The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
212
|
structure length |
203
|
Chain Sequence |
QLWPIRMDRLEGQRVCTAGGRYIVELDTRCRFEVAAQGNFVKRILIVEVDEMVQTVYVHRIPDRTVRGRNGEEELITLTNNPFVYTSYSQMPKEVQNDYMRLQKMVAVTISGRVAKVTFRRPSQFPDAQAQLMENGDLRIKLPRSVIVRKMDNGEIFNCQKQAVSGITLTKVNEVYKYLIRFEQCLNGMDRCFPIVFSAGTNM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the C. elegans ZYG-1 Cryptic Polo Box Suggests a Conserved Mechanism for Centriolar Docking of Plk4 Kinases.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| source organism |
Caenorhabditis elegans
|
| molecule keywords |
Probable serine/threonine-protein kinase zyg-1
|
| total genus |
46
|
| structure length |
203
|
| sequence length |
212
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
| pdb deposition date | 2013-11-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF18531 | Polo_box_2 | Polo box domain |
| A | PF18544 | Polo_box_3 | Polo box domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | Arylsulfatase, C-terminal domain | ||
| Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | Arylsulfatase, C-terminal domain |
#chains in the Genus database with same CATH superfamily 4N9J A; 4N7Z A; 4N7V A; 4G7N A; 4NKB A; 4NK7 A; #chains in the Genus database with same CATH topology 1Q4O A; 4LKM A; 3HIH A; 4E9D A; 1UMW A; 1AUK A; 4XB0 A; 4RS6 A; 2IA9 A; 4J7B B; 4WHK A; 2N19 A; 3P37 A; 4X9V A; 4O9W A; 1P49 A; 4E67 A; 2I9Z A; 4NK7 A; 4CYS A; 2QZU A; 3GYW A; 3GYV A; 1FSU A; 5J19 A; 2OJX A; 1HDH A; 4FDJ A; 3HFD A; 3ED4 A; 4WHL A; 4N7V A; 5DMV C; 4X9W A; 3P35 A; 2VKZ G; 1N2K A; 3FS3 A; 1A87 A; 4H71 A; 3BZI A; 1E33 P; 1Q4K A; 3P34 A; 5LHZ A; 2I9X A; 3RQ7 A; 3LM3 A; 4G7N A; 3FVH A; 2OGQ A; 4CXS A; 1F34 B; 1E2S P; 4N7Z A; 4O56 A; 2UV8 G; 1E3C P; 3HMJ G; 3LXQ A; 4CYR A; 3Q1I A; 5AJ9 A; 1E1Z P; 2E50 A; 4CXK A; 4O6W A; 4HY2 A; 4WHH A; 4DFW A; 3P36 A; 4FDI A; 4RCP A; 4LKL A; 4CXU A; 4HAB A; 4E9C A; 4X9R A; 5DNJ A; 4N9J A; 4H5X A; 1N2L A; 3KDR A; 3P2W A; 3HIK A; 4NKB A; 5DAY A; 3C5L A; 3P2Z A; 5DMS A; 1E2T A; 1F32 A; 4YYP A; 4HCO A; #chains in the Genus database with same CATH homology 3LM3 A; 4FDI A; 4G7N A; 4CYS A; 2QZU A; 4CXU A; 3GYW A; 3GYV A; 1FSU A; 1HDH A; 4FDJ A; 3HFD A; 4CXS A; 3ED4 A; 4N9J A; 1E2S P; 4N7V A; 4N7Z A; 1AUK A; 1N2L A; 2UV8 G; 1E3C P; 3KDR A; 1N2K A; 2VKZ G; 3FS3 A; 5DAY A; 4NKB A; 3HMJ G; 1E33 P; 3LXQ A; 4CYR A; 5AJ9 A; 1E1Z P; 2E50 A; 4CXK A; 1P49 A; 1E2T A; 4NK7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
