2HZAA

Nickel-bound full-length escherichia coli nikr
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NikR-operator complex structure and the mechanism of repressor activation by metal ions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Nickel-responsive regulator
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2hzaA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2hzaA02
4ME7E 2NZCA 3H87C 2BJ7A 2WVDA 2K6LA 1BAZA 2WVEA 2WVCA 2CAXA 3GXQA 2K1OA 2FGCA 1IRQA 1P94A 1B28A 3VEBA 1U9PA 1MYLA 2KELA 3LGHA 4D8JA 2K29A 2K5JA 1NLAA 1ARQA 2CAJA 2HZAA 3PHTA 1MYKA 3QOQA 1PARA 3BKFA 2JXHA 2BNZA 2CADA 3OD2A 2CA9A 2JXGA 2HZVA 1QTGA 2AY0A 1MNTA 4FXEA 2BJ1A 3FMTA 1EA4A 2JXIA 3QSIA 2BJ3A 2WVFA 1BDVA 2BJ9A 3BKTA 1Q5VA 1BDTA 2F1FA 2GPEA 3FT7A 1Q5YA 1B01A 1ARRA 2RBFA 3VEAA 2BSQE 2PC6A 2CPGA 3VW4A 1X93A 2WVBA 4HV0A 2H1OE 2Y3YA 2BA3A 2K9IA 2BJ8A 3BKUA 2BNWA
chains in the Genus database with same CATH superfamily
3HSGA 1NPPA 1Q4RA 4D3HA 1RA7A 2D69A 4HLBA 3A13A 1HI0P 1BQMB 4LRAA 2JOQA 3C46A 1FDDA 4P72A 1DAXA 4PCQA 2EG2A 1SUQA 2J9DE 2IY5B 3HCXA 1RT1A 4LF5F 3J7AN 4NRTA 1J2VA 2BZ2A 3DMJA 3MM6B 3TR5A 3OPKA 4JBCA 1FWLA 5CZXA 2E9ZA 2EC2A 5KG5A 3DGPB 4G1IA 4DOZA 2QTWA 3RGIA 4OHYA 2YWKA 3W63A 8AT1B 1RWVB 1S7IA 3P45B 4WP3A 4F4WA 4UT4A 4O3QA 1UVIA 2HRUA 3MTJA 4CLZA 5A8WA 5CA5A 5F8HA 1XMOF 1NUEA 2CJAA 1VBZA 1N6QA 1N0UA 3D68A 4USMA 4NZ0A 4CO3A 3BSNA 1HBNB 1YITS 1KEKA 1B4SA 4ZPWR 5EDWA 1Q81T 5JUMA 4M5GA 2GO8A 3VALA 2R7UA 2MYFA 4YB1P 1HBUB 3OFHA 4HACB 4CLPA 2HHWA 3G87A 4PPDA 5CHCB 2RE1A 4DF4A 3P5TL 4Q45A 1AW0A 1RWOB 1RBLA 3CC4S 1WTBA 1HLWA 7AT1B 3PV8A 2HAFA 3NS7B 1M90T 3M4XA 2JXGA 2AX1A 2OO4A 2W2OP 4C8OA 1EA4A 1D9DA 3DLKB 2J8SA 3M2UB 1MROA 3GJRB 3HZGA 4DLEA 4ECUA 2QLFB 4OV1A 2B8PA 3GPAA 3KFWX 4KIAA 2RB7A 4ID8A 4J5OA 3JB9k 3VAHA 2IM2A 2YBVA 4GMKA 2QYCA 2JX2A 1TFYA 4K4ZA 2FJAB 3VW4A 3OTDA 5KFLA 3PYEA 4ILRA 2RUGA 3NAHA 1RT3A 1R8BA 2G2OA 4K4VA 1UJ5A 3JQKA 4DV1F 3HULA 2F65A 4CM0A 2YPZA 1X4HA 1Y5NB 3PFOA 4YHHF 2E7XA 2J5AA 3CCQS 4DL3A 2BEFA 3PXGa 4QYZK 2LQJA 2FJDB 3W2VB 5T14A 4OX9J 3TUJC 3H40A 5LT5A 3TJAA 5HROA 1E6VA 4EI2A 2VG7B 4QIEA 2YNGB 3K2YA 3U02A 4ZITA 3A1YG 5C24A 3TX0A 4DZDA 2I1RA 1UA1A 3KLVA 2NUHA 3PO5A 1HNWF 5CYQA 4ZCMA 4KO0A 5ETLA 1WG5A 1IXKA 4RUCA 5KFPA 2HHVA 3HD2A 1L3KA 1TKZA 2GVZB 4OL8A 2F9DA 5A0YB 2H51B 3M32B 2BOAA 2ZEJA 3R27A 4F36A 5LMNF 2AEJA 2MZQA 3C15A 3EYZA 2BE2A 1QSLA 3QRQA 3MWBA 3F73A 2VU5A 5BR8F 3HFVA 1SPBP 1VQPS 1RB0A 1BUXA 1TELA 3HDSA 4DWIA 2AYBA 1EIYB 3GP9A 1OS5A 1RAHB 4O4GB 3M8SA 5DDQC 4PRFA 1GH8A 3R7NB 3OTOJ 5DGAA 1IBMJ 2NYIA 1JWWA 3TZWA 3OVAA 2QG9B 4F4KA 4NA2A 2YNIB 2W2QP 3DFEA 1FERA 1EZZB 2ZOMA 3DI6A 2VG5A 3GMGA 4I2PB 4NA3A 4P52A 4K0KJ 4ZK7M 3NEKA 3FC9A 5T41A 1WEZA 2WTFA 3N6NA 1FNXH 2CJXB 5GAEU 4ETZA 2XG8A 4F3MA 5H9FK 1KFSA 1CJVB 4DPUA 1RAFB 2ZH2A 1WF1A 1UFLA 2KZMA 2UVUA 1EQ0A 3UQSA 2DNRA 2HBQB 4NMLA 4MT1A 4ZJQA 2B51A 2I38A 1BHNA 2Y3YA 2GGPA 5HJYA 1K9MT 3AA9A 2ADLA 2FTRA 2HGMA 3HT3A 1EP4A 2NXUA 1SKSA 1GAOA 3QO9A 3F0NA 2CNKB 3DOMA 4H4MA 3WHIA 2XYHB 4LF5J 5CCMA 2B4PA 1IKWB 2MZJA 1NJYA 3ET6B 2ZJRQ 3FEZA 3J7Z5 1RT7A 1RTIA 4IFVB 3ETOA 1YTYA 2WCXA 1J5OB 4I6AA 2KXFA 3B4MA 1UEVA 2ZH1A 1X8DA 3AD8C 4M5MA 3NNCA 3MMCA 4QOTA 5CQGA 2EFVA 4WFBQ 4JV5F 5I3QA 4K50A 4ANCA 3K58A 1CJVA 4PQAA 2RU3A 3CTRA 4CO0A 3HHNB 4LF1A 1RT3B 4DUZF 1H0HB 2B9XA 1HNZJ 1IQTA 4AE5A 5AT1B 1E6YB 3C16A 3ZC4A 1UWBA 4K4SA 4LSLB 4K5RA 1JJ4A 1HQEB 4OFZA 3DOLB 4WFNQ 1YX2A 1ZAXA 1KQFB 2PEBA 1EB0A 3CCVS 3GFHA 2VG7A 1JMTA 4XAKA 3GQCA 2DHAA 1IN0A 4QBUA 2ZH6A 1M5SA 2UU9J 1WORA 3BDEA 1K0VA 3D0GE 1ARQA 1EQMA 4OIXA 3H4DA 5CCLA 2R8IA 2JXHA 2FZKB 2FGOA 2Q1LA 4B3MF 1WC4A 1JK9B 4FXWA 2C2NA 1NK9A 5IT9U 4MK9A 3GJQB 2V9WA 5J2PB 3ENVA 1ZM3A 1R8PA 4YDXA 2UXBF 1SCJB 1FKOB 1FRXA 2DNMA 2HK3A 3T19A 4LF8J 5HMXA 2ZC4A 3RB3A 3NS6A 1FD8A 3MEGB 4RWXA 1IR0A 2BE2B 4U67Q 5E33A 3W5YA 1NK8A 3CIZA 1YJ9S 1N8RT 1JLBA 4ED4A 2X1AA 4DG1A 1S1UB 3G82A 1YJUA 3M8YA 5A8KA 3Q2SC 1XWLA 2VQFF 5A2QY 2ROPA 2C3UA 2IDEA 1LK5A 1ZAWA 2OSRA 4LRFA 4JI4J 3DI6B 4TLQA 1RK8A 4RW9A 2D1CA 5B0DA 2ZZTA 1X4EA 4XDDA 1S0MA 3FMWA 2L48A 2HBRB 4A8OA 3WIVA 2BACA 1HHQA 4A48A 4OI1A 2RHQB 3D1HA 1ZM2A 3IGNA 3KXDA 2IFXA 4QWAA 4OZLA 1XNQF 4B3TJ 2BJDA 4ICLA 2YKOA 3R7BB 2R2SA 2FDNA 5BR8J 1CJTB 2D3UA 4IH6A 5I3UB 3ZTSA 1HI8A 2OP5A 3R5JB 4MYUA 2ASYA 2WVCA 4CLTA 5IFMA 4ILMA 3EWGA 2CFXA 1TL1B 5AJ3J 5GADU 4K4XA 1DQAA 3UNYA 1YIJS 4P74A 3KHGA 2XS5A 4J91A 4CIOA 2K5JA 3KLFB 4J9RA 1NLAA 1RHKB 2VFUA 3EZUA 2DTJA 2GJ2A 4LRBA 1IUJA 3DMJB 5IWAJ 3PCOB 4UY85 1T7PA 3QJJA 1CS4B 4FXEA 2IM1A 3K7RA 3BH7B 3KYLA 2LFVA 3HHLD 4DL2A 3H5UA 4DQPA 3HVTB 1KN6A 3K5LA 2AU0A 2Q6BA 1FX4A 5IT0A 1U2FA 5KFHA 4ED1A 2XB2D 4ZJOA 1Q79A 4HTIA 1MG7A 3TX8A 3FNNA 2K9IA 3VAJA 2P9CA 2XEXA 4OJHA 4LF2A 4N47A 5KFGA 1FDAA 3VR1A 3VAFA 3MR5A 4V19J 4AD6A 3E51A 1TAQA 2J6UA 1QAXA 2MHEA 3GFXA 4C11A 4Z2XA 5LSOA 3T6BA 4YQWA 3UW1A 4I7FA 4KV8A 5B7WA 3J81Y 2DXFA 1NDKA 4ZPCA 4QWCA 3OSNA 2RQCA 2MXYA 4OV6A 4QIFA 1BLUA 4WBFA 2B4OA 2GX8A 2F8MA 3PEJA 3QSIA 5JVHQ 4RU2A 1HYSB 3MMBB 1R7IA 2DRAA 3OL8A 4HL9A 3CE8A 4DV5J 4BDPA 1S0NA 1HMVB 4JV5J 2V50A 3RR8A 2VDHA 1ZZNA 2PFFB 1XNRJ 4P2XA 2XZTB 3OSPA 1NB7A 2FVRA 4WPAA 1G1XA 4ATNA 2XMVA 4EBDA 2OHDA 3TARA 1NJXA 3HJVA 1FRJA 3MPDA 3I0RA 2B4UA 5KAKA 1SJFA 3RRGA 1EETA 1TL3A 3UE2A 2L9DA 2Z4PA 4DL4A 2LQ8A 2JRSA 1HW8A 3V6JA 4NCAA 2FGCA 2YQ3A 1RYSA 3ICLA 1XN9A 3IBCB 1ZM4A 3CJRA 4J9SA 1UW4A 1WNEA 1S48A 1U9PA 4OYXA 3WBZA 5ADZA 2XHWA 3HFZB 1S1TA 1ZA2B 2KHCA 2ZC3A 1K47A 4PG8A 4EBEA 4C11B 2Y1JA 2IYGA 1TKTB 2F40A 4H4OA 4ECSA 3BGFA 4IG3B 4DPWA 2G9OA 2HGNA 2BJ1A 4FZVA 4ZPBA 2UUCJ 2NXNA 3QZ7A 2BJ9A 2RDJA 2LVWA 4ED3A 2Z0GA 4JI3F 1DQ9A 3MR6A 4DL7A 2R7XA 3BYPA 2VQEJ 2FVQA 1OY8A 1SQGA 1PYSB 2C2EA 3CDUA 2EC0A 4HVZA 1DTQA 2QSFA 3GIIA 3CJ5A 1U8SA 2O3DA 2QSWA 2D41A 3MEDB 1C2PA 1HW9A 4LBPA 4F7VA 4F3QA 3MAQA 2UZAA 1TL1A 3BR8A 4C3LA 5D6GA 3Q22A 2JJ4D 2VOPA 1H2VZ 4FF4A 3UD5A 3BBCA 2WBMA 4IFYB 1T94A 3VVTA 2V9KA 1O0PA 3PKYA 1S1VA 1VMBA 1YRTA 2RRBA 3JAMY 2E1CA 1S12A 1X0PA 1LWFA 2MZSA 4G1QB 1GX6A 3VZIA 1QVGR 3BH6B 3KLFA 4JI6J 2RHSB 4R5PB 1XERA 3DOKB 4CLSA 3MAAA 5C25B 1U24A 1RWKB 3N28A 3M05A 2WVFA 2DNOA 2CJYB 4RLEA 4J9MA 2UVRA 4LFCJ 2HS0A 3KG0A 4UZBA 1NZ8A 2ZJQQ 5BYQA 3NWGA 2CXEA 5EWGA 4ILLA 3GTYX 3TI0A 3D0HE 3AXMA 2HHTA 4F4AA 3VCDA 2WSFC 3LANA 1OYDA 3BBBA 3HKZD 3M1VB 4KPCA 1HNVB 4NLPA 1YRUA 4UOCA 4Q7AA 5ETQA 1KQKA 3KLHA 1WELA 4F25A 3RB4A 1LWXA 3PZPA 1VQNS 1HPZA 2N4DA 2KRBA 2V8DA 5H9FJ 1IBMF 2OAUA 3IG1A 4DPYA 4KB7A 2V5HG 2BANB 3R8YA 1XQIA 2KL8A 4NI2A 3TAPA 1S1WA 5IM0B 1K1QA 3DYAA 3H2VE 2W01A 4JV1A 2MZRA 3K8WA 1YI2S 3AD7C 2MHNA 2HEKA 3DHXA 2XI2A 2A0FB 3IM9A 4I67A 1HWLA 1LWFB 2KHDA 2MZTA 3GZ7A 2E29A 1M0SA 3TQEA 4DHVA 1CQMA 3HK2A 1NHUA 3DDNA 3SDEB 2DRDA 2PD1A 1ACMB 3MGJA 4LUBA 4ZVRB 4XO0A 1X0FA 3MMBA 2HWHA 2ZZNA 1U25A 3W3SA 2LQBA 1U6ZA 1T9XA 2FD2A 1AB8A 3DLEB 2MQMA 3D4JA 5DG8A 2V4QA 4ALZA 2AGQA 5A6WA 4OYIA 5F8JA 1H7XA 2XSJA 5BYRA 5E3QA 1ITPA 3HVRA 1NSKL 3GG1A 1RT6A 4HH1A 2DGQA 3ZTRA 3CULA 2PFDA 4LBHA 3D3BJ 1FRLA 3NRBA 4UUXA 4WU3A 2YNGA 2ALZA 2CAXA 1NJWA 1NKCA 4DR7J 3CD5A 4RPFA 2V8PA 3VQSA 4B17A 1CJUB 3BGRB 3O3LA 4CM2A 1LOUA 1MWZA 1O6XA 4DR6F 3OXLA 3HHKA 1NXIA 2E44A 3EGVA 4MH8A 1NM2A 3G5OA 4QPTA 3MM7B 1S9EB 2J9DA 4TU7A 3CDEA 1HD0A 3V4IA 2PI5A 4O3RA 6AT1B 4RW7A 5KOXA 4DV5F 3QBCA 1SH2A 2HRTA 2ZDOA 2E1PA 4Y2AA 2B43A 4A4JA 4C97A 2RD5C 3D3CJ 1F3FA 3VQTA 4F50A 2FHJA 1VS3A 3DHWC 2BE9B 2O1PA 4PEOA 3K59A 5RUBA 1DZ5A 3RU0A 1I51B 2YKAA 2OI2A 2PA8D 4J9NA 3C19A 4IRDA 1QLNA 1Q8KA 4GVBA 5HATA 1YJWS 2AJ1A 1CEZA 1U0HB 1UTAA 1RT6B 2GJFA 2J76E 3KDOA 5E3AA 2VG5B 2R7TA 4FVMA 3V81A 2MTLA 1D0EA 4PUOA 1WKJA 3MR2A 3W64A 5L1LA 2GHVC 2MLZA 2WSEC 1Z1ZA 4KE5A 4DR1J 3RZAA 2APOA 1VQMS 1D3WA 3CEDA 4C9DA 4TQRA 3IA0A 3T1AA 1ZTTA 3HP6A 3F41A 3Q8RB 2ZITA 2CUYA 3OTOF 3KLIB 5K5MA 1GXLA 2HWTA 4RW7B 4E0DA 2IMWP 4OYBA 2CJKA 4LF7J 5KFJA 1M5OC 5L9NA 1FEHA 2F8EX 4W4MA 2IVFB 4Q0BB 2RQ4A 3OUYA 2DJWA 1KTQA 1MWQA 3QT6A 1UETA 1FT8A 1YRXA 5B09A 1VJQA 4DFJA 2XBPA 3BBFA 4J7CA 2J9CA 5KFFA 4MIBA 4BS2A 1PBAA 5J1PA 2W8KA 3KLHB 2SXLA 3UDEA 2UUBJ 4OQJA 4MAKA 2R7VA 1MMNA 4ECVA 2MQ8A 2ZD1B 1IBCB 3QIPB 1CPZA 3SFGA 1C4AA 4J37A 2ERRA 3R5GA 3W61A 2I5JA 1NK6A 3SDEA 1OWXA 4RW4A 1UVNA 1S6PB 5K20B 1U1QA 4LVNP 1CS4A 4OZ2A 1P6TA 2HAIA 2D3OR 3AOAA 2HFOA 1RP5A 3JSRA 2VV5A 3MXHP 4B3OB 4QJVA 3M8ZA 2HBYB 2ZBRA 3NGDA 2WOMB 4JV0A 2ZWPA 1RBOB 1AT1B 4UF4A 5DQHA 4XPEA 1WSRA 1H38A 2ROEA 2Y0BB 4ECXA 2E1MC 1L3SA 2CQGA 2RF2A 2Y0SD 4ZPTR 3GYXB 1JLFA 4IOCQ 1R31A 2DR5A 3NAIA 4DG1B 2BV3A 1GTEA 1JNZB 1GQEA 3D2WA 2CPEA 4DL6A 4KT0C 5HAOA 4CLKA 3QGHA 4C8YA 2IHR1 1VBYA 4CO2A 4URSA 1YJVA 4FPRA 3T1HF 3VZHA 1SQFA 4F4YA 1FDNA 4K59A 2ZH8A 4FF1A 3V4IB 4FS2A 3OD2A 1T3OA 2HIYA 3GFZA 4NOHA 4WFZA 3HM9A 1IKVA 1KNZA 1YZ6A 9ATCB 2RH3A 3FRYA 4XDCA 1SBRA 5DLGA 2I5JB 2OD4A 1G7CB 3H2LA 1WEXA 4K2XA 2OLWA 5D15A 1PILA 4A47A 5DJBA 3GIKA 3QIDA 4ECTA 3KNAA 4USJC 3NMAA 4JYAJ 4CNYA 4K7QA 1U26A 2YWWA 3FKBA 1NSQA 1V3RA 2VPZB 4EU0A 4JI1F 2CVEA 2WOMA 3GR0A 5DETA 1D1UA 4GKKJ 2XI3A 3W66A 1B0VA 3H2UB 4JI0F 2W9CA 2VFVA 2RF2B 4LQ9A 2RT3A 3C6UA 4MIWA 4X4NA 4JV2A 4ZLPA 2MKCA 3Q23A 1VC6A 4DR2J 1SIZA 2ALYB 1FTCA 3AHPA 3ISNC 1KVJA 2UUWA 2XCPA 2WRMA 3D0IE 3H90A 1WOPA 3NNAA 1RJJA 4IRCA 2LQ9A 1QUVA 2Z30B 3R6LB 2COLA 5IZHA 2F4VF 2VD3A 1TL4A 3V6HA 2K1RA 3TP2A 4FF2A 1ZTWA 4QCLA 4O44A 2XTJP 4JI3J 1N34J 2D9OA 2MJNA 3KUEA 5FLXY 1PSDA 4P10A 1Q5YA 2DCLA 4DX8H 2XMKA 2BYCA 2BOPA 3RW6A 3LWMA 2HG4A 2PC6A 2BW2A 3ILOA 4NYPA 4P2MA 5D3GA 4ZDNA 3KK3B 2WW4A 4O3NA 2HHSA 3CJ4A 1LW2B 3B54A 4Q2LA 2MEWA 3L4BC 2QMWA 4LR9A 1YJTA 3H5SA 3JQMA 4RNFA 3CCJS 2GGPB 2AEFA 1Y5LB 4I4BA 4LR7A 2CVIA 5HROB 2WB4A 1P27B 2ZVIA 3MPWA 4ZKAA 2D3O1 1WHVA 1FNOA 1C0UA 2YH1A 3FBCA 2ZNYA 3P5BP 1XNQJ 3KJVA 3IAS9 2X1FA 1NU4A 4C7QA 3QMQA 2CAJA 1TUVA 3J81j 1MYKA 1YSJA 1FKAF 2NR0A 1TP7A 2LA6A 1RT7B 4XTTA 3I56S 2UUCF 3HVTA 2HWIA 4NLTA 2MLXA 2QFIA 5AXNA 5GAEI 3MZIA 1JXVA 7FDRA 2DISA 4KGZB 2G0JA 1S6PA 1VQLS 4WF9Q 3L7OA 2HZCA 3MCMA 1R0AA 5J2MA 3VEAA 5EX3A 1UMJA 3CJQA 1YBUA 2WVBA 4IYQA 2CNOB 4YFUA 4YN3B 3PW0A 4NPOA 2XY7A 5C2GA 5IT4A 3KK3A 2EFOA 3FBBA 3UD3P 2JC1A 3W65A 1FJEB 2XWXA 1VJWA 1ZBTA 5DZ7A 2EFGA 3I5AA 3SQOP 4W90B 4ZJLA 3MM5B 5KG2A 2OTLS 4I2PA 5F8NA 1YWXA 2HHUA 2Z2MA 1UFWA 2K06A 3LP1B 2MDAA 1Y10A 2KN4A 1NPKA 4RKUC 4YR2A 2K8GA 4O3SA 1WKKA 3QOQA 2EVZA 1FJCA 2DBBA 4LRVA 1A7GE 1T8EA 