2K29A

Structure of the dbd domain of e. coli antitoxin relb
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of transcriptional autorepression of the Escherichia coli RelB/RelE antitoxin/toxin module.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Antitoxin RelB
total genus 14
structure length 50
sequence length 50
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2k29A00
2CAJA 2JXIA 1NLAA 2HZAA 2HZVA 2GPEA 4HV0A 1MNTA 2K9IA 2BJ7A 3QOQA 3VW4A 2RBFA 2WVBA 2BNZA 2BNWA 2K5JA 2BJ3A 3VEAA 1EA4A 1B28A 2K1OA 2CA9A 1X93A 2WVEA 2JXHA 4D8JA 2BJ8A 3LGHA 1BDTA 4FXEA 2WVDA 2K6LA 2CAXA 3FT7A 1ARRA 3H87C 4ME7E 2JXGA 2WVFA 2BA3A 1MYKA 2K29A 3VEBA 2BJ1A 1MYLA 2H1OE 1Q5VA 3GXQA 1BDVA 1QTGA 1P94A 3OD2A 2KELA 2BJ9A 1IRQA 2CPGA 1B01A 2BSQE 1U9PA 1BAZA 3FMTA 2AY0A 1ARQA 2CADA 1PARA 2WVCA
chains in the Genus database with same CATH superfamily
2GPEA 3LJPA 4LQ3A 4AAIA 2K5JA 1B28A 2CA9A 3NNEA 2AN7A 2BJ8A 3LGHA 3QIDA 2A2BA 4MJWA 3H87C 3BSNA 2JXGA 1MYKA 3G5OA 2BSQE 1IRQA 1B01A 1U9PA 2AY0A 1PARA 2CKWA 4LRVA 4HV0A 2K9IA 3VW4A 3H5YA 2BNZA 3VEAA 2UUTA 2K1OA 1X93A 2WVEA 3IR7A 4D8JA 1BDTA 2H3AA 1ARRA 2BJ1A 2KOEA 3OD2A 2KELA 2H1OE 1OG7A 3H5XA 2CAJA 2JXIA 1NLAA 2HZAA 3BSOA 2ADLA 2RBFA 2WVBA 2BJ3A 1EA4A 4NRUA 3UQSA 2JXHA 2B43A 2JBVA 4FXEA 2CAXA 3FT7A 4ME7E 2WVFA 2BA3A 2K29A 3NAHA 3UR0A 2UUWA 3VEBA 1Q5VA 1SH0A 3SFUA 1BDVA 1QTGA 1P94A 2CADA 2WVCA 1Q16A 2HZVA 4NRTA 1SIWA 1MNTA 2BJ7A 3QOQA 2KKEA 2BNWA 4O4RA 2Q2KA 2WVDA 2K6LA 1SH3A 1OHNA 3UPFA 2WK4A 1MYLA 4LQ9A 3GXQA 3SFGA 3NO7A 2BJ9A 1ARQA 2CPGA 4QPXA 1BAZA 3FMTA 1SH2A 3NAIA
chains in the Genus database with same CATH topology
2CAJA 2JXIA 1NLAA 2HZAA 2HZVA 2GPEA 4HV0A 1MNTA 2K9IA 2BJ7A 3QOQA 3VW4A 2RBFA 2WVBA 2BNZA 2BNWA 2K5JA 2BJ3A 3VEAA 1EA4A 1B28A 2K1OA 2CA9A 1X93A 2WVEA 2JXHA 4D8JA 2BJ8A 3LGHA 1BDTA 4FXEA 2WVDA 2K6LA 2CAXA 3FT7A 1ARRA 3H87C 4ME7E 2JXGA 2WVFA 2BA3A 1MYKA 2K29A 3VEBA 2BJ1A 1MYLA 2H1OE 1Q5VA 3GXQA 1BDVA 1QTGA 1P94A 3OD2A 2KELA 2BJ9A 1IRQA 2CPGA 1B01A 2BSQE 1U9PA 1BAZA 3FMTA 2AY0A 1ARQA 2CADA 1PARA 2WVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAJ A;  2JXI A;  1NLA A;  2HZA A;  2HZV A;  2GPE A;  4HV0 A;  1MNT A;  2K9I A;  2BJ7 A;  3QOQ A;  3VW4 A;  2RBF A;  2WVB A;  2BNZ A;  2BNW A;  2K5J A;  2BJ3 A;  3VEA A;  1EA4 