2HZAA

Nickel-bound full-length escherichia coli nikr
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NikR-operator complex structure and the mechanism of repressor activation by metal ions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Nickel-responsive regulator
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2hzaA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2hzaA02
2H1OE 1NLAA 1Q5YA 2WVFA 2JXHA 2Y3YA 2K6LA 2BJ7A 3VW4A 1IRQA 2CAJA 1EA4A 2BA3A 1BDVA 1X93A 2CADA 2AY0A 1BDTA 2GPEA 3VEAA 1ARRA 3QSIA 2BJ9A 2BJ1A 2F1FA 1MYKA 2CA9A 2KELA 2JXGA 1BAZA 2WVEA 1B28A 2NZCA 1QTGA 4D8JA 1ARQA 3FT7A 2K5JA 3FMTA 2K29A 2K9IA 3BKUA 3BKFA 3LGHA 2WVCA 3QOQA 3GXQA 3BKTA 2K1OA 4HV0A 1MNTA 2CAXA 4FXEA 2BNZA 2PC6A 1MYLA 2BSQE 2HZVA 1P94A 1Q5VA 2WVBA 2CPGA 2HZAA 2WVDA 3OD2A 2FGCA 2BJ8A 2BJ3A 2RBFA 1B01A 1PARA 4ME7E 3H87C 2BNWA 1U9PA 3PHTA 3VEBA 2JXIA
chains in the Genus database with same CATH superfamily
1KEKA 4DBQA 1JNZB 4WXOA 3P5TL 4RU9A 2H9ZA 4OJ1A 4CCHA 3AJ1A 1EETB 4X4VA 1KS2A 1K9MT 2ABYA 5CYQA 3S1TA 1TUGB 3UWTA 2B8QA 4P7TA 1IWAA 5HLFA 1QAJA 3WX4A 4P6QA 1WI8A 2NUUG 4ED2A 4I67A 2CG8A 4Z2XA 4K4TA 2DGOA 5KG3A 4Q0BB 3QZ7A 3NO7A 1G4CA 2X1AA 2FZCB 2W9BA 3JB9k 3HFVA 4QIVA 4M5GA 4JI4F 4F50A 2O5DA 1W2BR 1N33J 1S4FA 4IFYA 3CCJS 2HQFA 1NEEA 4JI6J 2HFSA 4JI6F 3EVWA 1NKCA 1HNVA 2KT2A 3OR1B 2IAJB 3Q8VA 2KVIA 5KFJA 1KR4A 2BRLA 4K5SA 3D1OA 4USIA 3TJ9A 4LBHA 2GO8A 4PQAA 5EWGA 2XYGB 2XQCA 3KK2B 4W92B 4FXDA 1YK9A 4WYLA 1HD1A 4B17A 2IBOA 1W26A 5M2PA 1N4LA 1RAFB 2LLZA 3CDAA 3G8QA 5HJXA 1RAIB 4QZVB 1J5OA 2M52A 2XULA 4KC5A 4ANDA 1PILA 5AJ3J 3I4PA 2YPZA 3R27A 3DRSA 2ASLA 2K8GA 4ELUA 1TL3B 2I8EA 3TUIC 2G1DA 8RUCA 4OI4A 4U95A 5KFNA 5CD4A 3MMAA 5HANA 4EBCA 1FHTA 2ZD1A 3W3SA 2C2ZB 3OXFA 3ZZTA 3T5JA 3CDEA 5IT4A 2H3EB 4B08A 1CJUA 1HQUB 1R8AA 