3S8SA 1DBDA 2AY0A 2M70A 3DRPA 3H25A 2EK1A 3VV2B 1IM4A 4A8XA 3R2DJ 2WZ1A 1RYRA 2YKMB 2JZ5A 5J2NA 4Y00A 2CQ1A 2FJEB 3I0SB 3M9MB 3R1LA 1L3VA 4DR3J 1ZPWX 3IO1A 2IIHA 1IKYB 4DEZA 5F8GA 2EW9A 2ACMA 3KHRA 2A6OA 2ZJPQ 3GWCA 4ECZA 2DH9A 2W9CB 4FYYB 3JSYA 4RUBA 5T7LB 4EWTA 2DKOB 1EARA 2P9EA 3ULHA 1FTRA 3I9V9 4H4KA 1AXQA 2YPYA 2AYGA 3KNGA 3CCSS 4DSJA 2YNIA 2YWHA 3W62A 1JLAA 4URGA 1QTMA 2G4BA 2HQDA 2VJUA 3WX8A 1S0OA 2VL1A 5DDPC 5GAGI 3BB5A 2KTQA 4O44B 2VH7A 4QIVA 2QO3A 2AYEA 1NK0A 5K9FA 2AKWB 3V6DA 5IC6B 1BDVA 3AD9C 3BKTA 3MM9A 2CDRB 1MLAA 2V34A 1LQ9A 4DV2F 4M63A 5K14A 1RAIB 5E0OA 3A3NB 1F60B 2JH3A 3O2IA 1JXLA 2XWYA 3KDNA 2ZKTA 3S1TA 5KFIA 1PGZA 2ZHAA 1BC6A 2IA0A 3G8SA 1APSA 1T05A 4GKKF 1PYTA 5AXKA 3T9ZA 3IAM9 5ETOA 3AQOA 4LIWA 4ES2A 1KRPA 3M6UA 4NYOA 3SEOA 5AXLA 3CWJA 4DPOA 4DR7F 2EXUA 1Y5IB 1BQMA 3L3CA 3M30A 2OPRA 4DLGA 4ER8A 2NREA 2KELA 1MWYA 3IP0A 4DN9A 3IFEA 4YP3A 4UUWA 4J9OA 1K1SA 4CQ1A 1C1CA 2KB2A 3R2CJ 2KH9A 4P7TA 4YY3F 2G2YA 1PAUB 3MMAA 2KKHA 4OYMA 1EAYC 1CSJA 2YY3A 4L6V3 5L38A 3AOBA 5KFTA 1N34F 1FKOA 5C42B 3QGGA 2MKHA 3LAMA 2K7KA 1FK9B 3PRVA 4PYAA 2C2DA 5EHHA 5GAHI 4CLWA 1HR0J 2C3YA 4DFPA 5K14B 4U8YA 3TVKA 3TEGA 4CYUA 3T3FA 3JS9A 5CD4A 4CNZA 3H59A 2OH2A 2B7BB 1C0TA 3M6VA 4P2FA 2LECA 4LRCA 3R5AA 1UCNA 2FY1A 1JLQA 2UVVA 1VQKS 2AJFE 3SCKE 3TVYA 1WC5A 2L9WA 3DDKA 3EPGA 4N76A 1UPPA 5F9NA 2D9PA 3C14A 1PJ5A 1X4DA 1IQZA 2G1DA 3OR2B 3MM7A 2XM3A 2EFQA 4N5SA 1PARA 3NBPB 1SJ4P 4ZVTB 5HMYA 2HLTA 2HVHA 2M8HA 1H72C 4PQUB 4ANDA 3ZZYA 3NCQA 1RWXB 4I1TA 1KS2A 2E5HA 4YR0A 3MM8A 2E9RX 2DO0A 2CIMA 2LDIA 3M2UA 2BMBA 2KFZA 1PKUA 5HMWA 3DCAA 5F8MA 2PI4A 4ENOA 1BGXT 1NHKL 3GJTB 4PABA 5F3TA 4I6WA 1WC1A 2BNZA 2HZVA 1CQNA 1DLOB 1Q53A 5KG3A 4F2SA 2K7JA 2DGSA 1RISA 1ZS6A 2HNDB 2ASLA 3MUTP 1N5SA 2QN6B 3I82A 4TKTA 2V63A 1HL6A 2A18A 4NLSA 5DRKA 5KT5A 3K5OA 4ECWA 2DT9A 2W1BA 5HLFA 1YJ7A 4WIIA 5L1JA 5THWA 3JTOA 3TOQA 2GMLA 3K17A 2RDIA 5D78A 2XYPB 4IH7A 5CABA 4ZPDA 2O66A 2CADA 1A9NB 1LWCB 2Y1LB 3EM1A 3FMTA 1RU2A 1O5JA 1OQ6A 1Q7LB 4O23A 3G4SS 3Q24A 3A8KA 4WTOB 2DNQA 1TKXB 2CZVC 2OPSB 1VRUA 2RKIA 4ZPVR 3EVOA 4IOAQ 3E2EA 2B9YA 4DR6J 4WFAQ 3MAHA 1Q8BA 1N33J 4NLUA 2R8HA 3IWNC 2IAJA 5G0RA 2BNWA 1CC7A 2PMWA 3B8HA 3C15B 1VQ8S 1DTQB 4NZ6A 1F2GA 3CJ0A 4I56A 4NLYA 4V19X 1WF2A 5DG7A 2RDDA 4HH0A 4FYVB 2B9EA 1U0SA 2JL9A 1HFEL 4DV7F 3OTEA 2RS8A 4QYRA 4NLDA 1XMOJ 2AJ2A 2F5GA 2VHGA 4M5JA 3BGLA 3TAQA 2R7RA 5KG0A 3RW7A 3HXMA 3SBMA 4RW8A 4KH0B 3SI8A 1HWJA 2CNLB 1QAIA 2VA3A 1I5OB 3UDLA 1B01A 1C1BB 2HFZA 3M8RA 3HFKA 4X65F 3VAMA 2ZUAA 1T9TA 1VRUB 4QWEA 1P8GA 3JSMB 3QRPA 3PEHA 3MI7X 4X84A 4BC9A 2RMLA 3R1HA 1B7FA 5L8RC 3H5YA 1WOSA 2ZE2A 4W98A 3T6JA 1XR6A 3D54A 2J7WA 4CYUB 1E6YA 2E7VA 2QLBB 3B6BA 4JI0J 3M8QB 2HMIA 4TLRA 3LGMA 1AZSB 3OR2A 1S77D 1JLQB 4TNOA 2PGCA 1SH3A 4GRSA 1RT5B 3IWLA 4IOBA 2L08A 2CQCA 4IG3A 4Q2MA 2BANA 3G2XA 5KFCA 4UOFA 3M9NB 1JLCA 2CA9A 2H3AA 1REGX 3HHEA 1Y4ZB 4DV1J 2QYGA 1RTIB 2GMJA 2EWHA 3BN4A 1PJ6A 4IFVA 3GR1A 1Q86T 1WHYA 2AMCB 5A0YA 4GC7A 1GXUA 3QGIA 3U1MA 2HHPA 1UFKA 4DI6A 2VFRA 4MTPA 5H9EK 2UUBF 4F8RA 1NAQA 1RE1B 3I9ZA 2GHPA 1QAJA 3LGNA 2XMUA 4B9UA 2B5JA 5E3RA 3NGSA 3JQJA 3LPEA 4LFBJ 3HD1A 2BVZA 2D74B 1REVB 1T9YA 1RT4A 2O5DA 3SFUA 4P73A 5DS7A 1HQEA 4G3IA 2DHHA 4JI8F 3Q8VA 4N56A 1TTHB 2FLOA 2V8HA 1RADB 1WC6A 4WFYA 3DRSA 2MZ1A 4DUYF 2J0XA 1X5OA 1LV5A 2RIJA 2C2KB 1IKVB 5L46A 1R0BG 1CVJA 3GCXP 2JSXA 2ZFHA 3MEKA 3QT7A 2DHSA 3L9ZA 3DLGB 4IQXA 1RTDB 2XS2A 1GTHA 2Y9HA 2F1FA 2WB1D 2BUNA 2IM0A 1Q8IA 4BC7A 1NJIT 1VQSA 3GIRA 3TA1A 3LUYA 4C0HA 2ABYA 1RTHA 4M95A 2QE5A 4OI4A 3I0SA 2CPXA 3CF5Q 3BKUA 3QJLA 3LP2B 2W7OA 2IVYA 1FCAA 3HHLB 2H4YB 3MEGA 2DH8A 1BAZA 1BQNA 1S7HA 2AIRB 2Z58B 2FHMA 3IWXA 3OQ2A 1IR2A 1RT1B 2PT0A 3KMSA 1L5UA 1RAJA 3KJVB 2HNYB 4IRKA 2BW7A 3NMRA 2WK4A 4X4QA 4L73A 4JYAF 4PWDA 5MLCV 4RL1A 3KLEB 4R5PA 1F2HA 1Z2LA 2VPYB 3C66A 4AL7A 3IS9A 2BABA 3UCGA 2R8JA 4PUOB 3ZZZA 2MKIA 1S0VA 4B3RJ 5L1IA 1D8YA 1Y00A 1OQ3A 2AWZA 2CPZA 1JQGA 1IWAA 1Y0HA 3W5ZA 1MNEA 1AUSL 3QWUA 5F3ZA 2XQCA 3W60A 1HBOA 2A2CA 3MURP 3J7ZT 2BKNA 2NSCA 4URQU 3KK1B 3PX0A 4IR1A 1SI9A 2YX4A 2GAHC 2QA1A 2KT3A 3KJFB 2NPFA 2BSQE 5KFVA 3C16B 4C8LA 5IOLA 1X93A 2AN7A 2A6MA 2NXEA 3EPIA 1ELOA 2GJIA 2XMMA 5H1SV 3DOLA 1XJWB 2NYHA 2V4JA 4IDKB 4U7CA 4OHVA 3VGVA 2I8EA 1WJ9A 2M5YA 2FIUA 2CPHA 4EUVA 1C0UB 2HQ3A 5KG1A 1F0XA 4QWBA 4RUHA 5EGYA 1NMEB 2W4CA 5LSLA 1SH0A 3CGIA 3OR1B 2R2UA 1ZAVA 2GIQA 3BQ2A 2W9BA 1D9AA 1QM9A 4ED2A 2HNYA 2AGPA 4FP9A 1R8AA 1Y7PA 1QVFR 4HDGA 4ECRA 1I94J 5I3PA 4CCHA 1S1XA 4PG4A 4X4TA 1VLYA 4ZVUB 2AGOA 4S0MA 3ELHA 3G6XA 2C2ZB 5CYMA 2DIUA 3QAUA 1UWAA 2YQ1A 1NNDA 2CPJA 3QT5A 3CNQP 1YHQS 2K3IA 1AROP 1KP6A 3HX9A 3RRKA 3W9JA 2AEMA 3LPYA 2N4CA 3G8TA 1MMDA 4DL5A 4DV0J 3DLLQ 4AXJA 5DM7Q 2AD9A 4RBVA 5L39A 4DS4A 4JI5J 2NXJA 2OSQA 3FQLA 5KFBA 3GXQA 5D0EA 2UXBJ 2HFUA 3CJ2A 3RUBL 1RT2A 4KHPF 2MPUA 1KBRA 5D4LA 1WDTA 1TV6A 4G6VB 1S9EA 5HVGA 4FNHA 4YY3J 4K8RA 3PVXA 2HNZA 4FYXB 5KT2A 2IJFA 1S5ZA 2AT1B 2M0GB 4M5HA 5ETKA 3EJMA 4ED6A 2FLPA 2WONB 4J9UE 3TZZA 2A10A 1TZ0A 2CQPA 5CYQB 2ATCB 1S79A 4ZLNA 4I6YA 2AV5A 2RRAA 1M5PC 4C98A 4CZCA 4EYHB 4CLUA 3GV8B 1S57A 1B3TA 2Z8QA 1R6YA 1T02A 4HHHA 2PMHA 4HV0A 3DRRA 1OIAA 3JTNA 4JI4F 1FRKA 1RQ0A 2NQPA 2YXLA 3PIPQ 4OYOA 2M2BA 3BYRA 5I3UA 3D6HB 5D8HB 1QDUB 2ZWOA 3OTCA 3RBXA 3OVBA 1WACA 3MD1A 5CAAA 5FLXU 4ZIVA 1KOOA 3LP2A 5ETRA 4ZCKA 5SUHA 4CH0S 2X3DA 3CCTA 3D6TB 2KXNB 4JI8J 3H5XA 1P94A 5D4OA 4WXWA 3NOCA 2KG0A 3I5CA 3KK2A 4DSKA 2LLZA 5DO2A 4UQGA 1HI1A 1S1VB 2H4WB 1MROB 4NLVA 2XMAA 4DQIA 5HVHA 5C42A 2KG1A 1J5EJ 2ILYA 1IWGA 2KU7A 4NYZA 4LFAJ 4OZNA 4KAIA 1LK7A 3LO3A 3R6GB 3HT0A 2R8GA 4B9LA 2VB6A 2DY9A 4DPXA 5A76A 3KJQB 2FHJD 2JEGA 3EZOA 2XS7A 3R9LA 2JWNA 1G3OA 1RBAA 2UV8A 1NZAA 3MR3A 1GFWB 3JYTA 1U47A 3DN9A 1WC0A 2FPHX 2QLXA 3CJSA 1Y9OA 2W4DA 2B9WA 1DJ0A 2PA3A 4DPTA 2XY5A 1R3NA 3EXCX 4L3NA 4DV2J 3G71S 3LQVA 3M2RA 5HVFA 4NXMJ 4HT7A 1RTZA 2QGFB 2AYMA 2ZNZA 4IFYA 1S1XB 4DV6J 2LU1A 2V0NA 4RBUA 4BHQA 4MMOA 1TUWA 2FY8A 5LJ3Y 4IUFA 2DR6A 3ET6A 2UXCF 2LXIA 3PYDA 4G1QA 3P3DA 4ZVFA 2B0GA 2NZ4A 3GLJA 1F3VA 1UPMB 2UUTA 4KQZA 4QQBA 1FK9A 2H48B 5KFKA 2R2TA 3LF0A 1BQXA 4K4TA 1VBXA 2Y1RI 4CRJA 1W2IA 1UKUA 3MOZA 4NXNF 3UN5A 3OLAA 2KT2A 3TANA 1CULB 1N33F 3CDBA 2QMXA 1R0AB 3U27A 1EETB 3QWPA 2EK6A 4M1KA 3BF4A 3TWZA 1M5VC 1UAWA 5KFUA 4LFBF 3LP0A 1T03B 1YG0A 2HURA 3BJYA 3MPUB 4E8UA 5HLFB 1XK8A 3DU5A 5IQ6A 1ZOTA 2CQIA 3I5BA 3VHQA 4QU6A 2C1EB 3PM9A 2ZH4A 2DXEA 2XHCA 5HQLA 4YMEA 3PTWA 4H4KC 3G96A 3CD7A 1N5YB 3BSCA 2NLWA 3VTIA 4YDDB 2ADCA 2IVMA 1CJUA 3JAMU 3UD4P 3UN3A 4ZN3A 5DG9A 1KFDA 3OT9A 4KYZA 2N82B 2HNZB 3KLGB 2BRLA 3PRDA 1KTVA 3DRPB 3LA0A 1SV5A 3H42A 3QYYA 2CNNB 5AXMA 2Q66A 1JX4A 4HHUA 1EKSA 3MEDA 2QT7A 5KFSA 3IR7A 4FXVA 2F3JA 5B08A 1XBWA 2UVWA 4DR4J 2ZBQA 4RZRA 2W7PA 5K8NA 3KTQA 1Y3KA 3AQPA 2PMZD 2U2FA 3GV7B 3CC2S 2Z2LA 4AYBD 5HQ8A 2EKNA 2OELA 4N8OA 2CPFA 1H98A 2RVJA 3B4DA 4KHPJ 2VKRA 4XIUA 1GNKA 1X9WA 2GQQA 5E41A 2KXHA 5GADI 4DUTA 3SMZA 4Y2KA 2VF3A 1SL2A 4KKOA 4UOGA 1DTTA 4DX6A 3JTPA 4K4YA 1T11A 2DNLA 1NCLA 3GE9A 3IBFB 1RXOB 4U7UD 1RKJA 1S6QB 4K2JA 3QT8A 1RI7A 4YUDA 1U1PA 2D7SA 1W26A 2ASJA 2J7UA 1URNA 4ZVGA 2M7SA 3MMJA 2NXCA 1VGYA 3HF5A 1IJFB 1RAEB 3MOJB 1AZSA 3M2RB 2JFDA 3IG1B 3NGKA 4ES3A 5KG7A 3DLHA 2MJUA 2HFVA 5EX0A 1WSVA 3IRXA 1WD6A 2FYXA 3DYAB 1OSCA 1IJEB 4UZCA 3V2UC 3VAKA 4A8WA 1YDLA 3J81U 4GO5X 2E66A 4HT5A 4YR3A 4USWA 3MECB 3CW2C 3TZXA 3DLKA 3QNWB 4FKXA 1VLOA 1C1CB 1XEZA 2ZH3A 4WZMA 3CCWA 1W2BR 2GS8A 4ZCLA 4CLLA 1GMWD 2QLWA 1UJ4A 2ASDA 2BXJA 2I9SA 1T3NA 3BM7A 3DLEA 1N48A 3CUNA 2BBEA 4PZVA 4U7UK 2VODA 4L75A 2HKEA 4P75A 4RO0A 1T0TV 2C2MB 3MFIA 2KDOA 2D3ZA 4AT1B 3CCZA 4KPYA 2BDPA 1FXLA 2QZ8A 3TO8A 1K8AT 2CKWA 1NPRA 1Z4UA 3ENAA 2NZCA 1QD1A 4K5SA 4TYAA 1JXEA 5DLFA 3JXOA 4UOHA 2W2PP 4PAAA 5DDRC 3M7VA 2Q3PA 1C0TB 4KC5A 4RNNA 5ETPA 3S7RA 2HQCA 3BGRA 3H20A 4QW8A 1H7WA 1NBEB 2QX0A 4X65J 2Y1IA 1WUUA 3SV4A 1U1RA 1Q78A 1JNRB 1JLCB 1SJ1A 3R97A 3U1NA 2DR9A 3LTOA 4F0MA 2CJ9A 2CQDA 2NPIA 2RU9A 4DCOB 2XY6A 1RTDA 1UVLA 5LXRA 4Q43A 1HNIA 1UZDA 4DDFA 3MM9B 4ELTA 3FBFA 1KDNA 1TVRA 3MECA 2YKMA 3OXFA 3N5BA 4OX8A 4WE1B 4Y28C 1B99A 2KM8C 2F4FA 4RW4B 3EVMA 4PQUA 2CPIA 5KFXA 1OO0B 2CDQA 1LWEB 4WCEQ 4ZP6A 5I42A 4LRDA 2QMUB 3EGZA 4DUZJ 1R8HA 2F9JA 3FEXB 5ETVA 1U2CA 3H87C 2VFTA 4MFBB 1UL3A 2WVDA 1CJKA 3T1YF 1VIXA 1OHNA 4U96A 2CYYA 4Z7YA 1L3UA 5ETTA 3AH6A 1S10A 2KJVA 4HTJA 3OL9A 4J9LA 4QU7A 4I69A 3VEBA 5C5JA 1D9FA 3HVAA 3W2WB 4KSEB 1OMSA 3FQKA 1V3ZA 3DLGA 1DTTB 3W8PA 1I94F 4OHWA 1S9GA 4KGXB 2DGVA 3BPSP 5K8OA 1LKZA 5F0WA 3FDSA 2YNHB 3LW5C 3UCZP 1QSYA 2DNNA 2GA7A 1PBUA 2CQ0A 2GIRA 3RB0A 4DUYJ 1DQ8A 1TKXA 2RKIB 4Q8EA 1RHJB 1JJ2R 4PPZA 1GX5A 3HHLA 4CTAA 3NNEA 1RHUB 4RNMA 3PJWA 3PYFA 4JB8B 3NCPA 4ED5A 3NWRA 3VWSA 1X9MA 5D0GA 4C3KA 3PIOQ 1SC4B 4JI5F 3DOMB 1GMWA 2DNHA 4H4MB 5A8RB 1U4BA 2V2KA 2MGZA 3KHLA 1U45A 3C6UB 4I64A 1HHTP 4OJ1A 3SCIE 1MYLA 1LEOA 4LF7F 1AFJA 5B0EA 2HS4A 2ZBCA 3BPDA 1FRMA 3L7UA 5HL7Q 1J5OA 3EE3A 2DH7A 2OFHX 4ZHRA 4DSFA 2R4FA 1KKHA 3R7SB 3PW4A 1X9SA 3TAMA 3DC2A 3EDQB 4USVA 2VASA 2XZWA 4KBIA 1F9HA 1WG4A 4WP9A 2KM8B 3RAQA 2OUGA 4PG5A 4QR1A 2MSTA 3M6XA 1VBKA 4M5LA 2B56A 2DNYA 4TVAB 5GAHU 4LF6F 2V4JB 4IDKA 1UWBB 2VJVA 1SXLA 5KFWA 2P9GA 1SKRA 3VAGA 2VFSA 1M1HA 1R89A 4K4UA 1WTFA 3E01A 2OPPA 3IXQA 1SC6A 3G86A 4ERDA 4X4SA 1JIHA 2FC9A 3QAEA 4DSIA 2WAQD 3THTA 3DKDA 4RUAA 2OEJA 2ACYA 1YJRA 1BXNA 2LDYA 5DGBA 3GV5B 3EZ5A 4KTQA 4CP5A 2CJBA 2W4PA 5B0AA 1N32F 2LEBA 2O67A 4B3SF 5KT4A 4EK2A 4QYZJ 1XMBA 3IC1A 4TYBA 2JLGA 1EHWA 4NLOA 3CVKA 5KTQA 2DIVA 1SC3B 1Q7YT 2VPXB 5JVGQ 3FBEA 3SXLA 3WQPA 4C8KA 2VPWB 1W7WA 4QW9A 1WHXA 2Q6CA 3NGTA 3POTA 1S59A 4QR0A 3D67A 3DM2A 3AT1B 2VIHA 5I42B 3ZO7A 2QJ3A 3T1HJ 2UXDF 3ILJA 3N6MA 1FF2A 3MDFA 2P2CB 3NLCA 4ANEA 5SZTA 1NK5A 1RHQB 1X4CA 3H7HB 1U1NA 4R0EA 3FUYA 1FESA 2IRYA 1S1UA 1AYEA 1REVA 3QPIA 3S01A 3UDCA 4ES1A 5GVQA 3MUVP 3KOAA 5LOQA 4J9KA 4O3OA 2P5VA 2Z56B 1ZA1B 1VIOA 2POKA 5KFQA 4ECYA 5EUHA 4X4VA 3B78A 3SCLE 4FXDA 3ZXWA 3TUZC 4N41A 2UXCJ 3MM6A 5I4MA 4LF4F 3BZQA 4DBQA 1FX2A 2FC8A 3P4UB 2XLIA 3HPOA 4DV0F 4U9RA 3CMES 3I31A 1SJRA 4IO1A 4AXIA 3X1LB 4X4UA 1Q5VA 1SKUB 5A8WB 5A2QU 5J1NA 3Q89A 1SJ3P 4ZP8A 2B3TB 5F0UA 4C48A 1FI4A 1RWPB 1BWVA 2WW8A 1S6UA 5A6PA 1H2TZ 1RAOA 1FDBA 3POTB 4OMFG 3ISZA 5D0HA 4WK3A 4Y2IA 1EKRA 4GC6A 3UCUP 2F4VJ 3NXZA 5EN1A 2HMIB 1BD6A 2QL5B 3AJ2A 1HPZB 3LOUA 4CH7A 