2H3AA

Structural basis for nucleic acid and toxin recognition of the bacterial antitoxin ccda
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKVENQEGMVEVARFIEMNGSFADENKDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Nucleic Acid and Toxin Recognition of the Bacterial Antitoxin CcdA
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/dna
molecule keywords 5'-D(P*AP*TP*AP*TP*GP*TP*AP*TP*AP*CP*CP*CP*G)-3'
total genus 8
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07362 CcdA Post-segregation antitoxin CcdA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.80 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 2h3aA01
2ADLA 2H3AA
chains in the Genus database with same CATH superfamily
3H5YA 4MJWA 1QTGA 4QPXA 2H1OE 1OHNA 1P94A 2UUTA 3LJPA 2BJ3A 1B28A 1U9PA 2K1OA 2WVEA 2BJ7A 2CA9A 3H87C 2CKWA 1B01A 3VEBA 4D8JA 4NRUA 3SFGA 2KKEA 1SIWA 3OD2A 2A2BA 2BNWA 1BAZA 2BA3A 1Q16A 3FMTA 2BJ9A 3NAHA 1EA4A 2KELA 2H3AA 1MNTA 2K5JA 3NNEA 4LQ3A 3QIDA 3LGHA 2BNZA 1SH2A 3IR7A 3UQSA 2CADA 4NRTA 4AAIA 3H5XA 2GPEA 3BSNA 1BDVA 4LQ9A 3VW4A 2WVCA 4LRVA 3VEAA 2RBFA 2AN7A 2JXGA 1ARQA 4HV0A 3G5OA 1SH3A 2BJ8A 3NO7A 2JXHA 3UPFA 3GXQA 1MYLA 2HZVA 3QOQA 3SFUA 1PARA 3FT7A 4ME7E 2CAXA 2K6LA 2AY0A 2WVBA 1ARRA 2HZAA 3UR0A 1NLAA 2BSQE 2CAJA 2B43A 2CPGA 2WVDA 2UUWA 1MYKA 3BSOA 2WVFA 4O4RA 1SH0A 2ADLA 4FXEA 2JXIA 2BJ1A 2JBVA 1BDTA 1Q5VA 3NAIA 2Q2KA 2K9IA 2WK4A 1OG7A 2KOEA 1IRQA 2K29A 1X93A
chains in the Genus database with same CATH topology
4AAIA 3H5XA 3BSNA 3UR0A 4NRUA 4LQ9A 4MJWA 3H5YA 2B43A 3SFGA 2KKEA 4QPXA 4LRVA 1OHNA 1SIWA 2AN7A 2UUWA 2A2BA 3BSOA 4O4RA 2UUTA 1SH0A 2ADLA 3LJPA 1Q16A 2JBVA 3NAIA 2Q2KA 3G5OA 1SH3A 3NAHA 3NO7A 3UPFA 2H3AA 3SFUA 3NNEA 4LQ3A 2WK4A 1OG7A 2KOEA 3QIDA 2CKWA 1SH2A 3IR7A 3UQSA 4NRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADL A;  2H3A A; 
#chains in the Genus database with same CATH topology
 3H5Y A;  4MJW A;  1QTG A;  4QPX A;  2H1O E;  1OHN A;  1P94 A;  2UUT A;  3LJP A;  2BJ3 A;  1B28 A;  1U9P A;  2K1O A;  2WVE A;  2BJ7 A;  2CA9 A;  3H87 C;  2CKW A;  1B01 A;  3VEB A;  4D8J A;  4NRU A;  3SFG A;  2KKE A;  1SIW A;  3OD2 A;  2A2B A;  2BNW A;  1BAZ A;  2BA3 A;  1Q16 A;  3FMT A;  2BJ9 A;  3NAH A;  1EA4 A;  2KEL A;  2H3A A;  1MNT A;  2K5J A;  3NNE A;  4LQ3 A;  3QID A;  3LGH A;  2BNZ A;  1SH2 A;  3IR7 A;  3UQS A;  2CAD A;  4NRT A;  4AAI A;  3H5X A;  2GPE A;  3BSN A;  1BDV A;  4LQ9 A;  3VW4 A;  2WVC A;  4LRV A;  3VEA A;  2RBF A;  2AN7 A;  2JXG A;  1ARQ A;  4HV0 A;  3G5O A;  1SH3 A;  2BJ8 A;  3NO7 A;  2JXH A;  3UPF A;  3GXQ A;  1MYL A;  2HZV A;  3QOQ A;  3SFU A;  1PAR A;  3FT7 A;  4ME7 E;  2CAX A;  2K6L A;  2AY0 A;  2WVB A;  1ARR A;  2HZA A;  3UR0 A;  1NLA A;  2BSQ E;  2CAJ A;  2B43 A;  2CPG A;  2WVD A;  2UUW A;  1MYK A;  3BSO A;  2WVF A;  4O4R A;  1SH0 A;  2ADL A;  4FXE A;  2JXI A;  2BJ1 A;  2JBV A;  1BDT A;  1Q5V A;  3NAI A;  2Q2K A;  2K9I A;  2WK4 A;  1OG7 A;  2KOE A;  1IRQ A;  2K29 A;  1X93 A; 
#chains in the Genus database with same CATH homology
 4AAI A;  3H5X A;  3BSN A;  3UR0 A;  4NRU A;  4LQ9 A;  4MJW A;  3H5Y A;  2B43 A;  3SFG A;  2KKE A;  4QPX A;  4LRV A;  1OHN A;  1SIW A;  2AN7 A;  2UUW A;  2A2B A;  3BSO A;  4O4R A;  2UUT A;  1SH0 A;  2ADL A;  3LJP A;  1Q16 A;  2JBV A;  3NAI A;  2Q2K A;  3G5O A;  1SH3 A;  3NAH A;  3NO7 A;  3UPF A;  2H3A A;  3SFU A;  3NNE A;  4LQ3 A;  2WK4 A;  1OG7 A;  2KOE A;  3QID A;  2CKW A;  1SH2 A;  3IR7 A;  3UQS A;  4NRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...