2K29A

Structure of the dbd domain of e. coli antitoxin relb
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of transcriptional autorepression of the Escherichia coli RelB/RelE antitoxin/toxin module.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Antitoxin RelB
total genus 14
structure length 50
sequence length 50
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2k29A00
1U9PA 1NLAA 3VW4A 2WVFA 2JXHA 2BJ1A 2BJ3A 1B28A 2KELA 1MNTA 2H1OE 1X93A 2K1OA 2BA3A 4HV0A 4FXEA 2HZAA 2CAXA 1MYKA 3H87C 2CAJA 3FT7A 1P94A 3VEBA 2BNZA 1Q5VA 2AY0A 2JXIA 2JXGA 2CA9A 2BJ9A 2WVEA 3LGHA 1EA4A 3GXQA 1B01A 4ME7E 1IRQA 2K5JA 2K9IA 2BJ7A 3OD2A 2CPGA 3FMTA 2BNWA 2HZVA 1BAZA 2GPEA 2WVCA 2K6LA 1BDVA 3VEAA 1PARA 1MYLA 3QOQA 1QTGA 2BSQE 2K29A 1BDTA 1ARQA 2BJ8A 2CADA 2WVBA 4D8JA 1ARRA 2RBFA 2WVDA
chains in the Genus database with same CATH superfamily
1NLAA 2Q2KA 1OG7A 2H3AA 2HZAA 3H87C 2BNZA 2JXIA 2JXGA 2BJ9A 1EA4A 3GXQA 4MJWA 1IRQA 2K9IA 3FMTA 1SH3A 2HZVA 1MYLA 2ADLA 1QTGA 2BSQE 1ARQA 2BJ8A 3UPFA 2WVFA 3NNEA 2H1OE 2K1OA 2BA3A 2CKWA 2CAXA 3VEBA 3BSNA 3FT7A 1SH2A 2WVEA 1BAZA 2WVCA 3UR0A 1OHNA 3SFUA 2A2BA 4NRUA 2WVDA 1U9PA 3VW4A 3UQSA 2BJ1A 1X93A 4HV0A 2AN7A 1MYKA 2CAJA 4AAIA 2KKEA 2UUTA 2CA9A 1B01A 1SIWA 2KOEA 4ME7E 2UUWA 3OD2A 2BJ7A 2B43A 2CPGA 3SFGA 3H5YA 2K6LA 3VEAA 1PARA 3QOQA 3NO7A 3H5XA 4QPXA 2CADA 2WVBA 3QIDA 1ARRA 2RBFA 2JXHA 3NAHA 2BJ3A 1Q16A 1B28A 2KELA 1MNTA 2WK4A 4FXEA 3G5OA 1SH0A 1P94A 4LQ3A 1Q5VA 2AY0A 3LJPA 3IR7A 3LGHA 2K5JA 2BNWA 4LQ9A 2GPEA 1BDVA 2JBVA 4LRVA 4NRTA 4O4RA 2K29A 1BDTA 4D8JA 3BSOA 3NAIA
chains in the Genus database with same CATH topology
1U9PA 1NLAA 3VW4A 2WVFA 2JXHA 2BJ1A 2BJ3A 1B28A 2KELA 1MNTA 2H1OE 1X93A 2K1OA 2BA3A 4HV0A 4FXEA 2HZAA 2CAXA 1MYKA 3H87C 2CAJA 3FT7A 1P94A 3VEBA 2BNZA 1Q5VA 2AY0A 2JXIA 2JXGA 2CA9A 2BJ9A 2WVEA 3LGHA 1EA4A 3GXQA 1B01A 4ME7E 1IRQA 2K5JA 2K9IA 2BJ7A 3OD2A 2CPGA 3FMTA 2BNWA 2HZVA 1BAZA 2GPEA 2WVCA 2K6LA 1BDVA 3VEAA 1PARA 1MYLA 3QOQA 1QTGA 2BSQE 2K29A 1BDTA 1ARQA 2BJ8A 2CADA 2WVBA 4D8JA 1ARRA 2RBFA 2WVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9P A;  1NLA A;  3VW4 A;  2WVF A;  2JXH A;  2BJ1 A;  2BJ3 A;  1B28 A;  2KEL A;  1MNT A;  2H1O E;  1X93 A;  2K1O A;  2BA3 A;  4HV0 A;  4FXE A;  2HZA A;  2CAX A;  1MYK A;  3H87 