3PR4A 3Q0AA 1QJHA 3MUMP 1FE4A 2QA2A 1WKLA 2VG6A 2GVDA 5KT7A 3MCNA 5FIIA 5LL6d 3CCMS 4CT8A 2W25A 3IR6B 2AW0A 4F26A 2UUAJ 1LFPA 4C8ZA 4J9VA 2YWGA 4LSZB 2E5IA 1HBUA 2YH0A 3U7JA 2AJQA 4Y0FA 3OTBA 4RW6A 1I6JA 4L72B 4B9SA 4FYDA 2HHQA 1WF0A 2ZOGA 4OI3A 1RSCA 2FVPA 2OEMA 2JHEA 3KWMA 4E2FB 1NJZA 2W2NP 2IA6A 3UR3C 3CCLS 1FKPA 1V5VA 1U8WA 1KVIA 4UTGA 3B82A 3JYTB 3E01B 4JI7J 2KZZA 5AE2A 2X7IA 2UV8G 3QLHB 5D77A 4PYDA 1PCAA 4WKYA 1U1KA 2VONA 4DR4F 4Q0BA 2KYZA 2FZCB 3FK4A 1URRA 2HRYA 2N7YA 1I1GA 2ZH5A 1T05B 4LF9F 4LFAF 5DDOC 4EFAC 3LP1A 4JI2F 3O1LA 2Z2YB 4MYTA 4PXDA 3PJXA 3BGOP 4DV3F 3OW2R 2Y8WA 4KY3A 3UWTA 3C3LA 2GVDB 1UW9A 4FPIA 3D6FB 1RDRA 4FS1A 2JEFA 1R0CB 1B7YB 4EO8A 4J9PA 1U6FA 4A8SA 1FHTA 3F44A 3UVJA 1F1BB 1QTGA 3I4PA 1JKHA 1V9OA 4JUZA 2V6AA 4F02A 4F0HA 3TEHB 2DXDA 5AE3A 2W9AA 3ETMA 4ZLJA 5IXUA 2GNKA 5GMKa 2FJWA 4NXMF 3HJFA 1OJ4A 3C6TB 3TA0A 1TKZB 2GVZA 3MPYA 4RBTA 2EBGA 1RWMB 4WYWA 1FJGJ 4KJIA 1P9YA 2GQCA 4O0NA 2MKKA 5D0RA 3NGRA 2LEPA 4NWBA 2RJZA 2ZHBA 2ZHOA 4RWWA 3GILA 4C8MA 2XGPA 1SC1B 2ZKUA 4CLFA 2BQ3A 2I2YA 3WC2A 3X3UA 1HQUB 2DB1A 4OLOA 3RG6A 1RZMA 3EMTA 1LNQA 4G65A 3THPA 4ED7A 1N88A 2UP1A 2EFNA 2MMYA 4FKYA 2BQUA 3ZZPA 1WC3A 3SSSA 3V6DB 1HARA 2KJWA 4KHMA 3NP5A 4LFCF 3PY8A 1PAEX 1S6OA 2FVSA 3RAMA 1JKHB 5GMDA 3D28A 2Q2KA 5ITHA 3GSDA 4WE1A 4OYAA 2ZZMA 2AP6A 3LAKA 4DL0C 2CPGA 3RJMB 4ZMMA 5EWEA 3BO2A 3MFHA 1U1LA 1LWEA 2KFYA 2N3OA 2P6TA 1VR6A 3NO7A 3M6WA 3ZNUA 2N7CA 3ZZ0A 3HI9A 3UDVA 4WJBA 3N9UC 1ULRA 3R5CA 5KT6A 5H9EJ 4TY8B 1GMVA 1ICEB 1VQYA 2CQ3A 3ZZOA 5IC4B 4DR5F 3KG4A 2JBVA 2ZH7A 2E9TA 4C3MA 3G82B 4O4RA 2HZAA 1FE0A 2KRRA 2F8HA 2QEXS 4HYKA 2HSEB 1TR0A 5B0CA 4LF4J 3P6YC 1RABB 1TK5A 4Y2MA 4BCAA 2QC3A 1FKPB 1SB6A 4FBTA 1MW7A 1YZ7A 1Q16A 3GYNA 1NB2A 3CMQA 1CC8A 2LU2A 1BE4A 2BKOA 5E3CA 3UNGC 5DM6Q 1NDPA 4WKRA 2GHWA 4AQYF 4TQSA 4AUKA 4ZLLA 3RR7A 4ZPAA 2BJ8A 1Z2ZA 2HVDA 5HBMA 3W9HA 2E5LJ 3TJ8A 1FD2A 1OPZA 4NEZA 1IKXA 1MU2A 3T1YJ 1LW2A 3C14B 4KHRA 4M5DB 1M5HA 3SSQA 1F9EB 3O6QA 3QSYB 3KUGA 4M5IA 5KFZA 6FD1A 4PXCA 2PSZA 4G1PA 3PDNA 2V8VA 3PACA 1HR0F 3FZ2A 1CBKA 1VOMA 2CQBA 2C3PA 2M3DA 2WONA 4MJKA 4DZ6A 3V6KA 2OMOA 2R7OA 3UO0A 2EI5A 4F2RA 1G4CA 3J7A1 2C3OA 4X64F 2PN6A 3A8IA 3KG1A 4X66F 4TU8A 1BDTA 2XGQA 2V4RA 4HI1A 4OX9F 3DRRB 2DPJA 3Q8QB 1VRTA 2AJ0A 1CLFA 3NOGA 4DN0A 2M4MA 3M2VB 1FO1A 2JVOA 2B5JB 3F56A 3SZ2A 1JLBB 4ZS6A 2ZE2B 3P8BB 3C2PA 3GYGA 1RT2B 3VGTA 5A8KB 4P7VA 4L76A 3US5A 2ATLA 1L3TA 4AAIA 2HW3A 4DV3J 1HWIA 3ZZUA 5CYJA 3OJSA 3MEEB 3IGVA 4D3GA 4L3KA 3OL6A 4F3OA 3W2VA 3L09A 3OBIA 2MQLA 1LWCA 3Q83A 3DGPA 5LMNJ 1RT5A 2F63A 3O44A 3CIMA 1VK8A 3ZZRA 2HHHJ 2C2OB 3BO4A 1VI7A 2BKPA 1WWHA 2UXDJ 2DNPA 2ILZA 3PW7A 5LMUJ 3D9BA 4CI0B 5IV3A 1N5VA 4ZOSA 4DX7A 1XMQF 2J6SA 4FF3A 2RBFA 3ZNJ1 1F5BA 2DGUA 2FZGB 2HFSA 2IAJB 1HMVA 2M8DB 4Y34A 2V2ZA 4A8MP 2CQ4A 2N3LA 3UN2A 3PO4A 2A3JA 4TY8A 2EEYA 1U0HA 4MKBA 4I2QB 2B7CB 4Q5VA 1UVJA 1BWEA 1KLNA 1KC8T 1J5EF 1JB0C 1R8CA 2FJBB 1SL1A 2I6WA 2W24A 5KFDA 1O51A 1N32J 4RU9A 5C2CA 3NG8A 2CWKA 3T5LA 4M5NA 2ZH9A 2DITA 2E7WA 2CPDA 3AY0A 3MHYA 4NL5A 2VKZG 5JXSA 3BO3A 1T9WA 3IS9B 2EKYA 1VISA 4GKJF 1FXDA 3CSKA 1R6VA 4J90A 1N6QB 1FWKA 3TUPA 4AFFA 2OIHA 2JEJA 1ZYQA 4DV7J 1HBOB 1JJCB 1KD1T 1RLDA 2OD6A 2V69A 2WHOA 3PYGA 4TN2A 4NXNJ 3ISND 4WXOA 2CQ2A 2MB0B 4B02A 4NCBA 1TFWA 2E1RA 2MKJA 3FSXA 1JLGB 2NSBA 2RQKA 3S6EA 5HQMA 2DR7A 3CC7S 2W2MP 1FJ7A 5A8RA 5CD4H 4IR9A 4ZIWA 2MLYA 4O0IA 2OJ3A 1E6VB 1Q0NA 3TYTA 2HBZB 4CWBA 2PEHA 4WFXA 1KONA 3RAXA 4GVLA 3SQGB 3MTKA 4NLQA 3GONA 3QO9B 3K89A 4F4ZA 1D09B 2CRLA 1DY3A 3OR1A 2BQRA 3EUNA 4YB5A 2MKYA 1HNZF 3P49B 1UZHA 1S49A 3ADAC 4NEYA 3Q8PB 4W92B 1IBLJ 3I87A 4DU8A 1NEEA 1RUSA 1RA6A 5HANA 2GPEA 4JOUA 1IR1A 5LJ5Y 3SCJE 2B6AA 1C4CA 1HHSA 2V2VA 2R7QA 2YWEA 3DXBA 4KR0B 4LSNA 5HO4A 4UY8T 4HKQA 3ZTOA 5T7LA 1JLFB 1KWMA 2G13A 1OY9A 4MIAA 1VQOS 1SIWB 5E5NA 2BX6A 2E5LF 4B3MJ 1RCXB 1NHVA 2QRRA 2YKPA 2OFGX 3GB0A 4KH1B 1U1MA 3M2VA 2AJ4A 2H1YA 3MEEA 4KGMA 1HNVA 1X5TA 4ID5B 2ZUGA 1KQSR 1TL3B 2UUAF 2R8KA 4YEAA 2RQMA 3ENQA 2AX0A 8ATCB 4LF6J 2JVRA 3D7SB 4PR6A 3CXCR 3TRGA 5MAOA 2KI2A 3THVA 4PKDB 4R8UA 3FCVA 4OI2A 4U8VA 4ZCIA 4I0WA 3A4TA 3AXKA 2JDJA 3RBZA 5JMNA 3HMJG 4X4RA 1U09A 2FLNA 3CB4A 2I0XA 1P1TA 3M32A 4X66J 4OLPA 5K8PA 2XCAA 3CJ3A 3V4MA 5HMZA 1F9FA 1N54B 3HSZA 5CYMB 4A8YA 1RGVA 3OL7A 1YGYA 4WYLA 1HA1A 1HWKA 2K3KA 3OHBA 2G0IA 4I2QA 2X1BA 4C2MA 2VG6B 4AL6A 4DV4F 1WDDA 1M5KC 1JLEB 4LF9J 2VBWA 2RSQA 4LREA 1OYEA 3KMQA 1VFJA 2DVIA 2EG1A 3DRXA 4CH1A 5CXTA 2OTJS 1UA0A 5DQIA 2H5IB 2XLJA 4NLWA 2HLUA 2LMIA 2M9KA 4M5KA 2MQNA 1SUQB 3LALA 3PHTA 2K1RB 1TL7A 4LQ3A 3R5BA 3ITHB 1S4FA 1O8BA 1TV6B 3CD0A 4MKYA 4CO1A 2L9NA 2JLFA 2DPIA 1KR4A 3PKMA 1MMLA 3BREA 3QATA 5HP1A 2VDIA 3N01A 3NY0A 4DFMA 3DLBA 1UEKA 2OPSA 2LYVA 4ECQA 4B3RF 3Q8YA 1TU0B 4P9SA 4D8JA 2V94A 3FSIA 2Z2ZA 3CT9A 2XZDB 3NKYA 3WDOA 5G0RB 3KJNB 4CTAB 4B9NA 1X31C 2K2PA 3AODA 2FB0A 2HFNA 5D4NA 4NX9A 1VHIA 1F5AA 3ZTQA 8RUCA 3CO9A 4NRUA 5M2UA 4YB6A 4YOEA 1B70B 5E3PA 3I4HX 2MGZB 1LW0A 1WOOA 2YWFA 3FSYA 3DGVA 3OXGA 3W8GA 4NCGB 5FDLA 2KFNA 3LJPA 3G9CA 4B08A 3TA2A 3DRYA 3TAMB 3DNCA 2KYXA 3DU6A 3AFGA 3IRWP 2R7SA 2Q43A 1V5IB 3WIUA 3BGUA 1DURA 2GAGC 3FZBA 1MSWD 1N0VC 3RBEA 4MKVA 1DLOA 2GFFA 2GC8A 5EWFA 2C42A 2OPQB 2BM0A 2YNFB 3H8YA 3HSJA 3MCOA 1CJKB 5L9XA 1HNXJ 1U2RA 1X4BA 3Q8SB 4FNIA 2Z57B 3GIMA 1PG5B 1HQUA 3DLJA 4DR5J 5E7OB 3CDAA 4NLGA 3O8WA 2ZOFA 3Q86A 3ENWA 4EZ6A 3D1QA 5KFAA 1R27B 4LT6A 4XPCA 3TNVA 2DO4A 4O4GA 4P6QA 3UVJB 2MSSA 4JI7F 4K4WA 1LFWA 4B9MA 3BSOA 2JNJA 3VGUA 2JXIA 2IRUA 3EGWB 4QZVB 1RKIA 1YK9A 2AZ3A 2H9ZA 2NS1B 3FEYB 4WWSA 1ZZFA 4NLXA 2R42A 3C6TA 3H4BA 2ZBPA 4JI2J 2EBEA 3O5TB 1RWWB 3IN5A 1Q82T 4QR2A 3OFEA 3G6YA 2JEIA 3DXSX 1N4LA 1OPIA 1YLXA 2LP4A 2V8GA 5G4DA 4ELUA 4KRWA 4J9QA 1CULA 1JLEA 1NDLA 2OPQA 4A8QA 3ONQA 1FXRA 4CT9A 3R3TA 1LXNA 1RWUA 2BRKA 3MD3A 3ZTPA 4GVBB 1S72S 1U02A 1SL0A 2GMHA 5KOWA 2VQEF 3SV3A 5J2QB 1RHRB 2K29A 4KFBA 3WZ0A 3A8JA 3DRSB 3RTVA 2OKQA 2MY8A 1R43A 1ZM9A 1Y3JA 1BMQB 2DEJA 2DGTA 2G2ZA 2QL9B 2O01C 3A12A 5D4PA 4X64J 3ITHA 1N36F 1YBTA 3BN7A 1AUDA 1VQ7S 2B8QA 4ITSA 1RTJB 2AHOB 4KO0B 2J0SD 4I68A 3IM8A 3JSMA 2HHXA 1RTHB 3TW0A 1ARRA 1NLKL 2JC0A 4P2SA 3C8YA 3CCRS 3T5JA 2AQ4A 2CG8A 2L41A 3BEGB 4PG7A 2V2QA 2VBXA 1BY9A 5C7PA 4JI6F 1TK8A 1X5SA 3N79A 2P8IA 4M5DA 3V5RA 2NCKL 4DV4J 2DHXA 1FVQA 4NLRA 3WX4A 5KFOA 3M30B 3J80U 3IR5B 4PWDB 2G0CA 2H3EB 3BS9A 2XYGB 3M8PB 4OJGA 1H2UX 4BWMA 4YS2A 5IS2A 1S97A 1VRQC 2CPYA 3NL0A 3Q2TC 3LGHA 1UVKA 3GIJA 4NCGA 4Y2CA 4LBIA 1Q8LA 3CDWA 3MMAB 4DS5A 1TL5A 2HHHF 2XC9A 2PIIA 5J2QA 2RAQA 2VBZA 3MPVA 5K8MA 3Q8UA 3KHHA 2FJXA 4A8KA 1NKEA 2KOEA 4L74A 4OYWA 2CJQA 5ETSA 4XK8C 2XO7A 2HVZA 4NMXA 3VF0B 4NASA 5GAGU 5HI7A 2ZM6J 3PX4A 1U6BA 1RACB 1H3DA 2XMTA 1A6LA 4V1Ak 1RTJA 3CJKB 3PW5A 3HO1A 2DCUB 5HBMB 2DD8S 3OLBA 1QSSA 4DV6F 2BJEA 4GO7X 2OPPB 4ZVHA 1X60A 1IKXB 1MU2B 3EX7B 1B0TA 4ME7E 1VDHA 4H54A 2CG4A 1P1LA 3QLHA 2QL7B 1JLGA 3N6LA 5F8LA 3QFWA 4M8LA 4TXSA 1DFDA 7FD1A 3TJ9A 1ZPVA 2NUUG 1D8ZA 2XSFA 1RAAB 2VBYA 1XR7A 4Q44A 1OSDA 3N0VA 1P9QC 2DEIA 3H0PA 1X5PA 3IMQJ 3M8PA 4C0BA 4X4PA 4AQYJ 2IBKA 1HYSA 2XULA 4OYZA 4MKAA 2YKNA 3FRZA 2RRNA 2KO1A 3FGVA 1KLMB 1HQ2A 3TVZA 4EO6A 4EMDA 1FNMA 4LVOP 3J80Y 4GKJJ 3FFIB 2XMWA 4EZ9A 2E1AA 2ZVSA 2VC0A 5J2PA 2V67A 3MMCB 3MM8B 1U1OA 2Q79A 2ROGA 3PFEA 1V6HA 4RX6A 5KFEA 4X4OA 1FVSA 1NK7A 4PXBA 3R5DA 1OG7A 3ZZTA 5JJBA 4USIA 5KFRA 2MQPA 4DX5A 3VGSA 4ZP9A 5GMEA 2CZ4A 2QA4G 1XTZA 5U47A 1NRKA 3OJUA 4OZ3A 4LSLA 3K5MA 1NDCA 1WI8A 2DR8A 1HWUA 3CJ8A 1TMJA 1YBAA 2OMLA 3PHEA 1B28A 3KLEA 5KFNA 4Y65A 2FHKA 1GT8A 3I6PA 3OV7A 2M88A 4CO4A 1NO8A 4LIRA 3DOKA 5C25A 3W9IA 2VC1A 5BJRA 1HD1A 4KFBB 1VK3A 4M94A 1B0PA 1FRHA 1IBLF 1X7VA 2YX1A 4LR8A 1Q95G 3PX6A 3UPFA 1EX8A 2JLEA 4AL5A 1QAYA 1TVRB 2G1HA 4WZQA 2KT5A 2GIFA 5DZ6A 1NKBA 3BV8A 3L7PA 4OZJA 1EJ7L 2XO6A 4ED0A 5J2NB 2AF6A 4USKA 3M1VA 4DCPB 2E5GA 3PR5B 3VAIA 4MK8A 5D3GB 4DR1F 1EP4B 2L3MA 6FDRA 1RLCL 5FJ4A 1MN7A 4ICLB 4NE9C 3BQ0A 2J0QD 3IRXB 4DJBA 1RAGB 2MQOA 5BYSA 3BSAA 5LMUF 5E2QA 1RHMB 1IBKF 1VQ9S 4Q8FA 2HS3A 2MQQA 1XMQJ 1VYAA 3BDPA 1PIEA 5ETMA 1FFSB 2DGOA 3W7BA 2LKZA 2DNZA 2GV1A 3D66A 5BXIA 3G6VA 3CPWR 4DF8A 1T9UA 1SVDA 3JSBA 4OZ5A 2HGLA 3V81B 5KG6A 1DARA 3WC0A 3BKFA 2FLLA 2RILA 3I32A 3W2WA 1TKDA 3LH2S 1PC5A 4MJWA 4F04B 1TL7B 1WHWA 2LEAA 4ZHRB 3NNHA 3NGUA 3PRBA 4DCJB 4C4WA 1FRIA 1HBMA 4OX7A 4A46A 1VQ6S 2QA4S 2VOOA 3A3PB 2E5JA 2EFPA 2YNHA 1ROFA 2VUGA 2XSJB 3CMAS 4OI6A 2H1OE 4JP8A 3I55S 1U48A 3KKFA 4C8NA 2DNKA 4RR5A 1FFGB 2PO4A 3HHLC 1X4FA 4IG0B 2EPIA 5IV4A 1G2EA 4QPXA 4ZP7A 4F4XA 4NI2B 2HK2A 2K1OA 1B64A 1IRQA 5CZVA 2BE7D 2ZDPA 3A3OB 4USTA 1KHWA 4YB7A 2AZ1A 4BWJA 4ETXA 4F67A 2YKNB 4R8UB 5HN0A 2C28A 4DSLA 2OPRB 2Y8YA 1NH8A 3D5MA 2RUSA 2OEKA 3HSDA 3GU0A 1LW0B 2X3GA 2ZD1A 3RYLA 4DSEA 1K0TA 4LMZA 3UI3A 3BQ1A 1TUGB 4EYIB 2YVSA 1TAUA 3MCSA 2HIQA 4IQMA 3D1OA 2V68A 1TK0A 3OFFA 2J9EA 5LM7E 2QIFA 1X4AA 3N4WA 4ELVA 4K0KF 1PJ7A 3KUHA 4DQSA 3DM2B 5LXYA 1QTNB 1VRTB 2IJNA 5KFYA 4DFKA 1U49A 4HEA9 1WI6A 1VC0A 1JLAB 2HQIA 1PO6A 4P71A 2DRBA 2YTCA 1YQHA 3T9NA 3OVSA 3FJ2A 1GK8A 2KVQE 2W7AA 4RJVA 4CO5A 1IVZA 4BLGA 2DGWA 3GJSB 3K8VA 1FFWB 4TY9A 2VA2A 3TZYA 4JI1J 4PWUA 2XLKA 3HLUA 1SV5B 2IPOB 3G6ES 4H4OB 2J8AA 1S76D 3J7YU 3AJ1A 3EICA 2ZBIA 4Y3CA 2MY7A 2H65B 2QV6A 1GXTA 4BBYA 3D6MB 4DR2F 1VQ4S 1HIYA 1TQLA 2XNQA 3OFGA 3OUYB 4O3PA 2J6TA 5HJXA 1HBNA 1PC4A 1K44A 1KQGB 1CJTA 1IM6A 2FVCA 2KVIA 4QIGA 2W8LA 4USUA 2YKQA 2ADBA 4X62F 3IR7B 3K5PA 1N52B 4ZVQB 2K6LA 3LWLA 2IC3B 4HACA 1VQ5S 1VHFA 1UJ6A 4E98A 2A1BA 3AAWB 1QE1B 4DQQA 2DNGA 3QFHA 2GCFA 1AA1B 4PXEA 2FJVA 4NZ7A 1WEYA 1IKWA 1HNWJ 1S99A 1DHMA 4N8NA 3FCHA 1OY6A 1S6QA 5F9LA 1X4GA 1GMUA 2HVEA 5J1EA 5AE1A 3GG0A 1QY7A 1S9FA 2YNFA 1HBMB 1SJQA 3P96A 4EEYA 4ZVEA 3KK1A 9RUBA 2WSCC 4N7TA 3IBWA 4CLYA 5B0BA 2HYIB 5HSPA 5KT3A 2HQFA 5HK4A 2U1AA 1UVMA 3HZEA 3CCUS 4ZVPB 3W5XA 3T5HA 1YVFA 3QJPA 4UW2A 3PG9A 4U95A 1QUPA 1FWPA 3N5FA 2IYIA 4I7FB 4KV8B 4WK1A 2IBOA 3HKWA 2KKEA 4UQTA 4WP8A 5FDLB 4LF8F 2GZOA 5IT9Y 3KLGA 3AOCA 1N36J 1MNTA 4R25A 5FD1A 3J7YI 4RW6B 3PW2A 3A8EA 2A2DA 2IM3A 3FVYA 3FT7A 3EDRB 4FDFA 4FBUA 2IJRA 2VZ9A 3QRRA 3SSRA 3VVUA 2HQGA 3E8OA 4PG6A 3W1YC 5J1EB 1AFIA 5B0GA 2VQFJ 4B3SJ 5KG4A 1SQEA 3I0RB 4OX6A 4OI0A 1H73A 3AB2B 1K73T 3CO0P 2OGUA 1M1KT 2QLJB 1NH7A 4IH5A 2GQ2A 3PNIA 4MK7A 2DY1A 4R0JA 1TMMA 3QZ8A 3K57A 3RB6A 1ZH5A 2HNDA 3NS5A 2IMOA 3M8QA 3AJDA 