The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
47
|
sequence length |
216
|
structure length |
212
|
Chain Sequence |
HMRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the C. elegans ZYG-1 Cryptic Polo Box Suggests a Conserved Mechanism for Centriolar Docking of Plk4 Kinases.
pubmed doi rcsb |
| molecule keywords |
Serine/threonine-protein kinase PLK4
|
| molecule tags |
Transferase
|
| source organism |
Drosophila melanogaster
|
| total genus |
47
|
| structure length |
212
|
| sequence length |
216
|
| ec nomenclature |
ec
2.7.11.21: Polo kinase. |
| pdb deposition date | 2013-11-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF18190 | Plk4_PB1 | Polo-like Kinase 4 Polo Box 1 |
| A | PF18409 | Plk4_PB2 | Polo-like Kinase 4 Polo Box 2 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | Arylsulfatase, C-terminal domain | ||
| Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | Arylsulfatase, C-terminal domain |
#chains in the Genus database with same CATH superfamily 4N7Z A; 4N9J A; 4G7N A; 4N7V A; 4NKB A; 4NK7 A; #chains in the Genus database with same CATH topology 4O56 A; 3C5L A; 3KDR A; 1HDH A; 4WHH A; 4CYS A; 4X9W A; 4XB0 A; 3P36 A; 4E67 A; 4LKM A; 3LM3 A; 4G7N A; 3FVH A; 2E50 A; 4H71 A; 1E1Z P; 4CYR A; 4RS6 A; 3Q1I A; 4HCO A; 3GYW A; 3P34 A; 5DMV C; 2IA9 A; 5DAY A; 1E2T A; 2I9Z A; 1A87 A; 4WHL A; 4N7V A; 2N19 A; 2OJX A; 4YYP A; 4WHK A; 1AUK A; 4RCP A; 4CXK A; 3LXQ A; 1FSU A; 5AJ9 A; 4HAB A; 4LKL A; 1F32 A; 1UMW A; 4O9W A; 1N2K A; 4E9D A; 4N9J A; 1E3C P; 4NKB A; 1E33 P; 3HFD A; 2OGQ A; 2QZU A; 3BZI A; 1N2L A; 4N7Z A; 4E9C A; 3P2W A; 3HIK A; 4NK7 A; 4X9R A; 5J19 A; 5LHZ A; 4CXS A; 4HY2 A; 4O6W A; 3P2Z A; 3RQ7 A; 1Q4K A; 5DMS A; 3HIH A; 2VKZ G; 4FDJ A; 4CXU A; 1P49 A; 3GYV A; 4H5X A; 4FDI A; 3P37 A; 2UV8 G; 1Q4O A; 4DFW A; 3FS3 A; 2I9X A; 3ED4 A; 3P35 A; 3HMJ G; 1E2S P; 5DNJ A; 1F34 B; 4X9V A; 4J7B B; #chains in the Genus database with same CATH homology 3HFD A; 2VKZ G; 2QZU A; 4N7V A; 4FDJ A; 4CXU A; 3KDR A; 1HDH A; 1AUK A; 1P49 A; 3GYV A; 4CYS A; 3LXQ A; 4CXK A; 1N2L A; 1FSU A; 4N7Z A; 4FDI A; 3LM3 A; 4G7N A; 5AJ9 A; 4NK7 A; 2E50 A; 2UV8 G; 1E1Z P; 4CYR A; 3FS3 A; 1N2K A; 3ED4 A; 4CXS A; 3HMJ G; 3GYW A; 1E2S P; 5DAY A; 4N9J A; 1E2T A; 1E3C P; 4NKB A; 1E33 P;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
