1B01A

Transcriptional repressor copg/dna complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of plasmid-encoded transcriptional repressor CopG unliganded and bound to its operator.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*CP*CP*CP*GP*TP*GP*CP*AP*CP*TP*CP*AP*AP*TP*GP*CP*A
total genus 13
structure length 43
sequence length 43
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1b01A00
4HV0A 2BJ1A 2AY0A 2CADA 2JXIA 1MYLA 2BJ3A 1EA4A 3H87C 4D8JA 1Q5VA 2BNZA 2BJ8A 1MYKA 3FT7A 2K9IA 2WVBA 1P94A 2CPGA 2K5JA 2WVDA 3QOQA 2CAJA 1BDTA 2BSQE 2K1OA 2JXGA 1PARA 2KELA 3VEAA 2WVFA 1QTGA 1MNTA 2JXHA 2H1OE 2RBFA 3LGHA 2BNWA 2WVCA 2BJ7A 3FMTA 2CAXA 3VW4A 2GPEA 2BA3A 1B28A 2WVEA 4FXEA 1U9PA 1ARQA 1IRQA 2CA9A 2K6LA 1ARRA 1NLAA 2HZVA 1X93A 1BDVA 1B01A 2K29A 2BJ9A 3OD2A 3GXQA 4ME7E 2HZAA 3VEBA 1BAZA
chains in the Genus database with same CATH superfamily
2BJ1A 1MYLA 2KKEA 3FT7A 2WVDA 2K5JA 2JBVA 2KELA 1QTGA 3LGHA 2BA3A 3BSOA 4FXEA 3H5YA 2K6LA 1ARRA 4LQ3A 3UQSA 2H3AA 4NRUA 2ADLA 2CKWA 2AY0A 3UPFA 2BJ3A 3LJPA 1EA4A 3H87C 2K9IA 1Q16A 3NAHA 3QOQA 2CAJA 2B43A 2BSQE 2KOEA 3VEAA 1MNTA 3NAIA 4QPXA 3UR0A 2BJ7A 2CAXA 3VW4A 3BSNA 1IRQA 3SFUA 2CA9A 1SH3A 2JXIA 4D8JA 2BJ8A 2WVBA 1BDTA 2K1OA 2JXGA 4NRTA 2WVFA 2RBFA 2WVCA 3FMTA 2AN7A 3G5OA 2GPEA 2Q2KA 1U9PA 3NNEA 3SFGA 2UUWA 1OG7A 2HZVA 1NLAA 1BDVA 3NO7A 1B01A 4O4RA 3GXQA 4ME7E 2HZAA 3VEBA 4LQ9A 1SIWA 1BAZA 4HV0A 1OHNA 3QIDA 2CADA 4LRVA 1Q5VA 2BNZA 1MYKA 1P94A 1SH2A 2CPGA 1PARA 2UUTA 1SH0A 2JXHA 2H1OE 3H5XA 1B28A 2WVEA 1ARQA 2WK4A 4MJWA 2A2BA 1X93A 4AAIA 3IR7A 2K29A 2BJ9A 3OD2A 2BNWA
chains in the Genus database with same CATH topology
4HV0A 2BJ1A 2AY0A 2CADA 2JXIA 1MYLA 2BJ3A 1EA4A 3H87C 4D8JA 1Q5VA 2BNZA 2BJ8A 1MYKA 3FT7A 2K9IA 2WVBA 1P94A 2CPGA 2K5JA 2WVDA 3QOQA 2CAJA 1BDTA 2BSQE 2K1OA 2JXGA 1PARA 2KELA 3VEAA 2WVFA 1QTGA 1MNTA 2JXHA 2H1OE 2RBFA 3LGHA 2BNWA 2WVCA 2BJ7A 3FMTA 2CAXA 3VW4A 2GPEA 2BA3A 1B28A 2WVEA 4FXEA 1U9PA 1ARQA 1IRQA 2CA9A 2K6LA 1ARRA 1NLAA 2HZVA 1X93A 1BDVA 1B01A 2K29A 2BJ9A 3OD2A 3GXQA 4ME7E 2HZAA 3VEBA 1BAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HV0 A;  2BJ1 A;  2AY0 A;  2CAD A;  2JXI A;  1MYL A;  2BJ3 A;  1EA4 A;  3H87 C;  4D8J A;  1Q5V A;  2BNZ A;  2BJ8 A;  1MYK A;  3FT7 A;  2K9I A;  2WVB A;  1P94 A;  2CPG