2GPEA

Structure of the dna-binding domain of e. coli proline utilization a (puta)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
47
structure length
47
Chain Sequence
GTTTMGVKLDDATRERIKSAATRIDRTPHWLIKQAIFSYLEQLENSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the DNA-binding domain of Escherichia coli proline utilization A flavoprotein and analysis of the role of Lys9 in DNA recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Bifunctional protein putA
total genus 14
structure length 47
sequence length 47
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.88: L-glutamate gamma-semialdehyde dehydrogenase.
pdb deposition date 2006-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2gpeA01
1BAZA 2K9IA 4ME7E 3VEAA 3FMTA 2KELA 2JXIA 1MYLA 2BNZA 2WVBA 2CPGA 2BNWA 3H87C 3VW4A 1B28A 3VEBA 2HZAA 3FT7A 4D8JA 1NLAA 2AY0A 3OD2A 3GXQA 2WVDA 1PARA 1ARQA 2CAXA 2GPEA 2K5JA 1BDTA 2BSQE 2CAJA 2WVFA 2BA3A 1EA4A 2K1OA 2WVEA 3LGHA 4FXEA 1MYKA 1P94A 1BDVA 1QTGA 2K29A 1MNTA 2BJ9A 1Q5VA 2BJ7A 2WVCA 3QOQA 1X93A 2BJ3A 2CA9A 2CADA 1B01A 2RBFA 2H1OE 2HZVA 4HV0A 1ARRA 1IRQA 1U9PA 2BJ1A 2JXHA 2BJ8A 2JXGA 2K6LA
chains in the Genus database with same CATH superfamily
1BAZA 2ADLA 2JXIA 4NRTA 2BNZA 1Q16A 3BSNA 3VEBA 3LJPA 4LQ3A 4LQ9A 2K5JA 2JBVA 2BSQE 2K1OA 3QIDA 4FXEA 1P94A 1QTGA 1MNTA 1Q5VA 2Q2KA 1X93A 4QPXA 1OHNA 1IRQA 3SFGA 2JXHA 2BJ8A 1SH0A 1PARA 1OG7A 2WVBA 2BNWA 2B43A 3NNEA 3VW4A 4D8JA 3SFUA 2AY0A 2WVDA 2GPEA 2CKWA 2CAJA 2WVFA 2WVEA 3LGHA 2AN7A 3NAIA 1SH2A 3QOQA 2BJ3A 2KKEA 2RBFA 1ARRA 4LRVA 2BJ1A 2K9IA 4ME7E 3VEAA 3H5XA 4O4RA 1B28A 2HZAA 1NLAA 3OD2A 3GXQA 2CAXA 3IR7A 1BDTA 2UUTA 1BDVA 3BSOA 2H3AA 2CADA 3NO7A 1B01A 3G5OA 1U9PA 2BJ7A 3UPFA 2JXGA 3H5YA 3FMTA 2KELA 4AAIA 1MYLA 2CPGA 1SH3A 3FT7A 3NAHA 4NRUA 1ARQA 3UQSA 1SIWA 2BA3A 4MJWA 1EA4A 2A2BA 1MYKA 2WK4A 2K29A 3UR0A 2BJ9A 2WVCA 2CA9A 2UUWA 2H1OE 2HZVA 4HV0A 2KOEA 3H87C 2K6LA
chains in the Genus database with same CATH topology
1BAZA 2K9IA 4ME7E 3VEAA 3FMTA 2KELA 2JXIA 1MYLA 2BNZA 2WVBA 2CPGA 2BNWA 3H87C 3VW4A 1B28A 3VEBA 2HZAA 3FT7A 4D8JA 1NLAA 2AY0A 3OD2A 3GXQA 2WVDA 1PARA 1ARQA 2CAXA 2GPEA 2K5JA 1BDTA 2BSQE 2CAJA 2WVFA 2BA3A 1EA4A 2K1OA 2WVEA 3LGHA 4FXEA 1MYKA 1P94A 1BDVA 1QTGA 2K29A 1MNTA 2BJ9A 1Q5VA 2BJ7A 2WVCA 3QOQA 1X93A 2BJ3A 2CA9A 2CADA 1B01A 2RBFA 2H1OE 2HZVA 4HV0A 1ARRA 1IRQA 1U9PA 2BJ1A 2JXHA 2BJ8A 2JXGA 2K6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAZ A;  2K9I