A;  1B28 A;  2K1O A;  2CA9 A;  1X93 A;  2WVE A;  2JXH A;  4D8J A;  2BJ8 A;  3LGH A;  1BDT A;  4FXE A;  2WVD A;  2K6L A;  2CAX A;  3FT7 A;  1ARR A;  3H87 C;  4ME7 E;  2JXG A;  2WVF A;  2BA3 A;  1MYK A;  2K29 A;  3VEB A;  2BJ1 A;  1MYL A;  2H1O E;  1Q5V A;  3GXQ A;  1BDV A;  1QTG A;  1P94 A;  3OD2 A;  2KEL A;  2BJ9 A;  1IRQ A;  2CPG A;  1B01 A;  2BSQ E;  1U9P A;  1BAZ A;  3FMT A;  2AY0 A;  1ARQ A;  2CAD A;  1PAR A;  2WVC A; 
#chains in the Genus database with same CATH topology
 2GPE A;  3LJP A;  4LQ3 A;  4AAI A;  2K5J A;  1B28 A;  2CA9 A;  3NNE A;  2AN7 A;  2BJ8 A;  3LGH A;  3QID A;  2A2B A;  4MJW A;  3H87 C;  3BSN A;  2JXG A;  1MYK A;  3G5O A;  2BSQ E;  1IRQ A;  1B01 A;  1U9P A;  2AY0 A;  1PAR A;  2CKW A;  4LRV A;  4HV0 A;  2K9I A;  3VW4 A;  3H5Y A;  2BNZ A;  3VEA A;  2UUT A;  2K1O A;  1X93 A;  2WVE A;  3IR7 A;  4D8J A;  1BDT A;  2H3A A;  1ARR A;  2BJ1 A;  2KOE A;  3OD2 A;  2KEL A;  2H1O E;  1OG7 A;  3H5X A;  2CAJ A;  2JXI A;  1NLA A;  2HZA A;  3BSO A;  2ADL A;  2RBF A;  2WVB A;  2BJ3 A;  1EA4 A;  4NRU A;  3UQS A;  2JXH A;  2B43 A;  2JBV A;  4FXE A;  2CAX A;  3FT7 A;  4ME7 E;  2WVF A;  2BA3 A;  2K29 A;  3NAH A;  3UR0 A;  2UUW A;  3VEB A;  1Q5V A;  1SH0 A;  3SFU A;  1BDV A;  1QTG A;  1P94 A;  2CAD A;  2WVC A;  1Q16 A;  2HZV A;  4NRT A;  1SIW A;  1MNT A;  2BJ7 A;  3QOQ A;  2KKE A;  2BNW A;  4O4R A;  2Q2K A;  2WVD A;  2K6L A;  1SH3 A;  1OHN A;  3UPF A;  2WK4 A;  1MYL A;  4LQ9 A;  3GXQ A;  3SFG A;  3NO7 A;  2BJ9 A;  1ARQ A;  2CPG A;  4QPX A;  1BAZ A;  3FMT A;  1SH2 A;  3NAI A; 
#chains in the Genus database with same CATH homology
 2CAJ A;  2JXI A;  1NLA A;  2HZA A;  2HZV A;  2GPE A;  4HV0 A;  1MNT A;  2K9I A;  2BJ7 A;  3QOQ A;  3VW4 A;  2RBF A;  2WVB A;  2BNZ A;  2BNW A;  2K5J A;  2BJ3 A;  3VEA A;  1EA4 A;  1B28 A;  2K1O A;  2CA9 A;  1X93 A;  2WVE A;  2JXH A;  4D8J A;  2BJ8 A;  3LGH A;  1BDT A;  4FXE A;  2WVD A;  2K6L A;  2CAX A;  3FT7 A;  1ARR A;  3H87 C;  4ME7 E;  2JXG A;  2WVF A;  2BA3 A;  1MYK A;  2K29 A;  3VEB A;  2BJ1 A;  1MYL A;  2H1O E;  1Q5V A;  3GXQ A;  1BDV A;  1QTG A;  1P94 A;  3OD2 A;  2KEL A;  2BJ9 A;  1IRQ A;  2CPG A;  1B01 A;  2BSQ E;  1U9P A;  1BAZ A;  3FMT A;  2AY0 A;  1ARQ A;  2CAD A;  1PAR A;  2WVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...