2BR0A 3MM5A 4ID5A 5L1KA 2WBRA 2YX7A 4DR3F 1TKTA 1KSPA 2XNRA 1HNXF 1VC5A 4OZ0A 4B3TF 4KKOB 4ZVOB 3RRHA 4ZVSB 4DMZA 4WIQA 1N56A 2DGXA 4KGVB 4CDIA 1NK4A 4RW9B 1HNIB 4A8FA 2ZM6F 5F41A 4FN5A 4OYPA 2FQQB 1KVKA 1T03A 3GCWP 4FYWB 3FFIA 2PE8A 5B0FA 4C0OC 3CCES 1A0OB 3EGNA 1JJHA 3K5NA 1YKWA 2QFJA 1NSAA 1T95A 1UP1A 3ILLA 5IWAF 4KGKA 2IC3A 4X2BA 1M1GA 1T9VA 2LA4A 4EGLA 3TQ1A 1F6TA 1QE1A 1RCOB 1RT4B 4QWDA 3EVWA 1V3SA 3ILIA 1HKAA 2DYAA 4HHJA 2UU9F 4B3OA 3NCRA 3I96A 3AA8A 5CH7B 3MAAB 4OZ1A 2C22A 3EXYA 3H98A 1H6KX 2YQ0A 3KK2B 1UEUA 2R3VA 5ETNA 4TU9A 4PWWA 2R7WA 4ED8A 2F7VA 1C1BA 5M2RA 2LXUA 2B6AB 2BA9A 3CJTA 4LSNB 4U6PA 2W9BB 2HPUA 5J2MB 3UR0A 2FHOB 4RW8B 4EBCA 4WTYA 3HHDA 2C2RA 4B9VA 2HVIA 5HP1B 3KLIA 3MR7A 4IKAA 3RBDA 1SKWA 3PJ9A 1RU1A 1Q16B 2IDLA 3BR9A 4DU7A 3T5KA 3K0JA 1KOHA 1LXJA 3UFCX 3OHAA 2BJ7A 4X62J 1F5CA 4YHHJ 2JFKA 1W25A 3SQGA 2WVEA 1WG1A 4QIWD 4IO9Q 1BQNB 2J0WA 1S1WB 1XIQA 2H5JB 3GFYA 4OJ3A 3SIPB 4C6AA 2CWXA 5IM0A 2VICA 2CQHA 4B9TA 1XNRF 4LJMA 1PYOB 2X1GA 2R2RA 1YJNS 4N77A 4ZA1A 5M2PA 5DQGA 1MN9A 2GO9A 1DRZA 3QIPA 4NA1A 1N5QA 2H54B 3G8QA 3DDIA 4FVCA 3CJKA 1NSPA 1FA0A 1U7LA 3T41A 2DHGA 1IKYA 2A2BA 2B4VA 3GSIA 5F8IA 1VCTA 1RWNB 3QQCD 1SIWA 2GW8A 2M52A 4MFBA 3LP0B 3M8WA 3QGPA 4HDHA 4F0KA 3SYZA 3AB4B 2LQ5A 5KFMA 4RNOA 1ZETA 3CD6S 1CG2A 2LCWA 2H5EA 1XC9A 1I3OB 2RNEA 2DK2A 4RNHA 1Q1KA 4USHA 1IBKJ 3E3XA 1XR5A 3MF5A 3FCWA 4IG0A 1H74A 3ZFVA 2MKSA 2P6SA 3HVWA 4ZN1A 4Y6IA 1J27A 1S9GB 2FUG9 2RS2A 1KHVA 1FJGF 1KLMA 2X51A 3M9OB 3L95X 4DQRA 3U1LA 1N5YA 2IRXA 4DXLA 1FEEA 1GEHA 1S4EA 1S1TB 2J7KA 5C24B 1N5TA 1Y11A 2C3MA 3NBPA 4OHZA 2BJ3A 2LXFA 4WU2A 5AJ3F 4HR2A 5LSRA 1G6BA 5IQQA 2BM1A 3TUIC 2R9LA 3FMBA 2CZ9A 4Z7CA 2PDAA 4HI2A 4Z37A 2XMJA 2BA3A 4OHXA
chains in the Genus database with same CATH topology
4ME7E 2NZCA 3H87C 2BJ7A 2WVDA 2K6LA 1BAZA 2WVEA 2WVCA 2CAXA 3GXQA 2K1OA 2FGCA 1IRQA 1P94A 1B28A 3VEBA 1U9PA 1MYLA 2KELA 3LGHA 4D8JA 2K29A 2K5JA 1NLAA 1ARQA 2CAJA 2HZAA 3PHTA 1MYKA 3QOQA 1PARA 3BKFA 2JXHA 2BNZA 2CADA 3OD2A 2CA9A 2JXGA 2HZVA 1QTGA 2AY0A 1MNTA 4FXEA 2BJ1A 3FMTA 1EA4A 2JXIA 3QSIA 2BJ3A 2WVFA 1BDVA 2BJ9A 3BKTA 1Q5VA 1BDTA 2F1FA 2GPEA 3FT7A 1Q5YA 1B01A 1ARRA 2RBFA 3VEAA 2BSQE 2PC6A 2CPGA 3VW4A 1X93A 2WVBA 4HV0A 2H1OE 2Y3YA 2BA3A 2K9IA 2BJ8A 3BKUA 2BNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME7 E;  2NZC A;  3H87 C;  2BJ7 A;  2WVD A;  2K6L A;  1BAZ A;  2WVE A;  2WVC A;  2CAX A;  3GXQ A;  2K1O A;  2FGC A;  1IRQ A;  1P94 A;  1B28 A;  3VEB A;  1U9P A;  1MYL A;  2KEL A;  3LGH A;  4D8J A;  2K29 A;  2K5J A;  1NLA A;  1ARQ A;  2CAJ A;  2HZA A;  3PHT A;  1MYK A;  3QOQ A;  1PAR A;  3BKF A;  2JXH A;  2BNZ A;  2CAD A;  3OD2 A;  2CA9 A;  2JXG A;  2HZV A;  1QTG A;  2AY0 A;  1MNT A;  4FXE A;  2BJ1 A;  3FMT A;  1EA4 A;  2JXI A;  3QSI A;  2BJ3 A;  2WVF A;  1BDV A;  2BJ9 A;  3BKT A;  1Q5V A;  1BDT A;  2F1F A;  2GPE A;  3FT7 A;  1Q5Y A;  1B01 A;  1ARR A;  2RBF A;  3VEA A;  2BSQ E;  2PC6 A;  2CPG A;  3VW4 A;  1X93 A;  2WVB A;  4HV0 A;  2H1O E;  2Y3Y A;  2BA3 A;  2K9I A;  2BJ8 A;  3BKU A;  2BNW A; 
#chains in the Genus database with same CATH topology
 3HSG A;  1NPP A;  1Q4R A;  4D3H A;  1RA7 A;  2D69 A;  4HLB A;  3A13 A;  1HI0 P;  1BQM B;  4LRA A;  2JOQ A;  3C46 A;  1FDD A;  4P72 A;  1DAX A;  4PCQ A;  2EG2 A;  1SUQ A;  2J9D E;  2IY5 B;  3HCX A;  1RT1 A;  4LF5 F;  3J7A N;  4NRT A;  1J2V A;  2BZ2 A;  3DMJ A;  3MM6 B;  3TR5 A;  3OPK A;  4JBC A;  1FWL A;  5CZX A;  2E9Z A;  2EC2 A;  5KG5 A;  3DGP B;  4G1I A;  4DOZ A;  2QTW A;  3RGI A;  4OHY A;  2YWK A;  3W63 A;  8AT1 B;  1RWV B;  1S7I A;  3P45 B;  4WP3 A;  4F4W A;  4UT4 A;  4O3Q A;  1UVI A;  2HRU A;  3MTJ A;  4CLZ A;  5A8W A;  5CA5 A;  5F8H A;  1XMO F;  1NUE A;  2CJA A;  1VBZ A;  1N6Q A;  1N0U A;  3D68 A;  4USM A;  4NZ0 A;  4CO3 A;  3BSN A;  1HBN B;  1YIT S;  1KEK A;  1B4S A;  4ZPW R;  5EDW A;  1Q81 T;  5JUM A;  4M5G A;  2GO8 A;  3VAL A;  2R7U A;  2MYF A;  4YB1 P;  1HBU B;  3OFH A;  4HAC B;  4CLP A;  2HHW A;  3G87 A;  4PPD A;  5CHC B;  2RE1 A;  4DF4 A;  3P5T L;  4Q45 A;  1AW0 A;  1RWO B;  1RBL A;  3CC4 S;  1WTB A;  1HLW A;  7AT1 B;  3PV8 A;  2HAF A;  3NS7 B;  1M90 T;  3M4X A;  2JXG A;  2AX1 A;  2OO4 A;  2W2O P;  4C8O A;  1EA4 A;  1D9D A;  3DLK B;  2J8S A;  3M2U B;  1MRO A;  3GJR B;  3HZG A;  4DLE A;  4ECU A;  2QLF B;  4OV1 A;  2B8P A;  3GPA A;  3KFW X;  4KIA A;  2RB7 A;  4ID8 A;  4J5O A;  3JB9 k;  3VAH A;  2IM2 A;  2YBV A;  4GMK A;  2QYC A;  2JX2 A;  1TFY A;  4K4Z A;  2FJA B;  3VW4 A;  3OTD A;  5KFL A;  3PYE A;  4ILR A;  2RUG A;  3NAH A;  1RT3 A;  1R8B A;  2G2O A;  4K4V A;  1UJ5 A;  3JQK A;  4DV1 F;  3HUL A;  2F65 A;  4CM0 A;  2YPZ A;  1X4H A;  1Y5N B;  3PFO A;  4YHH F;  2E7X A;  2J5A A;  3CCQ S;  4DL3 A;  2BEF A;  3PXG a;  4QYZ K;  2LQJ A;  2FJD B;  3W2V B;  5T14 A;  4OX9 J;  3TUJ C;  3H40 A;  5LT5 A;  3TJA A;  5HRO A;  1E6V A;  4EI2 A;  2VG7 B;  4QIE A;  2YNG B;  3K2Y A;  3U02 A;  4ZIT A;  3A1Y G;  5C24 A;  3TX0 A;  4DZD A;  2I1R A;  1UA1 A;  3KLV A;  2NUH A;  3PO5 A;  1HNW F;  5CYQ A;  4ZCM A;  4KO0 A;  5ETL A;  1WG5 A;  1IXK A;  4RUC A;  5KFP A;  2HHV A;  3HD2 A;  1L3K A;  1TKZ A;  2GVZ B;  4OL8 A;  2F9D A;  5A0Y B;  2H51 B;  3M32 B;  2BOA A;  2ZEJ A;  3R27 A;  4F36 A;  5LMN F;  2AEJ A;  2MZQ A;  3C15 A;  3EYZ A;  2BE2 A;  1QSL A;  3QRQ A;  3MWB A;  3F73 A;  2VU5 A;  5BR8 F;  3HFV A;  1SPB P;  1VQP S;  1RB0 A;  1BUX A;  1TEL A;  3HDS A;  4DWI A;  2AYB A;  1EIY B;  3GP9 A;  1OS5 A;  1RAH B;  4O4G B;  3M8S A;  5DDQ C;  4PRF A;  1GH8 A;  3R7N B;  3OTO J;  5DGA A;  1IBM J;  2NYI A;  1JWW A;  3TZW A;  3OVA A;  2QG9 B;  4F4K A;  4NA2 A;  2YNI B;  2W2Q P;  3DFE A;  1FER A;  1EZZ B;  2ZOM A;  3DI6 A;  2VG5 A;  3GMG A;  4I2P B;  4NA3 A;  4P52 A;  4K0K J;  4ZK7 M;  3NEK A;  3FC9 A;  5T41 A;  1WEZ A;  2WTF A;  3N6N A;  1FNX H;  2CJX B;  5GAE U;  4ETZ A;  2XG8 A;  4F3M A;  5H9F K;  1KFS A;  1CJV B;  4DPU A;  1RAF B;  2ZH2 A;  1WF1 A;  1UFL A;  2KZM A;  2UVU A;  1EQ0 A;  3UQS A;  2DNR A;  2HBQ B;  4NML A;  4MT1 A;  4ZJQ A;  2B51 A;  2I38 A;  1BHN A;  2Y3Y A;  2GGP A;  5HJY A;  1K9M T;  3AA9 A;  2ADL A;  2FTR A;  2HGM A;  3HT3 A;  1EP4 A;  2NXU A;  1SKS A;  1GAO A;  3QO9 A;  3F0N A;  2CNK B;  3DOM A;  4H4M A;  3WHI A;  2XYH B;  4LF5 J;  5CCM A;  2B4P A;  1IKW B;  2MZJ A;  1NJY A;  3ET6 B;  2ZJR Q;  3FEZ A;  3J7Z 5;  1RT7 A;  1RTI A;  4IFV B;  3ETO A;  1YTY A;  2WCX A;  1J5O B;  4I6A A;  2KXF A;  3B4M A;  1UEV A;  2ZH1 A;  1X8D A;  3AD8 C;  4M5M A;  3NNC A;  3MMC A;  4QOT A;  5CQG A;  2EFV A;  4WFB Q;  4JV5 F;  5I3Q A;  4K50 A;  4ANC A;  3K58 A;  1CJV A;  4PQA A;  2RU3 A;  3CTR A;  4CO0 A;  3HHN B;  4LF1 A;  1RT3 B;  4DUZ F;  1H0H B;  2B9X A;  1HNZ J;  1IQT A;  4AE5 A;  5AT1 B;  1E6Y B;  3C16 A;  3ZC4 A;  1UWB A;  4K4S A;  4LSL B;  4K5R A;  1JJ4 A;  1HQE B;  4OFZ A;  3DOL B;  4WFN Q;  1YX2 A;  1ZAX A;  1KQF B;  2PEB A;  1EB0 A;  3CCV S;  3GFH A;  2VG7 A;  1JMT A;  4XAK A;  3GQC A;  2DHA A;  1IN0 A;  4QBU A;  2ZH6 A;  1M5S A;  2UU9 J;  1WOR A;  3BDE A;  1K0V A;  3D0G E;  1ARQ A;  1EQM A;  4OIX A;  3H4D A;  5CCL A;  2R8I A;  2JXH A;  2FZK B;  2FGO A;  2Q1L A;  4B3M F;  1WC4 A;  1JK9 B;  4FXW A;  2C2N A;  1NK9 A;  5IT9 U;  4MK9 A;  3GJQ B;  2V9W A;  5J2P B;  3ENV A;  1ZM3 A;  1R8P A;  4YDX A;  2UXB F;  1SCJ B;  1FKO B;  1FRX A;  2DNM A;  2HK3 A;  3T19 A;  4LF8 J;  5HMX A;  2ZC4 A;  3RB3 A;  3NS6 A;  1FD8 A;  3MEG B;  4RWX A;  1IR0 A;  2BE2 B;  4U67 Q;  5E33 A;  3W5Y A;  1NK8 A;  3CIZ A;  1YJ9 S;  1N8R T;  1JLB A;  4ED4 A;  2X1A A;  4DG1 A;  1S1U B;  3G82 A;  1YJU A;  3M8Y A;  5A8K A;  3Q2S C;  1XWL A;  2VQF F;  5A2Q Y;  2ROP A;  2C3U A;  2IDE A;  1LK5 A;  1ZAW A;  2OSR A;  4LRF A;  4JI4 J;  3DI6 B;  4TLQ A;  1RK8 A;  4RW9 A;  2D1C A;  5B0D A;  2ZZT A;  1X4E A;  4XDD A;  1S0M A;  3FMW A;  2L48 A;  2HBR B;  4A8O A;  3WIV A;  2BAC A;  1HHQ A;  4A48 A;  4OI1 A;  2RHQ B;  3D1H A;  1ZM2 A;  3IGN A;  3KXD A;  2IFX A;  4QWA A;  4OZL A;  1XNQ F;  4B3T J;  2BJD A;  4ICL A;  2YKO A;  3R7B B;  2R2S A;  2FDN A;  5BR8 J;  1CJT B;  2D3U A;  4IH6 A;  5I3U B;  3ZTS A;  1HI8 A;  2OP5 A;  3R5J B;  4MYU A;  2ASY A;  2WVC A;  4CLT A;  5IFM A;  4ILM A;  3EWG A;  2CFX A;  1TL1 B;  5AJ3 J;  5GAD U;  4K4X A;  1DQA A;  3UNY A;  1YIJ S;  4P74 A;  3KHG A;  2XS5 A;  4J91 A;  4CIO A;  2K5J A;  3KLF B;  4J9R A;  1NLA A;  1RHK B;  2VFU A;  3EZU A;  2DTJ A;  2GJ2 A;  4LRB A;  1IUJ A;  3DMJ B;  5IWA J;  3PCO B;  4UY8 5;  1T7P A;  3QJJ A;  1CS4 B;  4FXE A;  2IM1 A;  3K7R A;  3BH7 B;  3KYL A;  2LFV A;  3HHL D;  4DL2 A;  3H5U A;  4DQP A;  3HVT B;  1KN6 A;  3K5L A;  2AU0 A;  2Q6B A;  1FX4 A;  5IT0 A;  1U2F A;  5KFH A;  4ED1 A;  2XB2 D;  4ZJO A;  1Q79 A;  4HTI A;  1MG7 A;  3TX8 A;  3FNN A;  2K9I A;  3VAJ A;  2P9C A;  2XEX A;  4OJH A;  4LF2 A;  4N47 A;  5KFG A;  1FDA A;  3VR1 A;  3VAF A;  3MR5 A;  4V19 J;  4AD6 A;  3E51 A;  1TAQ A;  2J6U A;  1QAX A;  2MHE A;  3GFX A;  4C11 A;  4Z2X A;  5LSO A;  3T6B A;  4YQW A;  3UW1 A;  4I7F A;  4KV8 A;  5B7W A;  3J81 Y;  2DXF A;  1NDK A;  4ZPC A;  4QWC A;  3OSN A;  2RQC A;  2MXY A;  4OV6 A;  4QIF A;  1BLU A;  4WBF A;  2B4O A;  2GX8 A;  2F8M A;  3PEJ A;  3QSI A;  5JVH Q;  4RU2 A;  1HYS B;  3MMB B;  1R7I A;  2DRA A;  3OL8 A;  4HL9 A;  3CE8 A;  4DV5 J;  4BDP A;  1S0N A;  1HMV B;  4JV5 J;  2V50 A;  3RR8 A;  2VDH A;  1ZZN A;  2PFF B;  1XNR J;  4P2X A;  2XZT B;  3OSP A;  1NB7 A;  2FVR A;  4WPA A;  1G1X A;  4ATN A;  2XMV A;  4EBD A;  2OHD A;  3TAR A;  1NJX A;  3HJV A;  1FRJ A;  3MPD A;  3I0R A;  2B4U A;  5KAK A;  1SJF A;  3RRG A;  1EET A;  1TL3 A;  3UE2 A;  2L9D A;  2Z4P A;  4DL4 A;  2LQ8 A;  2JRS A;  1HW8 A;  3V6J A;  4NCA A;  2FGC A;  2YQ3 A;  1RYS A;  3ICL A;  1XN9 A;  3IBC B;  1ZM4 A;  3CJR A;  4J9S A;  1UW4 A;  1WNE A;  1S48 A;  1U9P A;  4OYX A;  3WBZ A;  5ADZ A;  2XHW A;  3HFZ B;  1S1T A;  1ZA2 B;  2KHC A;  2ZC3 A;  1K47 A;  4PG8 A;  4EBE A;  4C11 B;  2Y1J A;  2IYG A;  1TKT B;  2F40 A;  4H4O A;  4ECS A;  3BGF A;  4IG3 B;  4DPW A;  2G9O A;  2HGN A;  2BJ1 A;  4FZV A;  4ZPB A;  2UUC J;  2NXN A;  3QZ7 A;  2BJ9 A;  2RDJ A;  2LVW A;  4ED3 A;  2Z0G A;  4JI3 F;  1DQ9 A;  3MR6 A;  4DL7 A;  2R7X A;  3BYP A;  2VQE J;  2FVQ A;  1OY8 A;  1SQG A;  1PYS B;  2C2E A;  3CDU A;  2EC0 A;  4HVZ A;  1DTQ A;  2QSF A;  3GII