The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
67
|
sequence length |
227
|
structure length |
210
|
Chain Sequence |
SPEFDCHLSDMLQQLHSVEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb |
| molecule tags |
Transferase
|
| source organism |
Homo sapiens
|
| molecule keywords |
Serine/threonine-protein kinase PLK1
|
| total genus |
67
|
| structure length |
210
|
| sequence length |
227
|
| ec nomenclature |
ec
2.7.11.21: Polo kinase. |
| pdb deposition date | 2010-10-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00659 | POLO_box | POLO box duplicated region |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | POLO box domain | ||
| Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | POLO box domain |
#chains in the Genus database with same CATH superfamily 3RQ7 A; 4XB0 A; 4HCO A; 4LKM A; 4RS6 A; 1UMW A; 4J7B B; 4E67 A; 3P35 A; 3Q1I A; 4RCP A; 4YYP A; 3P37 A; 3P2W A; 3P2Z A; 4WHL A; 4E9C A; 4HY2 A; 3HIH A; 3FVH A; 4WHK A; 5DNJ A; 4O56 A; 4HAB A; 1Q4O A; 4X9V A; 1Q4K A; 3BZI A; 4O6W A; 4X9W A; 4LKL A; 3P36 A; 5LHZ A; 4X9R A; 3C5L A; 4DFW A; 3HIK A; 4O9W A; 2OGQ A; 5DMV C; 3P34 A; 4H71 A; 4H5X A; 4E9D A; 5J19 A; 2OJX A; 5DMS A; 4WHH A; 2N19 A; #chains in the Genus database with same CATH topology 3FS3 A; 4HCO A; 4LKM A; 1UMW A; 4E67 A; 5DNJ A; 5DAY A; 4X9V A; 4FDI A; 5AJ9 A; 3P36 A; 3HIK A; 4O9W A; 1F32 A; 1HDH A; 1P49 A; 4E9D A; 2VKZ G; 2N19 A; 2UV8 G; 4XB0 A; 4RS6 A; 1FSU A; 4YYP A; 3ED4 A; 4WHL A; 4N7V A; 4O56 A; 4HAB A; 1Q4O A; 3KDR A; 1E2S P; 3BZI A; 3LM3 A; 4O6W A; 4LKL A; 1F34 B; 1AUK A; 4DFW A; 1N2K A; 4H71 A; 5J19 A; 2OJX A; 4WHH A; 3RQ7 A; 3LXQ A; 3Q1I A; 4N9J A; 3P37 A; 3GYV A; 1E3C P; 4E9C A; 1E33 P; 4HY2 A; 3HFD A; 4CXU A; 4CYR A; 1Q4K A; 4G7N A; 2E50 A; 3C5L A; 5DMV C; 2OGQ A; 4N7Z A; 3P34 A; 2QZU A; 4H5X A; 1E2T A; 5DMS A; 2I9X A; 4J7B B; 1A87 A; 3P35 A; 4RCP A; 3P2W A; 3P2Z A; 4CXK A; 3HIH A; 3FVH A; 4WHK A; 4NKB A; 4FDJ A; 1N2L A; 4X9W A; 4CYS A; 5LHZ A; 4X9R A; 3HMJ G; 1E1Z P; 3GYW A; 4NK7 A; 4CXS A; 2I9Z A; 2IA9 A; #chains in the Genus database with same CATH homology 3RQ7 A; 4XB0 A; 4HCO A; 4LKM A; 4RS6 A; 1UMW A; 4J7B B; 4E67 A; 3P35 A; 3Q1I A; 4RCP A; 4YYP A; 3P37 A; 3P2W A; 3P2Z A; 4WHL A; 4E9C A; 4HY2 A; 3HIH A; 3FVH A; 4WHK A; 5DNJ A; 4O56 A; 4HAB A; 1Q4O A; 4X9V A; 1Q4K A; 3BZI A; 4O6W A; 4X9W A; 4LKL A; 3P36 A; 5LHZ A; 4X9R A; 3C5L A; 4DFW A; 3HIK A; 4O9W A; 2OGQ A; 5DMV C; 3P34 A; 4H71 A; 4H5X A; 4E9D A; 5J19 A; 2OJX A; 5DMS A; 4WHH A; 2N19 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