3PYGA 2NREA 3W60A 2ZUAA 3MAQA 2QYGA 3I0RB 4X4TA 1B64A 3CD7A 3UD4P 1XNQJ 3I32A 1S1WA 2RDDA 2ZBCA 3TJ8A 3POTA 5K8PA 3KMSA 3VAMA 2FC8A 4PQUA 2LU2A 2LFVA 1HW9A 4L76A 4OI6A 3D9BA 5DGBA 1HHTP 4U8VA 2CQ2A 4J37A 3MCSA 3HVTB 3GJRB 1FXRA 3LJPA 1VMBA 4G65A 1WKLA 2QLBB 3HHLA 1YX2A 1BWVA 1TL4A 2VB6A 4X4NA 5LT5A 3PIOQ 2CQGA 2VF3A 3DDIA 3OTOF 2OKQA 2KFNA 3KLIA 5BR8J 1PARA 5J2MA 3M32A 4I2QB 1TVRA 2G13A 4PWUA 1K1SA 3R8YA 5A8KB 2CNOB 3T5LA 2GMJA 3SZ2A 3C16B 1X4HA 2XI3A 3FSYA 2R8IA 4C8YA 3TARA 1KD1T 4NEYA 1C4CA 2QA2A 2HURA 3TUJC 2DNOA 1JJ4A 3NNCA 3OTDA 2VFUA 1Y5LB 1X9MA 1H38A 1WC3A 1RT1B 3O2IA 4ZP9A 1QTGA 2VDHA 3ZTPA 3MR7A 5GAHI 4DV6J 1QUVA 4DR1F 3UN2A 3UQSA 2N3OA 1VRQC 2PDAA 3J7Z5 4R5PA 4ILMA 3Q22A 3MM7B 4GVBB 5HBMB 2E66A 3OFFA 3DM2B 4UOHA 4ETXA 5J2PA 2CPYA 3MHYA 1IJFB 3N9UC 4H4MA 4RW6B 4USWA 5B09A 3B82A 4K8RA 2O67A 2V68A 3R5DA 3RRKA 1H98A 5HVGA 5F8JA 1S9GA 1ZZFA 4X65J 3FSIA 4BWMA 4N5SA 2GX8A 4NCGB 2RRAA 2VG7B 1UWAA 4NXMJ 3W8GA 4I68A 5D15A 5J1EA 3CIZA 2MXYA 2CJ9A 3MMBA 4DL5A 1GEHA 3Q0AA 5E7OB 1LWFA 4HTJA 2CA9A 1N8RT 2WK4A 3L4BC 4RZRA 3VVUA 3CF5Q 2FTRA 2XNQA 7FD1A 3SCIE 1H74A 3PJWA 4AL5A 3W64A 3HHLB 4L3NA 2DNGA 2DNNA 5E3AA 3D4JA 4NI2B 1I51B 3J80Y 4DV6F 1X9SA 2YTCA 3D67A 3I0SA 3VGUA 1M1KT 3P6YC 4EK2A 2J5AA 2H48B 4B3TJ 1FERA 4QIFA 1MW7A 4ZPWR 1DLOB 2AZ3A 2CIMA 3DMJB 1S1XA 4BCAA 4EZ9A 3QGHA 5DQGA 1U1NA 4F0KA 4IRKA 2YBVA 2AP6A 3MM6A 4LVOP 4WBFA 3GIJA 2IC3A 2UXBF 2IVYA 2GQ2A 3KNGA 4KO0B 4LRBA 5JMNA 1IJEB 4IRCA 3Q89A 4JI4J 1U6BA 4J9UE 3AA9A 5LJ5Y 1UVIA 1CJTA 2HK2A 3OHBA 5EUHA 3V6HA 3RAQA 1UEVA 2F40A 2V8HA 3MPVA 2JOQA 3PEJA 1BAZA 3GJQB 3GFYA 2CPIA 4ED8A 2F65A 3U1MA 4FN5A 4X64J 1N0UA 1XTZA 1ZM4A 3B78A 4DV3F 2XS5A 1PG5B 1Y3JA 4FYXB 4WP9A 3THVA 2CFXA 4E0DA 4QQBA 2PE8A 2JWNA 4Q45A 1RAAB 2RSQA 2XG8A 3IMQJ 3OXGA 5HP1B 1S0OA 3R7SB 2F4VJ 2YNIA 4OI2A 