C;  2CAJ A;  3FT7 A;  1P94 A;  3VEB A;  2BNZ A;  1Q5V A;  2AY0 A;  2JXI A;  2JXG A;  2CA9 A;  2BJ9 A;  2WVE A;  3LGH A;  1EA4 A;  3GXQ A;  1B01 A;  4ME7 E;  1IRQ A;  2K5J A;  2K9I A;  2BJ7 A;  3OD2 A;  2CPG A;  3FMT A;  2BNW A;  2HZV A;  1BAZ A;  2GPE A;  2WVC A;  2K6L A;  1BDV A;  3VEA A;  1PAR A;  1MYL A;  3QOQ A;  1QTG A;  2BSQ E;  2K29 A;  1BDT A;  1ARQ A;  2BJ8 A;  2CAD A;  2WVB A;  4D8J A;  1ARR A;  2RBF A;  2WVD A; 
#chains in the Genus database with same CATH topology
 1NLA A;  2Q2K A;  1OG7 A;  2H3A A;  2HZA A;  3H87 C;  2BNZ A;  2JXI A;  2JXG A;  2BJ9 A;  1EA4 A;  3GXQ A;  4MJW A;  1IRQ A;  2K9I A;  3FMT A;  1SH3 A;  2HZV A;  1MYL A;  2ADL A;  1QTG A;  2BSQ E;  1ARQ A;  2BJ8 A;  3UPF A;  2WVF A;  3NNE A;  2H1O E;  2K1O A;  2BA3 A;  2CKW A;  2CAX A;  3VEB A;  3BSN A;  3FT7 A;  1SH2 A;  2WVE A;  1BAZ A;  2WVC A;  3UR0 A;  1OHN A;  3SFU A;  2A2B A;  4NRU A;  2WVD A;  1U9P A;  3VW4 A;  3UQS A;  2BJ1 A;  1X93 A;  4HV0 A;  2AN7 A;  1MYK A;  2CAJ A;  4AAI A;  2KKE A;  2UUT A;  2CA9 A;  1B01 A;  1SIW A;  2KOE A;  4ME7 E;  2UUW A;  3OD2 A;  2BJ7 A;  2B43 A;  2CPG A;  3SFG A;  3H5Y A;  2K6L A;  3VEA A;  1PAR A;  3QOQ A;  3NO7 A;  3H5X A;  4QPX A;  2CAD A;  2WVB A;  3QID A;  1ARR A;  2RBF A;  2JXH A;  3NAH A;  2BJ3 A;  1Q16 A;  1B28 A;  2KEL A;  1MNT A;  2WK4 A;  4FXE A;  3G5O A;  1SH0 A;  1P94 A;  4LQ3 A;  1Q5V A;  2AY0 A;  3LJP A;  3IR7 A;  3LGH A;  2K5J A;  2BNW A;  4LQ9 A;  2GPE A;  1BDV A;  2JBV A;  4LRV A;  4NRT A;  4O4R A;  2K29 A;  1BDT A;  4D8J A;  3BSO A;  3NAI A; 
#chains in the Genus database with same CATH homology
 1U9P A;  1NLA A;  3VW4 A;  2WVF A;  2JXH A;  2BJ1 A;  2BJ3 A;  1B28 A;  2KEL A;  1MNT A;  2H1O E;  1X93 A;  2K1O A;  2BA3 A;  4HV0 A;  4FXE A;  2HZA A;  2CAX A;  1MYK A;  3H87 C;  2CAJ A;  3FT7 A;  1P94 A;  3VEB A;  2BNZ A;  1Q5V A;  2AY0 A;  2JXI A;  2JXG A;  2CA9 A;  2BJ9 A;  2WVE A;  3LGH A;  1EA4 A;  3GXQ A;  1B01 A;  4ME7 E;  1IRQ A;  2K5J A;  2K9I A;  2BJ7 A;  3OD2 A;  2CPG A;  3FMT A;  2BNW A;  2HZV A;  1BAZ A;  2GPE A;  2WVC A;  2K6L A;  1BDV A;  3VEA A;  1PAR A;  1MYL A;  3QOQ A;  1QTG A;  2BSQ E;  2K29 A;  1BDT A;  1ARQ A;  2BJ8 A;  2CAD A;  2WVB A;  4D8J A;  1ARR A;  2RBF A;  2WVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...