A;  3CJ5 A;  1U8S A;  2O3D A;  2QSW A;  2D41 A;  3MED B;  1C2P A;  1HW9 A;  4LBP A;  4F7V A;  4F3Q A;  3MAQ A;  2UZA A;  1TL1 A;  3BR8 A;  4C3L A;  5D6G A;  3Q22 A;  2JJ4 D;  2VOP A;  1H2V Z;  4FF4 A;  3UD5 A;  3BBC A;  2WBM A;  4IFY B;  1T94 A;  3VVT A;  2V9K A;  1O0P A;  3PKY A;  1S1V A;  1VMB A;  1YRT A;  2RRB A;  3JAM Y;  2E1C A;  1S12 A;  1X0P A;  1LWF A;  2MZS A;  4G1Q B;  1GX6 A;  3VZI A;  1QVG R;  3BH6 B;  3KLF A;  4JI6 J;  2RHS B;  4R5P B;  1XER A;  3DOK B;  4CLS A;  3MAA A;  5C25 B;  1U24 A;  1RWK B;  3N28 A;  3M05 A;  2WVF A;  2DNO A;  2CJY B;  4RLE A;  4J9M A;  2UVR A;  4LFC J;  2HS0 A;  3KG0 A;  4UZB A;  1NZ8 A;  2ZJQ Q;  5BYQ A;  3NWG A;  2CXE A;  5EWG A;  4ILL A;  3GTY X;  3TI0 A;  3D0H E;  3AXM A;  2HHT A;  4F4A A;  3VCD A;  2WSF C;  3LAN A;  1OYD A;  3BBB A;  3HKZ D;  3M1V B;  4KPC A;  1HNV B;  4NLP A;  1YRU A;  4UOC A;  4Q7A A;  5ETQ A;  1KQK A;  3KLH A;  1WEL A;  4F25 A;  3RB4 A;  1LWX A;  3PZP A;  1VQN S;  1HPZ A;  2N4D A;  2KRB A;  2V8D A;  5H9F J;  1IBM F;  2OAU A;  3IG1 A;  4DPY A;  4KB7 A;  2V5H G;  2BAN B;  3R8Y A;  1XQI A;  2KL8 A;  4NI2 A;  3TAP A;  1S1W A;  5IM0 B;  1K1Q A;  3DYA A;  3H2V E;  2W01 A;  4JV1 A;  2MZR A;  3K8W A;  1YI2 S;  3AD7 C;  2MHN A;  2HEK A;  3DHX A;  2XI2 A;  2A0F B;  3IM9 A;  4I67 A;  1HWL A;  1LWF B;  2KHD A;  2MZT A;  3GZ7 A;  2E29 A;  1M0S A;  3TQE A;  4DHV A;  1CQM A;  3HK2 A;  1NHU A;  3DDN A;  3SDE B;  2DRD A;  2PD1 A;  1ACM B;  3MGJ A;  4LUB A;  4ZVR B;  4XO0 A;  1X0F A;  3MMB A;  2HWH A;  2ZZN A;  1U25 A;  3W3S A;  2LQB A;  1U6Z A;  1T9X A;  2FD2 A;  1AB8 A;  3DLE B;  2MQM A;  3D4J A;  5DG8 A;  2V4Q A;  4ALZ A;  2AGQ A;  5A6W A;  4OYI A;  5F8J A;  1H7X A;  2XSJ A;  5BYR A;  5E3Q A;  1ITP A;  3HVR A;  1NSK L;  3GG1 A;  1RT6 A;  4HH1 A;  2DGQ A;  3ZTR A;  3CUL A;  2PFD A;  4LBH A;  3D3B J;  1FRL A;  3NRB A;  4UUX A;  4WU3 A;  2YNG A;  2ALZ A;  2CAX A;  1NJW A;  1NKC A;  4DR7 J;  3CD5 A;  4RPF A;  2V8P A;  3VQS A;  4B17 A;  1CJU B;  3BGR B;  3O3L A;  4CM2 A;  1LOU A;  1MWZ A;  1O6X A;  4DR6 F;  3OXL A;  3HHK A;  1NXI A;  2E44 A;  3EGV A;  4MH8 A;  1NM2 A;  3G5O A;  4QPT A;  3MM7 B;  1S9E B;  2J9D A;  4TU7 A;  3CDE A;  1HD0 A;  3V4I A;  2PI5 A;  4O3R A;  6AT1 B;  4RW7 A;  5KOX A;  4DV5 F;  3QBC A;  1SH2 A;  2HRT A;  2ZDO A;  2E1P A;  4Y2A A;  2B43 A;  4A4J A;  4C97 A;  2RD5 C;  3D3C J;  1F3F A;  3VQT A;  4F50 A;  2FHJ A;  1VS3 A;  3DHW C;  2BE9 B;  2O1P A;  4PEO A;  3K59 A;  5RUB A;  1DZ5 A;  3RU0 A;  1I51 B;  2YKA A;  2OI2 A;  2PA8 D;  4J9N A;  3C19 A;  4IRD A;  1QLN A;  1Q8K A;  4GVB A;  5HAT A;  1YJW S;  2AJ1 A;  1CEZ A;  1U0H B;  1UTA A;  1RT6 B;  2GJF A;  2J76 E;  3KDO A;  5E3A A;  2VG5 B;  2R7T A;  4FVM A;  3V81 A;  2MTL A;  1D0E A;  4PUO A;  1WKJ A;  3MR2 A;  3W64 A;  5L1L A;  2GHV C;  2MLZ A;  2WSE C;  1Z1Z A;  4KE5 A;  4DR1 J;  3RZA A;  2APO A;  1VQM S;  1D3W A;  3CED A;  4C9D A;  4TQR A;  3IA0 A;  3T1A A;  1ZTT A;  3HP6 A;  3F41 A;  3Q8R B;  2ZIT A;  2CUY A;  3OTO F;  3KLI B;  5K5M A;  1GXL A;  2HWT A;  4RW7 B;  4E0D A;  2IMW P;  4OYB A;  2CJK A;  4LF7 J;  5KFJ A;  1M5O C;  5L9N A;  1FEH A;  2F8E X;  4W4M A;  2IVF B;  4Q0B B;  2RQ4 A;  3OUY A;  2DJW A;  1KTQ A;  1MWQ A;  3QT6 A;  1UET A;  1FT8 A;  1YRX A;  5B09 A;  1VJQ A;  4DFJ A;  2XBP A;  3BBF A;  4J7C A;  2J9C A;  5KFF A;  4MIB A;  4BS2 A;  1PBA A;  5J1P A;  2W8K A;  3KLH B;  2SXL A;  3UDE A;  2UUB J;  4OQJ A;  4MAK A;  2R7V A;  1MMN A;  4ECV A;  2MQ8 A;  2ZD1 B;  1IBC B;  3QIP B;  1CPZ A;  3SFG A;  1C4A A;  4J37 A;  2ERR A;  3R5G A;  3W61 A;  2I5J A;  1NK6 A;  3SDE A;  1OWX A;  4RW4 A;  1UVN A;  1S6P B;  5K20 B;  1U1Q A;  4LVN P;  1CS4 A;  4OZ2 A;  1P6T A;  2HAI A;  2D3O R;  3AOA A;  2HFO A;  1RP5 A;  3JSR A;  2VV5 A;  3MXH P;  4B3O B;  4QJV A;  3M8Z A;  2HBY B;  2ZBR A;  3NGD A;  2WOM B;  4JV0 A;  2ZWP A;  1RBO B;  1AT1 B;  4UF4 A;  5DQH A;  4XPE A;  1WSR A;  1H38 A;  2ROE A;  2Y0B B;  4ECX A;  2E1M C;  1L3S A;  2CQG A;  2RF2 A;  2Y0S D;  4ZPT R;  3GYX B;  1JLF A;  4IOC Q;  1R31 A;  2DR5 A;  3NAI A;  4DG1 B;  2BV3 A;  1GTE A;  1JNZ B;  1GQE A;  3D2W A;  2CPE A;  4DL6 A;  4KT0 C;  5HAO A;  4CLK A;  3QGH A;  4C8Y A;  2IHR 1;  1VBY A;  4CO2 A;  4URS A;  1YJV A;  4FPR A;  3T1H F;  3VZH A;  1SQF A;  4F4Y A;  1FDN A;  4K59 A;  2ZH8 A;  4FF1 A;  3V4I B;  4FS2 A;  3OD2 A;  1T3O A;  2HIY A;  3GFZ A;  4NOH A;  4WFZ A;  3HM9 A;  1IKV A;  1KNZ A;  1YZ6 A;  9ATC B;  2RH3 A;  3FRY A;  4XDC A;  1SBR A;  5DLG A;  2I5J B;  2OD4 A;  1G7C B;  3H2L A;  1WEX A;  4K2X A;  2OLW A;  5D15 A;  1PIL A;  4A47 A;  5DJB A;  3GIK A;  3QID A;  4ECT A;  3KNA A;  4USJ C;  3NMA A;  4JYA J;  4CNY A;  4K7Q A;  1U26 A;  2YWW A;  3FKB A;  1NSQ A;  1V3R A;  2VPZ B;  4EU0 A;  4JI1 F;  2CVE A;  2WOM A;  3GR0 A;  5DET A;  1D1U A;  4GKK J;  2XI3 A;  3W66 A;  1B0V A;  3H2U B;  4JI0 F;  2W9C A;  2VFV A;  2RF2 B;  4LQ9 A;  2RT3 A;  3C6U A;  4MIW A;  4X4N A;  4JV2 A;  4ZLP A;  2MKC A;  3Q23 A;  1VC6 A;  4DR2 J;  1SIZ A;  2ALY B;  1FTC A;  3AHP A;  3ISN C;  1KVJ A;  2UUW A;  2XCP A;  2WRM A;  3D0I E;  3H90 A;  1WOP A;  3NNA A;  1RJJ A;  4IRC A;  2LQ9 A;  1QUV A;  2Z30 B;  3R6L B;  2COL A;  5IZH A;  2F4V F;  2VD3 A;  1TL4 A;  3V6H A;  2K1R A;  3TP2 A;  4FF2 A;  1ZTW A;  4QCL A;  4O44 A;  2XTJ P;  4JI3 J;  1N34 J;  2D9O A;  2MJN A;  3KUE A;  5FLX Y;  1PSD A;  4P10 A;  1Q5Y A;  2DCL A;  4DX8 H;  2XMK A;  2BYC A;  2BOP A;  3RW6 A;  3LWM A;  2HG4 A;  2PC6 A;  2BW2 A;  3ILO A;  4NYP A;  4P2M A;  5D3G A;  4ZDN A;  3KK3 B;  2WW4 A;  4O3N A;  2HHS A;  3CJ4 A;  1LW2 B;  3B54 A;  4Q2L A;  2MEW A;  3L4B C;  2QMW A;  4LR9 A;  1YJT A;  3H5S A;  3JQM A;  4RNF A;  3CCJ S;  2GGP B;  2AEF A;  1Y5L B;  4I4B A;  4LR7 A;  2CVI A;  5HRO B;  2WB4 A;  1P27 B;  2ZVI A;  3MPW A;  4ZKA A;  2D3O 1;  1WHV A;  1FNO A;  1C0U A;  2YH1 A;  3FBC A;  2ZNY A;  3P5B P;  1XNQ J;  3KJV A;  3IAS 9;  2X1F A;  1NU4 A;  4C7Q A;  3QMQ A;  2CAJ A;  1TUV A;  3J81 j;  1MYK A;  1YSJ A;  1FKA F;  2NR0 A;  1TP7 A;  2LA6 A;  1RT7 B;  4XTT A;  3I56 S;  2UUC F;  3HVT A;  2HWI A;  4NLT A;  2MLX A;  2QFI A;  5AXN A;  5GAE I;  3MZI A;  1JXV A;  7FDR A;  2DIS A;  4KGZ B;  2G0J A;  1S6P A;  1VQL S;  4WF9 Q;  3L7O A;  2HZC A;  3MCM A;  1R0A A;  5J2M A;  3VEA A;  5EX3 A;  1UMJ A;  3CJQ A;  1YBU A;  2WVB A;  4IYQ A;  2CNO B;  4YFU A;  4YN3 B;  3PW0 A;  4NPO A;  2XY7 A;  5C2G A;  5IT4 A;  3KK3 A;  2EFO A;  3FBB A;  3UD3 P;  2JC1 A;  3W65 A;  1FJE B;  2XWX A;  1VJW A;  1ZBT A;  5DZ7 A;  2EFG A;  3I5A A;  3SQO P;  4W90 B;  4ZJL A;  3MM5 B;  5KG2 A;  2OTL S;  4I2P A;  5F8N A;  1YWX A;  2HHU A;  2Z2M A;  1UFW A;  2K06 A;  3LP1 B;  2MDA A;  1Y10 A;  2KN4 A;  1NPK A;  4RKU C;  4YR2 A;  2K8G A;  4O3S A;  1WKK A;  3QOQ A;  2EVZ A;  1FJC A;  2DBB A;  4LRV A;  1A7G E;  1T8E A;  3S8S A;  1DBD A;  2AY0 A;  2M70 A;  3DRP A;  3H25 A;  2EK1 A;  3VV2 B;  1IM4 A;  4A8X A;  3R2D J;  2WZ1 A;  1RYR A;  2YKM B;  2JZ5 A;  5J2N A;  4Y00 A;  2CQ1 A;  2FJE B;  3I0S B;  3M9M B;  3R1L A;  1L3V A;  4DR3 J;  1ZPW X;  3IO1 A;  2IIH A;  1IKY B;  4DEZ A;  5F8G A;  2EW9 A;  2ACM A;  3KHR A;  2A6O A;  2ZJP Q;  3GWC A;  4ECZ A;  2DH9 A;  2W9C B;  4FYY B;  3JSY A;  4RUB A;  5T7L B;  4EWT A;  2DKO B;  1EAR A;  2P9E A;  3ULH A;  1FTR A;  3I9V 9;  4H4K A;  1AXQ A;  2YPY A;  2AYG A;  3KNG A;  3CCS S;  4DSJ A;  2YNI A;  2YWH A;  3W62 A;  1JLA A;  4URG A;  1QTM A;  2G4B A;  2HQD A;  2VJU A;  3WX8 A;  1S0O A;  2VL1 A;  5DDP C;  5GAG I;  3BB5 A;  2KTQ A;  4O44 B;  2VH7 A;  4QIV A;  2QO3 A;  2AYE A;  1NK0 A;  5K9F A;  2AKW B;  3V6D A;  5IC6 B;  1BDV A;  3AD9 C;  3BKT A;  3MM9 A;  2CDR B;  1MLA A;  2V34 A;  1LQ9 A;  4DV2 F;  4M63 A;  5K14 A;  1RAI B;  5E0O A;  3A3N B;  1F60 B;  2JH3 A;  3O2I A;  1JXL A;  2XWY A;  3KDN A;  2ZKT A;  3S1T A;  5KFI A;  1PGZ A;  2ZHA A;  1BC6 A;  2IA0 A;  3G8S A;  1APS A;  1T05 A;  4GKK F;  1PYT A;  5AXK A;  3T9Z A;  3IAM 9;  5ETO A;  3AQO A;  4LIW A;  4ES2 A;  1KRP A;  3M6U A;  4NYO A;  3SEO A;  5AXL A;  3CWJ A;  4DPO A;  4DR7 F;  2EXU A;  1Y5I B;  1BQM A;  3L3C A;  3M30 A;  2OPR A;  4DLG A;  4ER8 A;  2NRE A;  2KEL A;  1MWY A;  3IP0 A;  4DN9 A;  3IFE A;  4YP3 A;  4UUW A;  4J9O A;  1K1S A;  4CQ1 A;  1C1C A;  2KB2 A;  3R2C J;  2KH9 A;  4P7T A;  4YY3 F;  2G2Y A;  1PAU B;  3MMA A;  2KKH A;  4OYM A;  1EAY C;  1CSJ A;  2YY3 A;  4L6V 3;  5L38 A;  3AOB A;  5KFT A;  1N34 F;  1FKO A;  5C42 B;  3QGG A;  2MKH A;  3LAM A;  2K7K A;  1FK9 B;  3PRV A;  4PYA A;  2C2D A;  5EHH A;  5GAH I;  4CLW A;  1HR0 J;  2C3Y A;  4DFP A;  5K14 B;  4U8Y A;  3TVK A;  3TEG A;  4CYU A;  3T3F A;  3JS9 A;  5CD4 A;  4CNZ A;  3H59 A;  2OH2 A;  2B7B B;  1C0T A;  3M6V A;  4P2F A;  2LEC A;  4LRC A;  3R5A A;  1UCN A;  2FY1 A;  1JLQ A;  2UVV A;  1VQK S;  2AJF E;  3SCK E;  3TVY A;  1WC5 A;  2L9W A;  3DDK A;  3EPG A;  4N76 A;  1UPP A;  5F9N A;  2D9P A;  3C14 A;  1PJ5 A;  1X4D A;  1IQZ A;  2G1D A;  3OR2 B;  3MM7 A;  2XM3 A;  2EFQ A;  4N5S A;  1PAR A;  3NBP B;  1SJ4 P;  4ZVT B;  5HMY A;  2HLT A;  2HVH A;  2M8H A;  1H72 C;  4PQU B;  4AND A;  3ZZY A;  3NCQ A;  1RWX B;  4I1T A;  1KS2 A;  2E5H A;  4YR0 A;  3MM8 A;  2E9R X;  2DO0 A;  2CIM A;  2LDI A;  3M2U A;  2BMB A;  2KFZ A;  1PKU A;  5HMW A;  3DCA A;  5F8M A;  2PI4 A;  4ENO A;  1BGX T;  1NHK L;  3GJT B;  4PAB A;  5F3T A;  4I6W A;  1WC1 A;  2BNZ A;  2HZV A;  1CQN A;  1DLO B;  1Q53 A;  5KG3 A;  4F2S A;  2K7J A;  2DGS A;  1RIS A;  1ZS6 A;  2HND B;  2ASL A;  3MUT P;  1N5S A;  2QN6 B;  3I82 A;  4TKT A;  2V63 A;  1HL6 A;  2A18 A;  4NLS A;  5DRK A;  5KT5 A;  3K5O A;  4ECW A;  2DT9 A;  2W1B A;  5HLF A;  1YJ7 A;  4WII A;  5L1J A;  5THW A;  3JTO A;  3TOQ A;  2GML A;  3K17 A;  2RDI A;  5D78 A;  2XYP B;  4IH7 A;  5CAB A;  4ZPD A;  2O66 A;  2CAD A;  1A9N B;  1LWC B;  2Y1L B;  3EM1 A;  3FMT A;  1RU2 A;  1O5J A;  1OQ6 A;  1Q7L B;  4O23 A;  3G4S S;  3Q24 A;  3A8K A;  4WTO B;  2DNQ A;  1TKX B;  2CZV C;  2OPS B;  1VRU A;  2RKI A;  4ZPV R;  3EVO A;  4IOA Q;  3E2E A;  2B9Y A;  4DR6 J;  4WFA Q;  3MAH A;  1Q8B A;  1N33 J;  4NLU A;  2R8H A;  3IWN C;  2IAJ A;  5G0R A;  2BNW A;  1CC7 A;  2PMW A;  3B8H A;  3C15 B;  1VQ8 S;  1DTQ B;  4NZ6 A;  1F2G A;  3CJ0 A;  4I56 A;  4NLY A;  4V19 X;  1WF2 A;  5DG7 A;  2RDD A;  4HH0 A;  4FYV B;  2B9E