The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
55
|
sequence length |
222
|
structure length |
182
|
Chain Sequence |
MSAQAAKVSKKELNSDETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEAMHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHSSKSTEIKWKSGKDMFFTWFTADELGEVIKDDIWPNPLQYYLV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Relationship between the structure of SET/TAF-Ibeta/INHAT and its histone chaperone activity
pubmed doi rcsb |
| molecule keywords |
Protein SET
|
| molecule tags |
Protein binding
|
| source organism |
Homo sapiens
|
| total genus |
55
|
| structure length |
182
|
| sequence length |
222
|
| chains with identical sequence |
B, P, Q
|
| ec nomenclature | |
| pdb deposition date | 2006-12-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00956 | NAP | Nucleosome assembly protein (NAP) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | Arylsulfatase, C-terminal domain |
#chains in the Genus database with same CATH superfamily 3FS3 A; 5DAY A; 2E50 A; 3GYW A; 3HFD A; 3GYV A; #chains in the Genus database with same CATH topology 3FS3 A; 5DAY A; 3GYV A; 4CXU A; 4CYS A; 4YYP A; 2VKZ G; 2E50 A; 1AUK A; 2UV8 G; 4HY2 A; 2I9Z A; 1F32 A; 1E3C P; 4HCO A; 2I9X A; 1E33 P; 3FVH A; 3BZI A; 3KDR A; 5LHZ A; 4N9J A; 4WHK A; 4X9V A; 1N2L A; 1HDH A; 4O6W A; 4LKL A; 4O56 A; 1FSU A; 4NKB A; 4FDJ A; 4HAB A; 3ED4 A; 5DMS A; 1E2T A; 4WHL A; 4CXS A; 1E2S P; 5DNJ A; 3P36 A; 3P2W A; 3LM3 A; 4NK7 A; 4O9W A; 4CYR A; 1E1Z P; 3HIK A; 4RS6 A; 1Q4O A; 4N7V A; 5AJ9 A; 4CXK A; 4E9C A; 3Q1I A; 4FDI A; 2N19 A; 5J19 A; 4WHH A; 4DFW A; 3C5L A; 4H71 A; 4G7N A; 3HIH A; 3P34 A; 2QZU A; 3LXQ A; 3HMJ G; 1P49 A; 3P2Z A; 4X9W A; 3HFD A; 4E9D A; 3P35 A; 4RCP A; 4H5X A; 4LKM A; 2OGQ A; 2OJX A; 3RQ7 A; 3P37 A; 1F34 B; 4XB0 A; 1UMW A; 4E67 A; 2IA9 A; 3GYW A; 5DMV C; 4X9R A; 4J7B B; 1N2K A; 1Q4K A; 4N7Z A; 1A87 A; #chains in the Genus database with same CATH homology 3FS3 A; 5DAY A; 4N7V A; 1HDH A; 5AJ9 A; 4CXK A; 4FDI A; 3GYV A; 1FSU A; 4CXU A; 4CYS A; 4NKB A; 2VKZ G; 2E50 A; 1AUK A; 2UV8 G; 4FDJ A; 1E3C P; 1E33 P; 3ED4 A; 1E2T A; 3GYW A; 4G7N A; 4CXS A; 2QZU A; 3KDR A; 1E2S P; 3LXQ A; 3HMJ G; 1P49 A; 1N2K A; 3LM3 A; 4N7Z A; 4N9J A; 4NK7 A; 4CYR A; 1E1Z P; 3HFD A; 1N2L A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...