A;  2K5J A;  2WVD A;  3QOQ A;  2CAJ A;  1BDT A;  2BSQ E;  2K1O A;  2JXG A;  1PAR A;  2KEL A;  3VEA A;  2WVF A;  1QTG A;  1MNT A;  2JXH A;  2H1O E;  2RBF A;  3LGH A;  2BNW A;  2WVC A;  2BJ7 A;  3FMT A;  2CAX A;  3VW4 A;  2GPE A;  2BA3 A;  1B28 A;  2WVE A;  4FXE A;  1U9P A;  1ARQ A;  1IRQ A;  2CA9 A;  2K6L A;  1ARR A;  1NLA A;  2HZV A;  1X93 A;  1BDV A;  1B01 A;  2K29 A;  2BJ9 A;  3OD2 A;  3GXQ A;  4ME7 E;  2HZA A;  3VEB A;  1BAZ A; 
#chains in the Genus database with same CATH topology
 2BJ1 A;  1MYL A;  2KKE A;  3FT7 A;  2WVD A;  2K5J A;  2JBV A;  2KEL A;  1QTG A;  3LGH A;  2BA3 A;  3BSO A;  4FXE A;  3H5Y A;  2K6L A;  1ARR A;  4LQ3 A;  3UQS A;  2H3A A;  4NRU A;  2ADL A;  2CKW A;  2AY0 A;  3UPF A;  2BJ3 A;  3LJP A;  1EA4 A;  3H87 C;  2K9I A;  1Q16 A;  3NAH A;  3QOQ A;  2CAJ A;  2B43 A;  2BSQ E;  2KOE A;  3VEA A;  1MNT A;  3NAI A;  4QPX A;  3UR0 A;  2BJ7 A;  2CAX A;  3VW4 A;  3BSN A;  1IRQ A;  3SFU A;  2CA9 A;  1SH3 A;  2JXI A;  4D8J A;  2BJ8 A;  2WVB A;  1BDT A;  2K1O A;  2JXG A;  4NRT A;  2WVF A;  2RBF A;  2WVC A;  3FMT A;  2AN7 A;  3G5O A;  2GPE A;  2Q2K A;  1U9P A;  3NNE A;  3SFG A;  2UUW A;  1OG7 A;  2HZV A;  1NLA A;  1BDV A;  3NO7 A;  1B01 A;  4O4R A;  3GXQ A;  4ME7 E;  2HZA A;  3VEB A;  4LQ9 A;  1SIW A;  1BAZ A;  4HV0 A;  1OHN A;  3QID A;  2CAD A;  4LRV A;  1Q5V A;  2BNZ A;  1MYK A;  1P94 A;  1SH2 A;  2CPG A;  1PAR A;  2UUT A;  1SH0 A;  2JXH A;  2H1O E;  3H5X A;  1B28 A;  2WVE A;  1ARQ A;  2WK4 A;  4MJW A;  2A2B A;  1X93 A;  4AAI A;  3IR7 A;  2K29 A;  2BJ9 A;  3OD2 A;  2BNW A; 
#chains in the Genus database with same CATH homology
 4HV0 A;  2BJ1 A;  2AY0 A;  2CAD A;  2JXI A;  1MYL A;  2BJ3 A;  1EA4 A;  3H87 C;  4D8J A;  1Q5V A;  2BNZ A;  2BJ8 A;  1MYK A;  3FT7 A;  2K9I A;  2WVB A;  1P94 A;  2CPG A;  2K5J A;  2WVD A;  3QOQ A;  2CAJ A;  1BDT A;  2BSQ E;  2K1O A;  2JXG A;  1PAR A;  2KEL A;  3VEA A;  2WVF A;  1QTG A;  1MNT A;  2JXH A;  2H1O E;  2RBF A;  3LGH A;  2BNW A;  2WVC A;  2BJ7 A;  3FMT A;  2CAX A;  3VW4 A;  2GPE A;  2BA3 A;  1B28 A;  2WVE A;  4FXE A;  1U9P A;  1ARQ A;  1IRQ A;  2CA9 A;  2K6L A;  1ARR A;  1NLA A;  2HZV A;  1X93 A;  1BDV A;  1B01 A;  2K29 A;  2BJ9 A;  3OD2 A;  3GXQ A;  4ME7 E;  2HZA A;  3VEB A;  1BAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...