A;  4ME7 E;  3VEA A;  3FMT A;  2KEL A;  2JXI A;  1MYL A;  2BNZ A;  2WVB A;  2CPG A;  2BNW A;  3H87 C;  3VW4 A;  1B28 A;  3VEB A;  2HZA A;  3FT7 A;  4D8J A;  1NLA A;  2AY0 A;  3OD2 A;  3GXQ A;  2WVD A;  1PAR A;  1ARQ A;  2CAX A;  2GPE A;  2K5J A;  1BDT A;  2BSQ E;  2CAJ A;  2WVF A;  2BA3 A;  1EA4 A;  2K1O A;  2WVE A;  3LGH A;  4FXE A;  1MYK A;  1P94 A;  1BDV A;  1QTG A;  2K29 A;  1MNT A;  2BJ9 A;  1Q5V A;  2BJ7 A;  2WVC A;  3QOQ A;  1X93 A;  2BJ3 A;  2CA9 A;  2CAD A;  1B01 A;  2RBF A;  2H1O E;  2HZV A;  4HV0 A;  1ARR A;  1IRQ A;  1U9P A;  2BJ1 A;  2JXH A;  2BJ8 A;  2JXG A;  2K6L A; 
#chains in the Genus database with same CATH topology
 1BAZ A;  2ADL A;  2JXI A;  4NRT A;  2BNZ A;  1Q16 A;  3BSN A;  3VEB A;  3LJP A;  4LQ3 A;  4LQ9 A;  2K5J A;  2JBV A;  2BSQ E;  2K1O A;  3QID A;  4FXE A;  1P94 A;  1QTG A;  1MNT A;  1Q5V A;  2Q2K A;  1X93 A;  4QPX A;  1OHN A;  1IRQ A;  3SFG A;  2JXH A;  2BJ8 A;  1SH0 A;  1PAR A;  1OG7 A;  2WVB A;  2BNW A;  2B43 A;  3NNE A;  3VW4 A;  4D8J A;  3SFU A;  2AY0 A;  2WVD A;  2GPE A;  2CKW A;  2CAJ A;  2WVF A;  2WVE A;  3LGH A;  2AN7 A;  3NAI A;  1SH2 A;  3QOQ A;  2BJ3 A;  2KKE A;  2RBF A;  1ARR A;  4LRV A;  2BJ1 A;  2K9I A;  4ME7 E;  3VEA A;  3H5X A;  4O4R A;  1B28 A;  2HZA A;  1NLA A;  3OD2 A;  3GXQ A;  2CAX A;  3IR7 A;  1BDT A;  2UUT A;  1BDV A;  3BSO A;  2H3A A;  2CAD A;  3NO7 A;  1B01 A;  3G5O A;  1U9P A;  2BJ7 A;  3UPF A;  2JXG A;  3H5Y A;  3FMT A;  2KEL A;  4AAI A;  1MYL A;  2CPG A;  1SH3 A;  3FT7 A;  3NAH A;  4NRU A;  1ARQ A;  3UQS A;  1SIW A;  2BA3 A;  4MJW A;  1EA4 A;  2A2B A;  1MYK A;  2WK4 A;  2K29 A;  3UR0 A;  2BJ9 A;  2WVC A;  2CA9 A;  2UUW A;  2H1O E;  2HZV A;  4HV0 A;  2KOE A;  3H87 C;  2K6L A; 
#chains in the Genus database with same CATH homology
 1BAZ A;  2K9I A;  4ME7 E;  3VEA A;  3FMT A;  2KEL A;  2JXI A;  1MYL A;  2BNZ A;  2WVB A;  2CPG A;  2BNW A;  3H87 C;  3VW4 A;  1B28 A;  3VEB A;  2HZA A;  3FT7 A;  4D8J A;  1NLA A;  2AY0 A;  3OD2 A;  3GXQ A;  2WVD A;  1PAR A;  1ARQ A;  2CAX A;  2GPE A;  2K5J A;  1BDT A;  2BSQ E;  2CAJ A;  2WVF A;  2BA3 A;  1EA4 A;  2K1O A;  2WVE A;  3LGH A;  4FXE A;  1MYK A;  1P94 A;  1BDV A;  1QTG A;  2K29 A;  1MNT A;  2BJ9 A;  1Q5V A;  2BJ7 A;  2WVC A;  3QOQ A;  1X93 A;  2BJ3 A;  2CA9 A;  2CAD A;  1B01 A;  2RBF A;  2H1O E;  2HZV A;  4HV0 A;  1ARR A;  1IRQ A;  1U9P A;  2BJ1 A;  2JXH A;  2BJ8 A;  2JXG A;  2K6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...