4XDCA 5AJ3F 4ME7E 4DWIA 1FEHA 1GFWB 2OMLA 3PFEA 5T7LB 2LECA 1YTYA 3QQCD 2HGMA 3AOAA 4DHVA 4IFVB 2QGFB 2E1RA 2B9XA 5L46A 2BEFA 3PCOB 1CS4B 4J7CA 2X3DA 1X93A 1WSVA 2P9GA 5ITHA 4TLQA 3IO1A 2D3OR 4LT6A 1EIYB 1SH0A 4LREA 2C2NA 3SMZA 1M1HA 2DCUB 2RHSB 4YB6A 1C4AA 2JC1A 4Y2KA 1QSYA 4XAKA 2BACA 2VDIA 3LOUA 4PCQA 2J0QD 3DC2A 2B7BB 4X64F 3TQ1A 5GAHU 1UVNA 3D28A 3SEOA 2H1YA 2UUTA 1X60A 2KG0A 2NXJA 3GR1A 2U2FA 3DLGB 4PUOA 2Q1LA 4DL3A 1NBEB 1JXLA 4QYZK 4PZVA 5CHCB 5F9NA 5KFHA 4Q8EA 4QWDA 1EETA 4NYZA 4MJWA 2IFXA 2MDAA 3EX7B 3HT3A 4FKYA 1H7WA 3BV8A 1B0TA 4EO6A 3IWLA 4KV8B 2JEFA 1LQ9A 2HQDA 5ETKA 5H9FJ 2AU0A 4ZVEA 3T1HF 4MFBB 3ENAA 4H4OA 3FCVA 3IAM9 4M1KA 3ZZRA 3ZXWA 1K44A 4C11A 3LH2S 3QYYA 4WTOB 1VQLS 4B3SJ 4I6AA 4FF3A 4X4UA 2ZE2B 3L9ZA 3D1QA 5C5JA 2Q79A 1HD0A 2W9CB 3LO3A 4WE1B 3K0JA 1S97A 3NGUA 3KK3A 1IBCB 5G4DA 5K14B 2RF2A 1SKSA 5CH7B 1S1UA 5KFBA 4PXEA 2N4CA 2XEXA 1WOOA 1UFLA 2PGCA 2V8VA 3GJSB 1DAXA 3OLAA 3NGRA 1IBMJ 2B4PA 3ZC4A 3EPGA 5CZXA 2DR9A 4FF1A 4LF9F 3KMQA 1CS4A 2YKOA 4GVLA 2NR0A 4U6PA 1U2FA 2VPXB 4OYIA 2CAJA 4G1IA 4URGA 1S6PA 2DGQA 3LA0A 2UV8G 4LRCA 4OZ3A 1L3VA 4JI7F 4ZVSB 5L39A 1FWKA 1UETA 4ZDNA 1YBUA 4CIOA 4A8YA 2R7XA 2MY8A 3RRGA 5ETQA 3UCUP 2A3JA 2RQMA 3EM1A 5ETPA 1HWJA 2B5JB 1O8BA 2G0IA 3A3PB 1IKYA 4DV1F 3BR9A 2IRYA 4QOTA 1OQ6A 1U09A 4FS1A 2WB1D 1XQIA 2ERRA 4YOEA 2MQNA 1NCLA 2ZWPA 3ONQA 4OHYA 4QW9A 1WDTA 4DU7A 3NGTA 1VJWA 2AIRB 1R27B 1EZZB 2BM1A 1FNMA 1MMNA 1MMLA 1FDAA 2XI2A 4NMLA 2YNHB 2YWHA 4PG5A 3AY0A 2JXIA 5KG1A 2FVPA 1Q16B 1WOSA 3MM9B 4DR7F 3D6MB 3HSZA 1UEKA 4NLTA 1FD8A 1PC4A 1X7VA 2A2CA 2DKOB 3QRRA 1RKJA 1SC6A 4LF6J 4DV1J 4MKAA 1S1XB 4U9RA 3T19A 5B08A 1OY6A 3AODA 3EVMA 3S7RA 3SXLA 4KR0B 4FBUA 5K5MA 3Q2TC 2YQ1A 1RWMB 2GA7A 3RB6A 2IYIA 1D8YA 1HWKA 2UU9J 4OYXA 2JEGA 4DSKA 4DV0J 1YJRA 1BD6A 1TL1B 1T9UA 5F8IA 4JI2J 2HHUA 