A;  1U0S A;  2JL9 A;  1HFE L;  4DV7 F;  3OTE A;  2RS8 A;  4QYR A;  4NLD A;  1XMO J;  2AJ2 A;  2F5G A;  2VHG A;  4M5J A;  3BGL A;  3TAQ A;  2R7R A;  5KG0 A;  3RW7 A;  3HXM A;  3SBM A;  4RW8 A;  4KH0 B;  3SI8 A;  1HWJ A;  2CNL B;  1QAI A;  2VA3 A;  1I5O B;  3UDL A;  1B01 A;  1C1B B;  2HFZ A;  3M8R A;  3HFK A;  4X65 F;  3VAM A;  2ZUA A;  1T9T A;  1VRU B;  4QWE A;  1P8G A;  3JSM B;  3QRP A;  3PEH A;  3MI7 X;  4X84 A;  4BC9 A;  2RML A;  3R1H A;  1B7F A;  5L8R C;  3H5Y A;  1WOS A;  2ZE2 A;  4W98 A;  3T6J A;  1XR6 A;  3D54 A;  2J7W A;  4CYU B;  1E6Y A;  2E7V A;  2QLB B;  3B6B A;  4JI0 J;  3M8Q B;  2HMI A;  4TLR A;  3LGM A;  1AZS B;  3OR2 A;  1S77 D;  1JLQ B;  4TNO A;  2PGC A;  1SH3 A;  4GRS A;  1RT5 B;  3IWL A;  4IOB A;  2L08 A;  2CQC A;  4IG3 A;  4Q2M A;  2BAN A;  3G2X A;  5KFC A;  4UOF A;  3M9N B;  1JLC A;  2CA9 A;  2H3A A;  1REG X;  3HHE A;  1Y4Z B;  4DV1 J;  2QYG A;  1RTI B;  2GMJ A;  2EWH A;  3BN4 A;  1PJ6 A;  4IFV A;  3GR1 A;  1Q86 T;  1WHY A;  2AMC B;  5A0Y A;  4GC7 A;  1GXU A;  3QGI A;  3U1M A;  2HHP A;  1UFK A;  4DI6 A;  2VFR A;  4MTP A;  5H9E K;  2UUB F;  4F8R A;  1NAQ A;  1RE1 B;  3I9Z A;  2GHP A;  1QAJ A;  3LGN A;  2XMU A;  4B9U A;  2B5J A;  5E3R A;  3NGS A;  3JQJ A;  3LPE A;  4LFB J;  3HD1 A;  2BVZ A;  2D74 B;  1REV B;  1T9Y A;  1RT4 A;  2O5D A;  3SFU A;  4P73 A;  5DS7 A;  1HQE A;  4G3I A;  2DHH A;  4JI8 F;  3Q8V A;  4N56 A;  1TTH B;  2FLO A;  2V8H A;  1RAD B;  1WC6 A;  4WFY A;  3DRS A;  2MZ1 A;  4DUY F;  2J0X A;  1X5O A;  1LV5 A;  2RIJ A;  2C2K B;  1IKV B;  5L46 A;  1R0B G;  1CVJ A;  3GCX P;  2JSX A;  2ZFH A;  3MEK A;  3QT7 A;  2DHS A;  3L9Z A;  3DLG B;  4IQX A;  1RTD B;  2XS2 A;  1GTH A;  2Y9H A;  2F1F A;  2WB1 D;  2BUN A;  2IM0 A;  1Q8I A;  4BC7 A;  1NJI T;  1VQS A;  3GIR A;  3TA1 A;  3LUY A;  4C0H A;  2ABY A;  1RTH A;  4M95 A;  2QE5 A;  4OI4 A;  3I0S A;  2CPX A;  3CF5 Q;  3BKU A;  3QJL A;  3LP2 B;  2W7O A;  2IVY A;  1FCA A;  3HHL B;  2H4Y B;  3MEG A;  2DH8 A;  1BAZ A;  1BQN A;  1S7H A;  2AIR B;  2Z58 B;  2FHM A;  3IWX A;  3OQ2 A;  1IR2 A;  1RT1 B;  2PT0 A;  3KMS A;  1L5U A;  1RAJ A;  3KJV B;  2HNY B;  4IRK A;  2BW7 A;  3NMR A;  2WK4 A;  4X4Q A;  4L73 A;  4JYA F;  4PWD A;  5MLC V;  4RL1 A;  3KLE B;  4R5P A;  1F2H A;  1Z2L A;  2VPY B;  3C66 A;  4AL7 A;  3IS9 A;  2BAB A;  3UCG A;  2R8J A;  4PUO B;  3ZZZ A;  2MKI A;  1S0V A;  4B3R J;  5L1I A;  1D8Y A;  1Y00 A;  1OQ3 A;  2AWZ A;  2CPZ A;  1JQG A;  1IWA A;  1Y0H A;  3W5Z A;  1MNE A;  1AUS L;  3QWU A;  5F3Z A;  2XQC A;  3W60 A;  1HBO A;  2A2C A;  3MUR P;  3J7Z T;  2BKN A;  2NSC A;  4URQ U;  3KK1 B;  3PX0 A;  4IR1 A;  1SI9 A;  2YX4 A;  2GAH C;  2QA1 A;  2KT3 A;  3KJF B;  2NPF A;  2BSQ E;  5KFV A;  3C16 B;  4C8L A;  5IOL A;  1X93 A;  2AN7 A;  2A6M A;  2NXE A;  3EPI A;  1ELO A;  2GJI A;  2XMM A;  5H1S V;  3DOL A;  1XJW B;  2NYH A;  2V4J A;  4IDK B;  4U7C A;  4OHV A;  3VGV A;  2I8E A;  1WJ9 A;  2M5Y A;  2FIU A;  2CPH A;  4EUV A;  1C0U B;  2HQ3 A;  5KG1 A;  1F0X A;  4QWB A;  4RUH A;  5EGY A;  1NME B;  2W4C A;  5LSL A;  1SH0 A;  3CGI A;  3OR1 B;  2R2U A;  1ZAV A;  2GIQ A;  3BQ2 A;  2W9B A;  1D9A A;  1QM9 A;  4ED2 A;  2HNY A;  2AGP A;  4FP9 A;  1R8A A;  1Y7P A;  1QVF R;  4HDG A;  4ECR A;  1I94 J;  5I3P A;  4CCH A;  1S1X A;  4PG4 A;  4X4T A;  1VLY A;  4ZVU B;  2AGO A;  4S0M A;  3ELH A;  3G6X A;  2C2Z B;  5CYM A;  2DIU A;  3QAU A;  1UWA A;  2YQ1 A;  1NND A;  2CPJ A;  3QT5 A;  3CNQ P;  1YHQ S;  2K3I A;  1ARO P;  1KP6 A;  3HX9 A;  3RRK A;  3W9J A;  2AEM A;  3LPY A;  2N4C A;  3G8T A;  1MMD A;  4DL5 A;  4DV0 J;  3DLL Q;  4AXJ A;  5DM7 Q;  2AD9 A;  4RBV A;  5L39 A;  4DS4 A;  4JI5 J;  2NXJ A;  2OSQ A;  3FQL A;  5KFB A;  3GXQ A;  5D0E A;  2UXB J;  2HFU A;  3CJ2 A;  3RUB L;  1RT2 A;  4KHP F;  2MPU A;  1KBR A;  5D4L A;  1WDT A;  1TV6 A;  4G6V B;  1S9E A;  5HVG A;  4FNH A;  4YY3 J;  4K8R A;  3PVX A;  2HNZ A;  4FYX B;  5KT2 A;  2IJF A;  1S5Z A;  2AT1 B;  2M0G B;  4M5H A;  5ETK A;  3EJM A;  4ED6 A;  2FLP A;  2WON B;  4J9U E;  3TZZ A;  2A10 A;  1TZ0 A;  2CQP A;  5CYQ B;  2ATC B;  1S79 A;  4ZLN A;  4I6Y A;  2AV5 A;  2RRA A;  1M5P C;  4C98 A;  4CZC A;  4EYH B;  4CLU A;  3GV8 B;  1S57 A;  1B3T A;  2Z8Q A;  1R6Y A;  1T02 A;  4HHH A;  2PMH A;  4HV0 A;  3DRR A;  1OIA A;  3JTN A;  4JI4 F;  1FRK A;  1RQ0 A;  2NQP A;  2YXL A;  3PIP Q;  4OYO A;  2M2B A;  3BYR A;  5I3U A;  3D6H B;  5D8H B;  1QDU B;  2ZWO A;  3OTC A;  3RBX A;  3OVB A;  1WAC A;  3MD1 A;  5CAA A;  5FLX U;  4ZIV A;  1KOO A;  3LP2 A;  5ETR A;  4ZCK A;  5SUH A;  4CH0 S;  2X3D A;  3CCT A;  3D6T B;  2KXN B;  4JI8 J;  3H5X A;  1P94 A;  5D4O A;  4WXW A;  3NOC A;  2KG0 A;  3I5C A;  3KK2 A;  4DSK A;  2LLZ A;  5DO2 A;  4UQG A;  1HI1 A;  1S1V B;  2H4W B;  1MRO B;  4NLV A;  2XMA A;  4DQI A;  5HVH A;  5C42 A;  2KG1 A;  1J5E J;  2ILY A;  1IWG A;  2KU7 A;  4NYZ A;  4LFA J;  4OZN A;  4KAI A;  1LK7 A;  3LO3 A;  3R6G B;  3HT0 A;  2R8G A;  4B9L A;  2VB6 A;  2DY9 A;  4DPX A;  5A76 A;  3KJQ B;  2FHJ D;  2JEG A;  3EZO A;  2XS7 A;  3R9L A;  2JWN A;  1G3O A;  1RBA A;  2UV8 A;  1NZA A;  3MR3 A;  1GFW B;  3JYT A;  1U47 A;  3DN9 A;  1WC0 A;  2FPH X;  2QLX A;  3CJS A;  1Y9O A;  2W4D A;  2B9W A;  1DJ0 A;  2PA3 A;  4DPT A;  2XY5 A;  1R3N A;  3EXC X;  4L3N A;  4DV2 J;  3G71 S;  3LQV A;  3M2R A;  5HVF A;  4NXM J;  4HT7 A;  1RTZ A;  2QGF B;  2AYM A;  2ZNZ A;  4IFY A;  1S1X B;  4DV6 J;  2LU1 A;  2V0N A;  4RBU A;  4BHQ A;  4MMO A;  1TUW A;  2FY8 A;  5LJ3 Y;  4IUF A;  2DR6 A;  3ET6 A;  2UXC F;  2LXI A;  3PYD A;  4G1Q A;  3P3D A;  4ZVF A;  2B0G A;  2NZ4 A;  3GLJ A;  1F3V A;  1UPM B;  2UUT A;  4KQZ A;  4QQB A;  1FK9 A;  2H48 B;  5KFK A;  2R2T A;  3LF0 A;  1BQX A;  4K4T A;  1VBX A;  2Y1R I;  4CRJ A;  1W2I A;  1UKU A;  3MOZ A;  4NXN F;  3UN5 A;  3OLA A;  2KT2 A;  3TAN A;  1CUL B;  1N33 F;  3CDB A;  2QMX A;  1R0A B;  3U27 A;  1EET B;  3QWP A;  2EK6 A;  4M1K A;  3BF4 A;  3TWZ A;  1M5V C;  1UAW A;  5KFU A;  4LFB F;  3LP0 A;  1T03 B;  1YG0 A;  2HUR A;  3BJY A;  3MPU B;  4E8U A;  5HLF B;  1XK8 A;  3DU5 A;  5IQ6 A;  1ZOT A;  2CQI A;  3I5B A;  3VHQ A;  4QU6 A;  2C1E B;  3PM9 A;  2ZH4 A;  2DXE A;  2XHC A;  5HQL A;  4YME A;  3PTW A;  4H4K C;  3G96 A;  3CD7 A;  1N5Y B;  3BSC A;  2NLW A;  3VTI A;  4YDD B;  2ADC A;  2IVM A;  1CJU A;  3JAM U;  3UD4 P;  3UN3 A;  4ZN3 A;  5DG9 A;  1KFD A;  3OT9 A;  4KYZ A;  2N82 B;  2HNZ B;  3KLG B;  2BRL A;  3PRD A;  1KTV A;  3DRP B;  3LA0 A;  1SV5 A;  3H42 A;  3QYY A;  2CNN B;  5AXM A;  2Q66 A;  1JX4 A;  4HHU A;  1EKS A;  3MED A;  2QT7 A;  5KFS A;  3IR7 A;  4FXV A;  2F3J A;  5B08 A;  1XBW A;  2UVW A;  4DR4 J;  2ZBQ A;  4RZR A;  2W7P A;  5K8N A;  3KTQ A;  1Y3K A;  3AQP A;  2PMZ D;  2U2F A;  3GV7 B;  3CC2 S;  2Z2L A;  4AYB D;  5HQ8 A;  2EKN A;  2OEL A;  4N8O A;  2CPF A;  1H98 A;  2RVJ A;  3B4D A;  4KHP J;  2VKR A;  4XIU A;  1GNK A;  1X9W A;  2GQQ A;  5E41 A;  2KXH A;  5GAD I;  4DUT A;  3SMZ A;  4Y2K A;  2VF3 A;  1SL2 A;  4KKO A;  4UOG A;  1DTT A;  4DX6 A;  3JTP A;  4K4Y A;  1T11 A;  2DNL A;  1NCL A;  3GE9 A;  3IBF B;  1RXO B;  4U7U D;  1RKJ A;  1S6Q B;  4K2J A;  3QT8 A;  1RI7 A;  4YUD A;  1U1P A;  2D7S A;  1W26 A;  2ASJ A;  2J7U A;  1URN A;  4ZVG A;  2M7S A;  3MMJ A;  2NXC A;  1VGY A;  3HF5 A;  1IJF B;  1RAE B;  3MOJ B;  1AZS A;  3M2R B;  2JFD A;  3IG1 B;  3NGK A;  4ES3 A;  5KG7 A;  3DLH A;  2MJU A;  2HFV A;  5EX0 A;  1WSV A;  3IRX A;  1WD6 A;  2FYX A;  3DYA B;  1OSC A;  1IJE B;  4UZC A;  3V2U C;  3VAK A;  4A8W A;  1YDL A;  3J81 U;  4GO5 X;  2E66 A;  4HT5 A;  4YR3 A;  4USW A;  3MEC B;  3CW2 C;  3TZX A;  3DLK A;  3QNW B;  4FKX A;  1VLO A;  1C1C B;  1XEZ A;  2ZH3 A;  4WZM A;  3CCW A;  1W2B R;  2GS8 A;  4ZCL A;  4CLL A;  1GMW D;  2QLW A;  1UJ4 A;  2ASD A;  2BXJ A;  2I9S A;  1T3N A;  3BM7 A;  3DLE A;  1N48 A;  3CUN A;  2BBE A;  4PZV A;  4U7U K;  2VOD A;  4L75 A;  2HKE A;  4P75 A;  4RO0 A;  1T0T V;  2C2M B;  3MFI A;  2KDO A;  2D3Z A;  4AT1 B;  3CCZ A;  4KPY A;  2BDP A;  1FXL A;  2QZ8 A;  3TO8 A;  1K8A T;  2CKW A;  1NPR A;  1Z4U A;  3ENA A;  2NZC A;  1QD1 A;  4K5S A;  4TYA A;  1JXE A;  5DLF A;  3JXO A;  4UOH A;  2W2P P;  4PAA A;  5DDR C;  3M7V A;  2Q3P A;  1C0T B;  4KC5 A;  4RNN A;  5ETP A;  3S7R A;  2HQC A;  3BGR A;  3H20 A;  4QW8 A;  1H7W A;  1NBE B;  2QX0 A;  4X65 J;  2Y1I A;  1WUU A;  3SV4 A;  1U1R A;  1Q78 A;  1JNR B;  1JLC B;  1SJ1 A;  3R97 A;  3U1N A;  2DR9 A;  3LTO A;  4F0M A;  2CJ9 A;  2CQD A;  2NPI A;  2RU9 A;  4DCO B;  2XY6 A;  1RTD A;  1UVL A;  5LXR A;  4Q43 A;  1HNI A;  1UZD A;  4DDF A;  3MM9 B;  4ELT A;  3FBF A;  1KDN A;  1TVR A;  3MEC A;  2YKM A;  3OXF A;  3N5B A;  4OX8 A;  4WE1 B;  4Y28 C;  1B99 A;  2KM8 C;  2F4F A;  4RW4 B;  3EVM A;  4PQU A;  2CPI A;  5KFX A;  1OO0 B;  2CDQ A;  1LWE B;  4WCE Q;  4ZP6 A;  5I42 A;  4LRD A;  2QMU B;  3EGZ A;  4DUZ J;  1R8H A;  2F9J A;  3FEX B;  5ETV A;  1U2C A;  3H87 C;  2VFT A;  4MFB B;  1UL3 A;  2WVD A;  1CJK A;  3T1Y F;  1VIX A;  1OHN A;  4U96 A;  2CYY A;  4Z7Y A;  1L3U A;  5ETT A;  3AH6 A;  1S10 A;  2KJV A;  4HTJ A;  3OL9 A;  4J9L A;  4QU7 A;  4I69 A;  3VEB A;  5C5J A;  1D9F A;  3HVA A;  3W2W B;  4KSE B;  1OMS A;  3FQK A;  1V3Z A;  3DLG A;  1DTT B;  3W8P A;  1I94 F;  4OHW A;  1S9G A;  4KGX B;  2DGV A;  3BPS P;  5K8O A;  1LKZ A;  5F0W A;  3FDS A;  2YNH B;  3LW5 C;  3UCZ P;  1QSY A;  2DNN A;  2GA7 A;  1PBU A;  2CQ0 A;  2GIR A;  3RB0 A;  4DUY J;  1DQ8 A;  1TKX A;  2RKI B;  4Q8E A;  1RHJ B;  1JJ2 R;  4PPZ A;  1GX5 A;  3HHL A;  4CTA A;  3NNE A;  1RHU B;  4RNM A;  3PJW A;  3PYF A;  4JB8 B;  3NCP A;  4ED5 A;  3NWR A;  3VWS A;  1X9M A;  5D0G A;  4C3K A;  3PIO Q;  1SC4 B;  4JI5 F;  3DOM B;  1GMW A;  2DNH A;  4H4M B;  5A8R B;  1U4B A;  2V2K A;  2MGZ A;  3KHL A;  1U45 A;  3C6U B;  4I64 A;  1HHT P;  4OJ1 A;  3SCI E;  1MYL A;  1LEO A;  4LF7 F;  1AFJ A;  5B0E A;  2HS4 A;  2ZBC A;  3BPD A;  1FRM A;  3L7U A;  5HL7 Q;  1J5O A;  3EE3 A;  2DH7 A;  2OFH X;  4ZHR A;  4DSF A;  2R4F A;  1KKH A;  3R7S B;  3PW4 A;  1X9S A;  3TAM A;  3DC2 A;  3EDQ B;  4USV A;  2VAS A;  2XZW A;  4KBI A;  1F9H A;  1WG4 A;  4WP9 A;  2KM8 B;  3RAQ A;  2OUG A;  4PG5 A;  4QR1 A;  2MST A;  3M6X A;  1VBK A;  4M5L A;  2B56 A;  2DNY A;  4TVA B;  5GAH U;  4LF6 F;  2V4J B;  4IDK A;  1UWB B;  2VJV A;  1SXL A;  5KFW A;  2P9G A;  1SKR A;  3VAG A;  2VFS