2K29A

Structure of the dbd domain of e. coli antitoxin relb
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
b'MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antitoxin RelB
publication title Structural mechanism of transcriptional autorepression of the Escherichia coli RelB/RelE antitoxin/toxin module.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 14
structure length 50
sequence length 50
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2k29A00
1Q5VA 1BDVA 2K1OA 4ME7E 1BAZA 1U9PA 2KELA 1MYLA 2WVDA 1IRQA 3FMTA 2K6LA 1BDTA 1PARA 1QTGA 2CAXA 2WVBA 4HV0A 1EA4A 2BJ8A 2BNZA 2HZAA 2BSQE 2BJ7A 2WVCA 3H87C 2BJ9A 2H1OE 2CADA 2HZVA 2WVFA 2JXIA 1ARQA 2CA9A 1NLAA 1MYKA 4D8JA 2CAJA 1MNTA 2JXGA 3LGHA 1P94A 1ARRA 2K9IA 2K29A 2BJ1A 2WVEA 1X93A 3QOQA 4FXEA 3VEBA 3GXQA 3VW4A 1B28A 2RBFA 3FT7A 2BA3A 3VEAA 2BNWA 2AY0A 2GPEA 2BJ3A 2K5JA 3OD2A 2CPGA 1B01A 2JXHA
chains in the Genus database with same CATH superfamily
1Q5VA 4ME7E 3LJPA 1U9PA 3IR7A 3UQSA 3UR0A 1IRQA 2K6LA 2WVBA 2BNZA 2ADLA 1OHNA 2BSQE 3H87C 3SFGA 2A2BA 2WK4A 4LRVA 4QPXA 1MNTA 2CKWA 3NAIA 4MJWA 3H5XA 1SIWA 2WVEA 1X93A 3QOQA 2RBFA 2JBVA 2GPEA 1Q16A 1B01A 2JXHA 1BDVA 1BAZA 3UPFA 1PARA 1MYLA 2WVDA 3FMTA 2CAXA 2HZAA 1SH0A 2KKEA 4O4RA 2WVFA 2Q2KA 1ARRA 2H3AA 3VEBA 3GXQA 3G5OA 4LQ3A 4NRUA 2BJ3A 2K5JA 3BSNA 2KELA 1ARQA 1SH2A 1BDTA 1QTGA 3H5YA 2BJ7A 2WVCA 2JXIA 2H1OE 2CADA 1SH3A 1NLAA 1MYKA 4D8JA 2CAJA 3BSOA 3LGHA 1OG7A 3NO7A 3NAHA 2K9IA 2K29A 2BJ1A 2B43A 3FT7A 4NRTA 4AAIA 2UUTA 2K1OA 4HV0A 1EA4A 2BJ8A 2BJ9A 2HZVA 4LQ9A 2CA9A 2JXGA 1P94A 3SFUA 4FXEA 3VW4A 1B28A 2BA3A 2UUWA 3VEAA 2BNWA 2AN7A 3QIDA 2AY0A 2KOEA 3OD2A 2CPGA 3NNEA
chains in the Genus database with same CATH topology
1Q5VA 1BDVA 2K1OA 4ME7E 1BAZA 1U9PA 2KELA 1MYLA 2WVDA 1IRQA 3FMTA 2K6LA 1BDTA 1PARA 1QTGA 2CAXA 2WVBA 4HV0A 1EA4A 2BJ8A 2BNZA 2HZAA 2BSQE 2BJ7A 2WVCA 3H87C 2BJ9A 2H1OE 2CADA 2HZVA 2WVFA 2JXIA 1ARQA 2CA9A 1NLAA 1MYKA 4D8JA 2CAJA 1MNTA 2JXGA 3LGHA 1P94A 1ARRA 2K9IA 2K29A 2BJ1A 2WVEA 1X93A 3QOQA 4FXEA 3VEBA 3GXQA 3VW4A 1B28A 2RBFA 3FT7A 2BA3A 3VEAA 2BNWA 2AY0A 2GPEA 2BJ3A 2K5JA 3OD2A 2CPGA 1B01A 2JXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q5V A;  1BDV A;  2K1O A;  4ME7 E;  1BAZ A;  1U9P A;  2KEL A;  1MYL A;  2WVD A;  1IRQ A;  3FMT A;  2K6L A;  1BDT A;  1PAR A;  1QTG A;  2CAX A;  2WVB A;  4HV0 A;  1EA4 A;  2BJ8 A;  2BNZ A;  2HZA A;  2BSQ E;  2BJ7 A;  2WVC A;  3H87 C;  2BJ9 A;  2H1O E;  2CAD A;  2HZV A;  2WVF A;  2JXI A;  1ARQ A;  2CA9 A;  1NLA A;  1MYK A;  4D8J A;  2CAJ A;  1MNT A;  2JXG A;  3LGH A;  1P94 A;  1ARR A;  2K9I A;  2K29 A;  2BJ1 A;  2WVE A;  1X93 A;  3QOQ A;  4FXE A;  3VEB A;  3GXQ A;  3VW4 A;  1B28 A;  2RBF A;  3FT7 A;  2BA3 A;  3VEA A;  2BNW A;  2AY0 A;  2GPE A;  2BJ3 A;  2K5J A;  3OD2 A;  2CPG A;  1B01 A;  2JXH A; 
#chains in the Genus database with same CATH topology
 1Q5V A;  4ME7 E;  3LJP A;  1U9P A;  3IR7 A;  3UQS A;  3UR0 A;  1IRQ A;  2K6L A;  2WVB A;  2BNZ A;  2ADL A;  1OHN A;  2BSQ E;  3H87 C;  3SFG A;  2A2B A;  2WK4 A;  4LRV A;  4QPX A;  1MNT A;  2CKW A;  3NAI A;  4MJW A;  3H5X A;  1SIW A;  2WVE A;  1X93 A;  3QOQ A;  2RBF A;  2JBV A;  2GPE A;  1Q16 A;  1B01 A;  2JXH A;  1BDV A;  1BAZ A;  3UPF A;  1PAR A;  1MYL A;  2WVD A;  3FMT A;  2CAX A;  2HZA A;  1SH0 A;  2KKE A;  4O4R A;  2WVF A;  2Q2K A;  1ARR A;  2H3A A;  3VEB A;  3GXQ A;  3G5O A;  4LQ3 A;  4NRU A;  2BJ3 A;  2K5J A;  3BSN A;  2KEL A;  1ARQ A;  1SH2 A;  1BDT A;  1QTG A;  3H5Y A;  2BJ7 A;  2WVC A;  2JXI A;  2H1O E;  2CAD A;  1SH3 A;  1NLA A;  1MYK A;  4D8J A;  2CAJ A;  3BSO A;  3LGH A;  1OG7 A;  3NO7 A;  3NAH A;  2K9I A;  2K29 A;  2BJ1 A;  2B43 A;  3FT7 A;  4NRT A;  4AAI A;  2UUT A;  2K1O A;  4HV0 A;  1EA4 A;  2BJ8 A;  2BJ9 A;  2HZV A;  4LQ9 A;  2CA9 A;  2JXG A;  1P94 A;  3SFU A;  4FXE A;  3VW4 A;  1B28 A;  2BA3 A;  2UUW A;  3VEA A;  2BNW A;  2AN7 A;  3QID A;  2AY0 A;  2KOE A;  3OD2 A;  2CPG A;  3NNE A; 
#chains in the Genus database with same CATH homology
 1Q5V A;  1BDV A;  2K1O A;  4ME7 E;  1BAZ A;  1U9P A;  2KEL A;  1MYL A;  2WVD A;  1IRQ A;  3FMT A;  2K6L A;  1BDT A;  1PAR A;  1QTG A;  2CAX A;  2WVB A;  4HV0 A;  1EA4 A;  2BJ8 A;  2BNZ A;  2HZA A;  2BSQ E;  2BJ7 A;  2WVC A;  3H87 C;  2BJ9 A;  2H1O E;  2CAD A;  2HZV A;  2WVF A;  2JXI A;  1ARQ A;  2CA9 A;  1NLA A;  1MYK A;  4D8J A;  2CAJ A;  1MNT A;  2JXG A;  3LGH A;  1P94 A;  1ARR A;  2K9I A;  2K29 A;  2BJ1 A;  2WVE A;  1X93 A;  3QOQ A;  4FXE A;  3VEB A;  3GXQ A;  3VW4 A;  1B28 A;  2RBF A;  3FT7 A;  2BA3 A;  3VEA A;  2BNW A;  2AY0 A;  2GPE A;  2BJ3 A;  2K5J A;  3OD2 A;  2CPG A;  1B01 A;  2JXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...