The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
100
|
structure length |
100
|
Chain Sequence |
PIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the septum site-determining protein minC from Salmonella typhimurium
rcsb |
| molecule keywords |
Septum site-determining protein minC
|
| molecule tags |
Cell cycle
|
| source organism |
Salmonella typhimurium lt2
|
| total genus |
27
|
| structure length |
100
|
| sequence length |
100
|
| ec nomenclature | |
| pdb deposition date | 2009-03-03 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Transcription Regulator spoIIAA | Transcription Regulator spoIIAA |
#chains in the Genus database with same CATH superfamily 4L1C A; 3GHF A; #chains in the Genus database with same CATH topology 1HF2 A; 3ZTB A; 3GMF A; 3LLO A; 3ZXN A; 4QTP A; 4L8K A; 1V0E A; 2DXL A; 3NY7 A; 3VSE A; 3MGL A; 2DXN A; 3LDF A; 3IH9 A; 1WXW A; 2ZO9 B; 3JU4 A; 2KLN A; 1FC7 A; 4HYL A; 4AE2 A; 3DOR A; 2ZOA A; 5EUW A; 1H4Y A; 1FC6 A; 4L1C A; 4JC0 A; 2B78 A; 1SBO A; 1V0F A; 1J7X A; 4DGH A; 4DGF A; 2VY9 A; 5EZB A; 4DMG A; 4XS5 A; 1THN B; 5EUZ A; 2RRL A; 4GHN A; 4AEJ A; 3V8V A; 3EH7 A; 2OAS A; 3GK7 A; 3AGD A; 3IF5 A; 1VC1 A; 3IHA A; 3GHF A; 1H4X A; 1N6E A; 5EUU A; 3AGE A; 3OIR A; 1FC9 A; 3DJA A; 1K32 A; 1N6F A; 3K50 A; 3LKL A; 3F43 A; 3DUP A; 1FCF A; 1T6R A; 3MOG A; 3C0K A; 2CWW A; 1N6D A; 3GVJ A; 3D03 A; 5EUX A; 1WXX A; 4HIZ A; 2AS0 A; 1TID B; 3QDQ A; 3IHB A; 1TH8 B; 3T6O A; 3GVL A; 1BUZ A; 1BPL A; 3V97 A; 3OIZ A; 5EUS A; 1TIL B; 3GVK A; 3IH8 A; 3D3U A; 1AUZ A; 1H4Z A; 2KA5 A; #chains in the Genus database with same CATH homology 3DOR A; 1N6D A; 2ZOA A; 3D03 A; 1FC6 A; 3GHF A; 1N6E A; 3GMF A; 4L1C A; 4JC0 A; 1J7X A; 1BPL A; 1FC9 A; 4AE2 A; 3DJA A; 4L8K A; 2DXL A; 2DXN A; 1K32 A; 1N6F A; 3K50 A; 2ZO9 B; 2RRL A; 1FC7 A; 3DUP A; 4GHN A; 1FCF A; 4AEJ A; 3MOG A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