A;  1M1H A;  1R89 A;  4K4U A;  1WTF A;  3E01 A;  2OPP A;  3IXQ A;  1SC6 A;  3G86 A;  4ERD A;  4X4S A;  1JIH A;  2FC9 A;  3QAE A;  4DSI A;  2WAQ D;  3THT A;  3DKD A;  4RUA A;  2OEJ A;  2ACY A;  1YJR A;  1BXN A;  2LDY A;  5DGB A;  3GV5 B;  3EZ5 A;  4KTQ A;  4CP5 A;  2CJB A;  2W4P A;  5B0A A;  1N32 F;  2LEB A;  2O67 A;  4B3S F;  5KT4 A;  4EK2 A;  4QYZ J;  1XMB A;  3IC1 A;  4TYB A;  2JLG A;  1EHW A;  4NLO A;  3CVK A;  5KTQ A;  2DIV A;  1SC3 B;  1Q7Y T;  2VPX B;  5JVG Q;  3FBE A;  3SXL A;  3WQP A;  4C8K A;  2VPW B;  1W7W A;  4QW9 A;  1WHX A;  2Q6C A;  3NGT A;  3POT A;  1S59 A;  4QR0 A;  3D67 A;  3DM2 A;  3AT1 B;  2VIH A;  5I42 B;  3ZO7 A;  2QJ3 A;  3T1H J;  2UXD F;  3ILJ A;  3N6M A;  1FF2 A;  3MDF A;  2P2C B;  3NLC A;  4ANE A;  5SZT A;  1NK5 A;  1RHQ B;  1X4C A;  3H7H B;  1U1N A;  4R0E A;  3FUY A;  1FES A;  2IRY A;  1S1U A;  1AYE A;  1REV A;  3QPI A;  3S01 A;  3UDC A;  4ES1 A;  5GVQ A;  3MUV P;  3KOA A;  5LOQ A;  4J9K A;  4O3O A;  2P5V A;  2Z56 B;  1ZA1 B;  1VIO A;  2POK A;  5KFQ A;  4ECY A;  5EUH A;  4X4V A;  3B78 A;  3SCL E;  4FXD A;  3ZXW A;  3TUZ C;  4N41 A;  2UXC J;  3MM6 A;  5I4M A;  4LF4 F;  3BZQ A;  4DBQ A;  1FX2 A;  2FC8 A;  3P4U B;  2XLI A;  3HPO A;  4DV0 F;  4U9R A;  3CME S;  3I31 A;  1SJR A;  4IO1 A;  4AXI A;  3X1L B;  4X4U A;  1Q5V A;  1SKU B;  5A8W B;  5A2Q U;  5J1N A;  3Q89 A;  1SJ3 P;  4ZP8 A;  2B3T B;  5F0U A;  4C48 A;  1FI4 A;  1RWP B;  1BWV A;  2WW8 A;  1S6U A;  5A6P A;  1H2T Z;  1RAO A;  1FDB A;  3POT B;  4OMF G;  3ISZ A;  5D0H A;  4WK3 A;  4Y2I A;  1EKR A;  4GC6 A;  3UCU P;  2F4V J;  3NXZ A;  5EN1 A;  2HMI B;  1BD6 A;  2QL5 B;  3AJ2 A;  1HPZ B;  3LOU A;  4CH7 A;  3PR4 A;  3Q0A A;  1QJH A;  3MUM P;  1FE4 A;  2QA2 A;  1WKL A;  2VG6 A;  2GVD A;  5KT7 A;  3MCN A;  5FII A;  5LL6 d;  3CCM S;  4CT8 A;  2W25 A;  3IR6 B;  2AW0 A;  4F26 A;  2UUA J;  1LFP A;  4C8Z A;  4J9V A;  2YWG A;  4LSZ B;  2E5I A;  1HBU A;  2YH0 A;  3U7J A;  2AJQ A;  4Y0F A;  3OTB A;  4RW6 A;  1I6J A;  4L72 B;  4B9S A;  4FYD A;  2HHQ A;  1WF0 A;  2ZOG A;  4OI3 A;  1RSC A;  2FVP A;  2OEM A;  2JHE A;  3KWM A;  4E2F B;  1NJZ A;  2W2N P;  2IA6 A;  3UR3 C;  3CCL S;  1FKP A;  1V5V A;  1U8W A;  1KVI A;  4UTG A;  3B82 A;  3JYT B;  3E01 B;  4JI7 J;  2KZZ A;  5AE2 A;  2X7I A;  2UV8 G;  3QLH B;  5D77 A;  4PYD A;  1PCA A;  4WKY A;  1U1K A;  2VON A;  4DR4 F;  4Q0B A;  2KYZ A;  2FZC B;  3FK4 A;  1URR A;  2HRY A;  2N7Y A;  1I1G A;  2ZH5 A;  1T05 B;  4LF9 F;  4LFA F;  5DDO C;  4EFA C;  3LP1 A;  4JI2 F;  3O1L A;  2Z2Y B;  4MYT A;  4PXD A;  3PJX A;  3BGO P;  4DV3 F;  3OW2 R;  2Y8W A;  4KY3 A;  3UWT A;  3C3L A;  2GVD B;  1UW9 A;  4FPI A;  3D6F B;  1RDR A;  4FS1 A;  2JEF A;  1R0C B;  1B7Y B;  4EO8 A;  4J9P A;  1U6F A;  4A8S A;  1FHT A;  3F44 A;  3UVJ A;  1F1B B;  1QTG A;  3I4P A;  1JKH A;  1V9O A;  4JUZ A;  2V6A A;  4F02 A;  4F0H A;  3TEH B;  2DXD A;  5AE3 A;  2W9A A;  3ETM A;  4ZLJ A;  5IXU A;  2GNK A;  5GMK a;  2FJW A;  4NXM F;  3HJF A;  1OJ4 A;  3C6T B;  3TA0 A;  1TKZ B;  2GVZ A;  3MPY A;  4RBT A;  2EBG A;  1RWM B;  4WYW A;  1FJG J;  4KJI A;  1P9Y A;  2GQC A;  4O0N A;  2MKK A;  5D0R A;  3NGR A;  2LEP A;  4NWB A;  2RJZ A;  2ZHB A;  2ZHO A;  4RWW A;  3GIL A;  4C8M A;  2XGP A;  1SC1 B;  2ZKU A;  4CLF A;  2BQ3 A;  2I2Y A;  3WC2 A;  3X3U A;  1HQU B;  2DB1 A;  4OLO A;  3RG6 A;  1RZM A;  3EMT A;  1LNQ A;  4G65 A;  3THP A;  4ED7 A;  1N88 A;  2UP1 A;  2EFN A;  2MMY A;  4FKY A;  2BQU A;  3ZZP A;  1WC3 A;  3SSS A;  3V6D B;  1HAR A;  2KJW A;  4KHM A;  3NP5 A;  4LFC F;  3PY8 A;  1PAE X;  1S6O A;  2FVS A;  3RAM A;  1JKH B;  5GMD A;  3D28 A;  2Q2K A;  5ITH A;  3GSD A;  4WE1 A;  4OYA A;  2ZZM A;  2AP6 A;  3LAK A;  4DL0 C;  2CPG A;  3RJM B;  4ZMM A;  5EWE A;  3BO2 A;  3MFH A;  1U1L A;  1LWE A;  2KFY A;  2N3O A;  2P6T A;  1VR6 A;  3NO7 A;  3M6W A;  3ZNU A;  2N7C A;  3ZZ0 A;  3HI9 A;  3UDV A;  4WJB A;  3N9U C;  1ULR A;  3R5C A;  5KT6 A;  5H9E J;  4TY8 B;  1GMV A;  1ICE B;  1VQY A;  2CQ3 A;  3ZZO A;  5IC4 B;  4DR5 F;  3KG4 A;  2JBV A;  2ZH7 A;  2E9T A;  4C3M A;  3G82 B;  4O4R A;  2HZA A;  1FE0 A;  2KRR A;  2F8H A;  2QEX S;  4HYK A;  2HSE B;  1TR0 A;  5B0C A;  4LF4 J;  3P6Y C;  1RAB B;  1TK5 A;  4Y2M A;  4BCA A;  2QC3 A;  1FKP B;  1SB6 A;  4FBT A;  1MW7 A;  1YZ7 A;  1Q16 A;  3GYN A;  1NB2 A;  3CMQ A;  1CC8 A;  2LU2 A;  1BE4 A;  2BKO A;  5E3C A;  3UNG C;  5DM6 Q;  1NDP A;  4WKR A;  2GHW A;  4AQY F;  4TQS A;  4AUK A;  4ZLL A;  3RR7 A;  4ZPA A;  2BJ8 A;  1Z2Z A;  2HVD A;  5HBM A;  3W9H A;  2E5L J;  3TJ8 A;  1FD2 A;  1OPZ A;  4NEZ A;  1IKX A;  1MU2 A;  3T1Y J;  1LW2 A;  3C14 B;  4KHR A;  4M5D B;  1M5H A;  3SSQ A;  1F9E B;  3O6Q A;  3QSY B;  3KUG A;  4M5I A;  5KFZ A;  6FD1 A;  4PXC A;  2PSZ A;  4G1P A;  3PDN A;  2V8V A;  3PAC A;  1HR0 F;  3FZ2 A;  1CBK A;  1VOM A;  2CQB A;  2C3P A;  2M3D A;  2WON A;  4MJK A;  4DZ6 A;  3V6K A;  2OMO A;  2R7O A;  3UO0 A;  2EI5 A;  4F2R A;  1G4C A;  3J7A 1;  2C3O A;  4X64 F;  2PN6 A;  3A8I A;  3KG1 A;  4X66 F;  4TU8 A;  1BDT A;  2XGQ A;  2V4R A;  4HI1 A;  4OX9 F;  3DRR B;  2DPJ A;  3Q8Q B;  1VRT A;  2AJ0 A;  1CLF A;  3NOG A;  4DN0 A;  2M4M A;  3M2V B;  1FO1 A;  2JVO A;  2B5J B;  3F56 A;  3SZ2 A;  1JLB B;  4ZS6 A;  2ZE2 B;  3P8B B;  3C2P A;  3GYG A;  1RT2 B;  3VGT A;  5A8K B;  4P7V A;  4L76 A;  3US5 A;  2ATL A;  1L3T A;  4AAI A;  2HW3 A;  4DV3 J;  1HWI A;  3ZZU A;  5CYJ A;  3OJS A;  3MEE B;  3IGV A;  4D3G A;  4L3K A;  3OL6 A;  4F3O A;  3W2V A;  3L09 A;  3OBI A;  2MQL A;  1LWC A;  3Q83 A;  3DGP A;  5LMN J;  1RT5 A;  2F63 A;  3O44 A;  3CIM A;  1VK8 A;  3ZZR A;  2HHH J;  2C2O B;  3BO4 A;  1VI7 A;  2BKP A;  1WWH A;  2UXD J;  2DNP A;  2ILZ A;  3PW7 A;  5LMU J;  3D9B A;  4CI0 B;  5IV3 A;  1N5V A;  4ZOS A;  4DX7 A;  1XMQ F;  2J6S A;  4FF3 A;  2RBF A;  3ZNJ 1;  1F5B A;  2DGU A;  2FZG B;  2HFS A;  2IAJ B;  1HMV A;  2M8D B;  4Y34 A;  2V2Z A;  4A8M P;  2CQ4 A;  2N3L A;  3UN2 A;  3PO4 A;  2A3J A;  4TY8 A;  2EEY A;  1U0H A;  4MKB A;  4I2Q B;  2B7C B;  4Q5V A;  1UVJ A;  1BWE A;  1KLN A;  1KC8 T;  1J5E F;  1JB0 C;  1R8C A;  2FJB B;  1SL1 A;  2I6W A;  2W24 A;  5KFD A;  1O51 A;  1N32 J;  4RU9 A;  5C2C A;  3NG8 A;  2CWK A;  3T5L A;  4M5N A;  2ZH9 A;  2DIT A;  2E7W A;  2CPD A;  3AY0 A;  3MHY A;  4NL5 A;  2VKZ G;  5JXS A;  3BO3 A;  1T9W A;  3IS9 B;  2EKY A;  1VIS A;  4GKJ F;  1FXD A;  3CSK A;  1R6V A;  4J90 A;  1N6Q B;  1FWK A;  3TUP A;  4AFF A;  2OIH A;  2JEJ A;  1ZYQ A;  4DV7 J;  1HBO B;  1JJC B;  1KD1 T;  1RLD A;  2OD6 A;  2V69 A;  2WHO A;  3PYG A;  4TN2 A;  4NXN J;  3ISN D;  4WXO A;  2CQ2 A;  2MB0 B;  4B02 A;  4NCB A;  1TFW A;  2E1R A;  2MKJ A;  3FSX A;  1JLG B;  2NSB A;  2RQK A;  3S6E A;  5HQM A;  2DR7 A;  3CC7 S;  2W2M P;  1FJ7 A;  5A8R A;  5CD4 H;  4IR9 A;  4ZIW A;  2MLY A;  4O0I A;  2OJ3 A;  1E6V B;  1Q0N A;  3TYT A;  2HBZ B;  4CWB A;  2PEH A;  4WFX A;  1KON A;  3RAX A;  4GVL A;  3SQG B;  3MTK A;  4NLQ A;  3GON A;  3QO9 B;  3K89 A;  4F4Z A;  1D09 B;  2CRL A;  1DY3 A;  3OR1 A;  2BQR A;  3EUN A;  4YB5 A;  2MKY A;  1HNZ F;  3P49 B;  1UZH A;  1S49 A;  3ADA C;  4NEY A;  3Q8P B;  4W92 B;  1IBL J;  3I87 A;  4DU8 A;  1NEE A;  1RUS A;  1RA6 A;  5HAN A;  2GPE A;  4JOU A;  1IR1 A;  5LJ5 Y;  3SCJ E;  2B6A A;  1C4C A;  1HHS A;  2V2V A;  2R7Q A;  2YWE A;  3DXB A;  4KR0 B;  4LSN A;  5HO4 A;  4UY8 T;  4HKQ A;  3ZTO A;  5T7L A;  1JLF B;  1KWM A;  2G13 A;  1OY9 A;  4MIA A;  1VQO S;  1SIW B;  5E5N A;  2BX6 A;  2E5L F;  4B3M J;  1RCX B;  1NHV A;  2QRR A;  2YKP A;  2OFG X;  3GB0 A;  4KH1 B;  1U1M A;  3M2V A;  2AJ4 A;  2H1Y A;  3MEE A;  4KGM A;  1HNV A;  1X5T A;  4ID5 B;  2ZUG A;  1KQS R;  1TL3 B;  2UUA F;  2R8K A;  4YEA A;  2RQM A;  3ENQ A;  2AX0 A;  8ATC B;  4LF6 J;  2JVR A;  3D7S B;  4PR6 A;  3CXC R;  3TRG A;  5MAO A;  2KI2 A;  3THV A;  4PKD B;  4R8U A;  3FCV A;  4OI2 A;  4U8V A;  4ZCI A;  4I0W A;  3A4T A;  3AXK A;  2JDJ A;  3RBZ A;  5JMN A;  3HMJ G;  4X4R A;  1U09 A;  2FLN A;  3CB4 A;  2I0X A;  1P1T A;  3M32 A;  4X66 J;  4OLP A;  5K8P A;  2XCA A;  3CJ3 A;  3V4M A;  5HMZ A;  1F9F A;  1N54 B;  3HSZ A;  5CYM B;  4A8Y A;  1RGV A;  3OL7 A;  1YGY A;  4WYL A;  1HA1 A;  1HWK A;  2K3K A;  3OHB A;  2G0I A;  4I2Q A;  2X1B A;  4C2M A;  2VG6 B;  4AL6 A;  4DV4 F;  1WDD A;  1M5K C;  1JLE B;  4LF9 J;  2VBW A;  2RSQ A;  4LRE A;  1OYE A;  3KMQ A;  1VFJ A;  2DVI A;  2EG1 A;  3DRX A;  4CH1 A;  5CXT A;  2OTJ S;  1UA0 A;  5DQI A;  2H5I B;  2XLJ A;  4NLW A;  2HLU A;  2LMI A;  2M9K A;  4M5K A;  2MQN A;  1SUQ B;  3LAL A;  3PHT A;  2K1R B;  1TL7 A;  4LQ3 A;  3R5B A;  3ITH B;  1S4F A;  1O8B A;  1TV6 B;  3CD0 A;  4MKY A;  4CO1 A;  2L9N A;  2JLF A;  2DPI A;  1KR4 A;  3PKM A;  1MML A;  3BRE A;  3QAT A;  5HP1 A;  2VDI A;  3N01 A;  3NY0 A;  4DFM A;  3DLB A;  1UEK A;  2OPS A;  2LYV A;  4ECQ A;  4B3R F;  3Q8Y A;  1TU0 B;  4P9S A;  4D8J A;  2V94 A;  3FSI A;  2Z2Z A;  3CT9 A;  2XZD B;  3NKY A;  3WDO A;  5G0R B;  3KJN B;  4CTA B;  4B9N A;  1X31 C;  2K2P A;  3AOD A;  2FB0 A;  2HFN A;  5D4N A;  4NX9 A;  1VHI A;  1F5A A;  3ZTQ A;  8RUC A;  3CO9 A;  4NRU A;  5M2U A;  4YB6 A;  4YOE A;  1B70 B;  5E3P A;  3I4H X;  2MGZ B;  1LW0 A;  1WOO A;  2YWF A;  3FSY A;  3DGV A;  3OXG A;  3W8G A;  4NCG B;  5FDL A;  2KFN A;  3LJP A;  3G9C A;  4B08 A;  3TA2 A;  3DRY A;  3TAM B;  3DNC A;  2KYX A;  3DU6 A;  3AFG A;  3IRW P;  2R7S A;  2Q43 A;  1V5I B;  3WIU A;  3BGU A;  1DUR A;  2GAG C;  3FZB A;  1MSW D;  1N0V C;  3RBE A;  4MKV A;  1DLO A;  2GFF A;  2GC8 A;  5EWF A;  2C42 A;  2OPQ B;  2BM0 A;  2YNF B;  3H8Y A;  3HSJ A;  3MCO A;  1CJK B;  5L9X A;  1HNX J;  1U2R A;  1X4B A;  3Q8S B;  4FNI A;  2Z57 B;  3GIM A;  1PG5 B;  1HQU A;  3DLJ A;  4DR5 J;  5E7O B;  3CDA A;  4NLG A;  3O8W A;  2ZOF A;  3Q86 A;  3ENW A;  4EZ6 A;  3D1Q A;  5KFA A;  1R27 B;  4LT6 A;  4XPC A;  3TNV A;  2DO4 A;  4O4G A;  4P6Q A;  3UVJ B;  2MSS A;  4JI7 F;  4K4W A;  1LFW A;  4B9M A;  3BSO A;  2JNJ A;  3VGU A;  2JXI A;  2IRU A;  3EGW B;  4QZV B;  1RKI A;  1YK9 A;  2AZ3 A;  2H9Z A;  2NS1 B;  3FEY B;  4WWS A;  1ZZF A;  4NLX A;  2R42 A;  3C6T A;  3H4B A;  2ZBP A;  4JI2 J;  2EBE A;  3O5T B;  1RWW B;  3IN5 A;  1Q82 T;  4QR2 A;  3OFE A;  3G6Y A;  2JEI A;  3DXS X;  1N4L A;  1OPI A;  1YLX A;  2LP4 A;  2V8G A;  5G4D A;  4ELU A;  4KRW A;  4J9Q A;  1CUL A;  1JLE A;  1NDL A;  2OPQ A;  4A8Q A;  3ONQ A;  1FXR A;  4CT9 A;  3R3T A;  1LXN A;  1RWU A;  2BRK A;  3MD3 A;  3ZTP A;  4GVB B;  1S72 S;  1U02 A;  1SL0 A;  2GMH A;  5KOW A;  2VQE F;  3SV3 A;  5J2Q B;  1RHR B;  2K29 A;  4KFB A;  3WZ0 A;  3A8J A;  3DRS B;  3RTV A;  2OKQ A;  2MY8 A;  1R43 A;  1ZM9 A;  1Y3J A;  1BMQ B;  2DEJ A;  2DGT A;  2G2Z A;  2QL9 B;  2O01 C;  3A12 A;  5D4P A;  4X64 J;  3ITH A;  1N36 F;  1YBT A;  3BN7 A;  1AUD A;  1VQ7 S;  2B8Q A;  4ITS A;  1RTJ B;  2AHO B;  4KO0 B;  2J0S D;  4I68 A;  3IM8 A;  3JSM A;  2HHX A;  1RTH B;  3TW0 A;  1ARR A;  1NLK L;  2JC0 A;  4P2S A;  3C8Y A;  3CCR S;  3T5J A;  2AQ4 A;  2CG8 A;  2L41 A;  3BEG B;  4PG7 A;  2V2Q A;  2VBX A;  1BY9 A;  5C7P A;  4JI6 F;  1TK8 A;  1X5S A;  3N79 A;  2P8I A;  4M5D A;  3V5R A;  2NCK L;  4DV4 J;  2DHX A;  1FVQ A;  4NLR A;  3WX4 A;  5KFO A;  3M30 B;  3J80 U;  3IR5 B;  4PWD B;  2G0C A;  2H3E B;  3BS9 A;  2XYG B;  3M8P B;  4OJG A;  1H2U X;  4BWM A;  4YS2 A;  5IS2 A;  1S97 A;  1VRQ C;  2CPY A;  3NL0 A;  3Q2T C;  3LGH A;  1UVK A;  3GIJ A;  4NCG A;  4Y2C A;  4LBI A;  1Q8L A;  3CDW A;  3MMA B;  4DS5 A;  1TL5 A;  2HHH F;  2XC9 A;  2PII A;  5J2Q A;  2RAQ A;  2VBZ A;  3MPV A;  5K8M A;  3Q8U A;  3KHH A;  2FJX A;  4A8K A;  1NKE A;  2KOE A;  4L74 A;  4OYW A;  2CJQ A;  5ETS A;  4XK8 C;  2XO7 A;  2HVZ A;  4NMX A;  3VF0 B;  4NAS A;  5GAG U;  5HI7 A;  2ZM6 J;  3PX4 A;  1U6B A;  1RAC B;  1H3D A;  2XMT A;  1A6L A;  4V1A k;  1RTJ A;  3CJK B;  3PW5 A;  3HO1 A;  2DCU B;  5HBM B;  2DD8 S;  3OLB A;  1QSS A;  4DV6 F;  2BJE A;  4GO7 X;  2OPP B;  4ZVH A;  1X60 A;  1IKX B;  1MU2 B;  3EX7 B;  1B0T A;  4ME7 E;  1VDH A;  4H54 A;  2CG4 A;  1P1L A;  3QLH A;  2QL7 B;  1JLG A;  3N6L A;  5F8L A;  3QFW A;  4M8L A;  4TXS A;  1DFD A;  7FD1 A;  3TJ9 A;  1ZPV A;  2NUU G;  1D8Z A;  2XSF A;  1RAA B;  2VBY A;  1XR7 A;  4Q44 A;  1OSD A;  3N0V A;  1P9Q C;  2DEI A;  3H0P A;  1X5P A;  3IMQ J;  3M8P A;  4C0B A;  4X4P A;  4AQY J;  2IBK A;  1HYS A;  2XUL A;  4OYZ A;  4MKA A;  2YKN A;  3FRZ A;  2RRN A;  2KO1 A;  3FGV A;  1KLM B;  1HQ2 A;  3TVZ A;  4EO6 A;  4EMD A;  1FNM A;  4LVO P;  3J80 Y;  4GKJ J;  3FFI B;  2XMW A;  4EZ9 A;  2E1A A;  2ZVS A;  2VC0 A;  5J2P A;  2V67 A;  3MMC B;  3MM8 B;  1U1O A;  2Q79 A;  2ROG A;  3PFE A;  1V6H A;  4RX6 A;  5KFE A;  4X4O A;  1FVS A;  1NK7 A;  4PXB A;  3R5D A;  1OG7 A;  3ZZT A;  5JJB A;  4USI A;  5KFR A;  2MQP A;  4DX5 A;  3VGS A;  4ZP9 A;  5GME A;  2CZ4 A;  2QA4 G;  1XTZ A;  5U47 A;  1NRK A;  3OJU A;  4OZ3 A;  4LSL A;  3K5M A;  1NDC A;  1WI8 A;  2DR8 A;  1HWU A;  3CJ8 A;  1TMJ A;  1YBA A;  2OML A;  3PHE A;  1B28 A;  3KLE A;  5KFN A;  4Y65 A;  2FHK A;  1GT8 A;  3I6P A;  3OV7 A;  2M88 A;  4CO4 A;  1NO8 A;  4LIR A;  3DOK A;  5C25 A;  3W9I A;  2VC1 A;  5BJR A;  1HD1 A;  4KFB B;  1VK3 A;  4M94 A;  1B0P A;  1FRH A;  1IBL F;  1X7V A;  2YX1 A;  4LR8 A;  1Q95 G;  3PX6 A;  3UPF A;  1EX8 A;  2JLE A;  4AL5 A;  1QAY A;  1TVR B;  2G1H A;  4WZQ A;  2KT5 A;  2GIF A;  5DZ6 A;  1NKB A;  3BV8 A;  3L7P A;  4OZJ A;  1EJ7 L;  2XO6 A;  4ED0 A;  5J2N B;  2AF6 A;  4USK A;  3M1V A;  4DCP B;  2E5G A;  3PR5 B;  3VAI A;  4MK8 A;  5D3G B;  4DR1 F;  1EP4 B;  2L3M A;  6FDR A;  1RLC L;  5FJ4 A;  1MN7 A;  4ICL B;  4NE9 C;  3BQ0 A;  2J0Q D;  3IRX B;  4DJB A;  1RAG B;  2MQO A;  5BYS A;  3BSA A;  5LMU F;  5E2Q A;  1RHM B;  1IBK F;  1VQ9 S;  4Q8F A;  2HS3 A;  2MQQ A;  1XMQ J;  1VYA A;  3BDP A;  1PIE A;  5ETM A;  1FFS B;  2DGO A;  3W7B A;  2LKZ A;  2DNZ A;  2GV1 A;  3D66 A;  5BXI A;  3G6V A;  3CPW R;  4DF8 A;  1T9U A;  1SVD A;  3JSB A;  4OZ5 A;  2HGL A;  3V81 B;  5KG6 A;  1DAR A;  3WC0 A;  3BKF A;  2FLL A;  2RIL A;  3I32 A;  3W2W A;  1TKD A;  3LH2 S;  1PC5 A;  4MJW A;  4F04 B;  1TL7 B;  1WHW A;  2LEA A;  4ZHR B;  3NNH A;  3NGU A;  3PRB A;  4DCJ B;  4C4W A;  1FRI A;  1HBM A;  4OX7 A;  4A46 A;  1VQ6 S;  2QA4 S;  2VOO A;  3A3P B;  2E5J A;  2EFP A;  2YNH A;  1ROF A;  2VUG A;  2XSJ B;  3CMA S;  4OI6 A;  2H1O E;  4JP8 A;  3I55 S;  1U48 A;  3KKF A;  4C8N A;  2DNK A;  4RR5 A;  1FFG B;  2PO4 A;  3HHL C;  1X4F A;  4IG0 B;  2EPI A;  5IV4 A;  1G2E A;  4QPX A;  4ZP7 A;  4F4X A;  4NI2 B;  2HK2 A;  2K1O A;  1B64 A;  1IRQ A;  5CZV A;  2BE7 D;  2ZDP A;  3A3O B;  4UST A;  1KHW A;  4YB7 A;  2AZ1 A;  4BWJ A;  4ETX A;  4F67 A;  2YKN B;  4R8U B;  5HN0 A;  2C28 A;  4DSL A;  2OPR B;  2Y8Y A;  1NH8 A;  3D5M A;  2RUS A;  2OEK A;  3HSD A;  3GU0 A;  1LW0 B;  2X3G A;  2ZD1 A;  3RYL A;  4DSE A;  1K0T A;  4LMZ A;  3UI3 A;  3BQ1 A;  1TUG B;  4EYI B;  2YVS A;  1TAU A;  3MCS A;  2HIQ A;  4IQM A;  3D1O A;  2V68 A;  1TK0 A;  3OFF A;  2J9E A;  5LM7 E;  2QIF A;  1X4A A;  3N4W A;  4ELV A;  4K0K F;  1PJ7 A;  3KUH A;  4DQS A;  3DM2 B;  5LXY A;  1QTN B;  1VRT B;  2IJN A;  5KFY A;  4DFK A;  1U49 A;  4HEA 9;  1WI6 A;  1VC0 A;  1JLA B;  2HQI A;  1PO6 A;  4P71 A;  2DRB A;  2YTC A;  1YQH A;  3T9N A;  3OVS A;  3FJ2 A;  1GK8 A;  2KVQ E;  2W7A A;  4RJV A;  4CO5 A;  1IVZ A;  4BLG A;  2DGW A;  3GJS B;  3K8V A;  1FFW B;  4TY9 A;  2VA2 A;  3TZY A;  4JI1 J;  4PWU A;  2XLK A;  3HLU A;  1SV5 B;  2IPO B;  3G6E S;  4H4O B;  2J8A A;  1S76 D;  3J7Y U;  3AJ1 A;  3EIC A;  2ZBI A;  4Y3C A;  2MY7 A;  2H65 B;  2QV6 A;  1GXT A;  4BBY A;  3D6M B;  4DR2 F;  1VQ4 S;  1HIY A;  1TQL A;  2XNQ A;  3OFG A;  3OUY B;  4O3P A;  2J6T A;  5HJX A;  1HBN A;  1PC4 A;  1K44 A;  1KQG B;  1CJT A;  1IM6 A;  2FVC A;  2KVI A;  4QIG A;  2W8L A;  4USU A;  2YKQ A;  2ADB A;  4X62 F;  3IR7 B;  3K5P A;  1N52 B;  4ZVQ B;  2K6L A;  3LWL A;  2IC3 B;  4HAC A;  1VQ5 S;  1VHF A;  1UJ6 A;  4E98 A;  2A1B A;  3AAW B;  1QE1 B;  4DQQ A;  2DNG A;  3QFH A;  2GCF A;  1AA1 B;  4PXE A;  2FJV A;  4NZ7 A;  1WEY A;  1IKW A;  1HNW J;  1S99 A;  1DHM A;  4N8N A;  3FCH A;  1OY6 A;  1S6Q A;  5F9L A;  1X4G A;  1GMU A;  2HVE A;  5J1E A;  5AE1 A;  3GG0 A;  1QY7 A;  1S9F A;  2YNF A;  1HBM B;  1SJQ A;  3P96 A;  4EEY A;  4ZVE A;  3KK1 A;  9RUB A;  2WSC C;  4N7T A;  3IBW A;  4CLY A;  5B0B A;  2HYI B;  5HSP A;  5KT3 A;  2HQF A;  5HK4 A;  2U1A A;  1UVM A;  3HZE A;  3CCU S;  4ZVP B;  3W5X A;  3T5H A;  1YVF A;  3QJP A;  4UW2 A;  3PG9 A;  4U95 A;  1QUP A;  1FWP A;  3N5F A;  2IYI A;  4I7F B;  4KV8 B;  4WK1 A;  2IBO A;  3HKW A;  2KKE A;  4UQT A;  4WP8 A;  5FDL B;  4LF8 F;  2GZO A;  5IT9 Y;  3KLG A;  3AOC A;  1N36 J;  1MNT A;  4R25 A;  5FD1 A;  3J7Y I;  4RW6 B;  3PW2 A;  3A8E A;  2A2D A;  2IM3 A;  3FVY A;  3FT7 A;  3EDR B;  4FDF A;  4FBU A;  2IJR A;  2VZ9 A;  3QRR A;  3SSR A;  3VVU A;  2HQG A;  3E8O A;  4PG6 A;  3W1Y C;  5J1E B;  1AFI A;  5B0G A;  2VQF J;  4B3S J;  5KG4 A;  1SQE A;  3I0R B;  4OX6 A;  4OI0 A;  1H73 A;  3AB2 B;  1K73 T;  3CO0 P;  2OGU A;  1M1K T;  2QLJ B;  1NH7 A;  4IH5 A;  2GQ2 A;  3PNI A;  4MK7 A;  2DY1 A;  4R0J A;  1TMM A;  3QZ8 A;  3K57 A;  3RB6 A;  1ZH5 A;  2HND A;  3NS5 A;  2IMO A;  3M8Q A;  3AJD A;  2BR0 A;  3MM5 A;  4ID5 A;  5L1K A;  2WBR A;  2YX7 A;  4DR3 F;  1TKT A;  1KSP A;  2XNR A;  1HNX F;  1VC5 A;  4OZ0 A;  4B3T F;  4KKO B;  4ZVO B;  3RRH A;  4ZVS B;  4DMZ A;  4WIQ A;  1N56 A;  2DGX A;  4KGV B;  4CDI A;  1NK4 A;  4RW9 B;  1HNI B;  4A8F A;  2ZM6 F;  5F41 A;  4FN5 A;  4OYP A;  2FQQ B;  1KVK A;  1T03 A;  3GCW P;  4FYW B;  3FFI A;  2PE8 A;  5B0F A;  4C0O C;  3CCE S;  1A0O B;  3EGN A;  1JJH A;  3K5N A;  1YKW A;  2QFJ A;  1NSA A;  1T95 A;  1UP1 A;  3ILL A;  5IWA F;  4KGK A;  2IC3 A;  4X2B A;  1M1G A;  1T9V A;  2LA4 A;  4EGL A;  3TQ1 A;  1F6T A;  1QE1 A;  1RCO B;  1RT4 B;  4QWD A;  3EVW A;  1V3S A;  3ILI A;  1HKA A;  2DYA A;  4HHJ A;  2UU9 F;  4B3O A;  3NCR A;  3I96 A;  3AA8 A;  5CH7 B;  3MAA B;  4OZ1 A;  2C22 A;  3EXY A;  3H98 A;  1H6K X;  2YQ0 A;  3KK2 B;  1UEU A;  2R3V A;  5ETN A;  4TU9 A;  4PWW A;  2R7W A;  4ED8 A;  2F7V A;  1C1B A;  5M2R A;  2LXU A;  2B6A B;  2BA9 A;  3CJT A;  4LSN B;  4U6P A;  2W9B B;  2HPU A;  5J2M B;  3UR0 A;  2FHO B;  4RW8 B;  4EBC A;  4WTY A;  3HHD A;  2C2R A;  4B9V A;  2HVI A;  5HP1 B;  3KLI A;  3MR7 A;  4IKA A;  3RBD A;  1SKW A;  3PJ9 A;  1RU1 A;  1Q16 B;  2IDL A;  3BR9 A;  4DU7 A;  3T5K A;  3K0J A;  1KOH A;  1LXJ A;  3UFC X;  3OHA A;  2BJ7 A;  4X62 J;  1F5C A;  4YHH J;  2JFK A;  1W25 A;  3SQG A;  2WVE A;  1WG1 A;  4QIW D;  4IO9 Q;  1BQN B;  2J0W A;  1S1W B;  1XIQ A;  2H5J B;  3GFY A;  4OJ3 A;  3SIP B;  4C6A A;  2CWX A;  5IM0 A;  2VIC A;  2CQH A;  4B9T A;  1XNR F;  4LJM A;  1PYO B;  2X1G A;  2R2R A;  1YJN S;  4N77 A;  4ZA1 A;  5M2P A;  5DQG A;  1MN9 A;  2GO9 A;  1DRZ A;  3QIP A;  4NA1 A;  1N5Q A;  2H54 B;  3G8Q A;  3DDI A;  4FVC A;  3CJK A;  1NSP A;  1FA0 A;  1U7L A;  3T41 A;  2DHG A;  1IKY A;  2A2B A;  2B4V A;  3GSI A;  5F8I A;  1VCT A;  1RWN B;  3QQC D;  1SIW A;  2GW8 A;  2M52 A;  4MFB A;  3LP0 B;  3M8W A;  3QGP A;  4HDH A;  4F0K A;  3SYZ A;  3AB4 B;  2LQ5 A;  5KFM A;  4RNO A;  1ZET A;  3CD6 S;  1CG2 A;  2LCW A;  2H5E A;  1XC9 A;  1I3O B;  2RNE A;  2DK2 A;  4RNH A;  1Q1K A;  4USH A;  1IBK J;  3E3X A;  1XR5 A;  3MF5 A;  3FCW A;  4IG0 A;  1H74 A;  3ZFV A;  2MKS A;  2P6S A;  3HVW A;  4ZN1 A;  4Y6I A;  1J27 A;  1S9G B;  2FUG 9;  2RS2 A;  1KHV A;  1FJG F;  1KLM A;  2X51 A;  3M9O B;  3L95 X;  4DQR A;  3U1L A;  1N5Y A;  2IRX A;  4DXL A;  1FEE A;  1GEH A;  1S4E A;  1S1T B;  2J7K A;  5C24 B;  1N5T A;  1Y11 A;  2C3M A;  3NBP A;  4OHZ A;  2BJ3 A;  2LXF A;  4WU2 A;  5AJ3 F;  4HR2 A;  5LSR A;  1G6B A;  5IQQ A;  2BM1 A;  3TUI C;  2R9L A;  3FMB A;  2CZ9 A;  4Z7C A;  2PDA A;  4HI2 A;  4Z37 A;  2XMJ A;  2BA3 A;  4OHX A; 
#chains in the Genus database with same CATH homology
 4ME7 E;  2NZC A;  3H87 C;  2BJ7 A;  2WVD A;  2K6L A;  1BAZ A;  2WVE A;  2WVC A;  2CAX A;  3GXQ A;  2K1O A;  2FGC A;  1IRQ A;  1P94 A;  1B28 A;  3VEB A;  1U9P A;  1MYL A;  2KEL A;  3LGH A;  4D8J A;  2K29 A;  2K5J A;  1NLA A;  1ARQ A;  2CAJ A;  2HZA A;  3PHT A;  1MYK A;  3QOQ A;  1PAR A;  3BKF A;  2JXH A;  2BNZ A;  2CAD A;  3OD2 A;  2CA9 A;  2JXG A;  2HZV A;  1QTG A;  2AY0 A;  1MNT A;  4FXE A;  2BJ1 A;  3FMT A;  1EA4 A;  2JXI A;  3QSI A;  2BJ3 A;  2WVF A;  1BDV A;  2BJ9 A;  3BKT A;  1Q5V A;  1BDT A;  2F1F A;  2GPE A;  3FT7 A;  1Q5Y A;  1B01 A;  1ARR A;  2RBF A;  3VEA A;  2BSQ E;  2PC6 A;  2CPG A;  3VW4 A;  1X93 A;  2WVB A;  4HV0 A;  2H1O E;  2Y3Y A;  2BA3 A;  2K9I A;  2BJ8 A;  3BKU A;  2BNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...