1P1TA 1R6YA 2QFIA 2HEKA 2HNZB 2WVDA 2DHAA 3DYAA 3HJVA 4F4ZA 5ETOA 4UF4A 3DRXA 2EFPA 1I5OB 3E01A 1RHQB 4X4QA 2E1MC 1EKSA 4XK8C 4GC6A 2L9WA 4UY85 3NNEA 4XPEA 3H90A 3HM9A 4O4GA 3J81Y 4M8LA 4OV6A 4ZS6A 2GQQA 4JV5J 4RUBA 4FYDA 1QAIA 3UDLA 2M9KA 1HMVB 5KFRA 3HVRA 2BJDA 1HQEB 4ZJQA 3UN5A 1FESA 1RTHB 2XYPB 1S9GB 4OJ3A 3SQOP 2ATCB 2JJ4D 3GFZA 2Z4PA 4RW6A 2RUSA 5A6PA 4JI0J 4OHVA 2X1BA 2YKNA 4CTAA 5LSOA 3ENQA 4RX6A 1E6VA 3D66A 5J2PB 4TU7A 4B9UA 2XNRA 3FBEA 1BQXA 1XMQJ 4RW7A 5D0RA 4X4RA 3RB3A 2OPRA 1R8BA 2IY5B 2DO4A 2G1HA 3A8IA 2HWIA 2OGUA 1DQAA 1WUUA 2C3MA 3TA0A 3FDSA 2IJNA 8ATCB 5F8LA 1TK5A 1TKZA 3BGRA 3NNHA 3SFGA 4F4WA 2GIFA 3ITHB 3Q23A 2R2RA 1XBWA 5ETLA 1WEXA 3AQPA 3F0NA 4OI1A 2GVDB 2KOEA 5L9XA 1SCJB 3ZZOA 1X4DA 1ZPWX 5IWAF 3C16A 4DJBA 2CPFA 1U1LA 5C2GA 4OHZA 4J9NA 1CULA 3KLFA 3ZZZA 2JXGA 3MI7X 3PM9A 4NLWA 5FLXY 3MR6A 3IR6B 3NMRA 2GNKA 2OEMA 3CJRA 1QTMA 1FNOA 2UXDJ 4DX8H 2GZOA 3KLGB 4ILRA 5F8MA 3MR2A 1FX4A 1M5PC 2IM1A 2YY3A 1HARA 2DRDA 3EUNA 1YJ9S 2DH8A 3IBWA 3N28A 5E41A 1ELOA 2AEMA 3AH6A 4P10A 2DRAA 2CJAA 3GG1A 1NNDA 4DR5J 2QZ8A 3KLHA 3M4XA 2HNYA 3CCVS 1AXQA 2E5IA 4PXDA 3V5RA 3V4MA 2HVDA 3TAPA 1OG7A 3LANA 2MPUA 4DR1J 1B0PA 4NA3A 1F2GA 1P9QC 1U02A 4KSEB 3Q2SC 1CJUB 1HQUA 3I9V9 5KFEA 2HFVA 3FCWA 3NS6A 3EE3A 4KFBA 2DNKA 2QMUB 1ARQA 3DLGA 4PUOB 1N5VA 2KHDA 1ZM2A 3RGIA 3HX9A 3MD1A 4CNYA 3KUGA 2BE7D 4QWEA 1OQ3A 4K4YA 2X3GA 1XJWB 4N8OA 1HNZJ 1OYEA 3ILLA 1TL7B 2BX6A 1YWXA 2D74B 2GHPA 5J2NA 1NJXA 2DRBA 3B8HA 1K0VA 3TA1A 2H51B 4B3MJ 2E5JA 2X1GA 3BR8A 2JEJA 4F4KA 1TFWA 5DZ6A 2QL9B 2CQ4A 1FEEA 2DNLA 2MKKA 2J8SA 2W25A 1JLCA 3GTYX 3MEGB 2CG4A 2W2NP 2IVFB 2MKYA 2OH2A 4X62F 4A8SA 2XMJA 4DV4J 3C8YA 3KK2A 3T3FA 2L9NA 2DY9A 4NMXA 1FKPA 3R97A 3ET6B 4KAIA 5C42B 4PYDA 2E7WA 3VEAA 3CCLS 2VICA 4ECVA 2A18A 2GHVC 4CH0S 4B3TF 3EXYA 1IR1A 5F0WA 1K47A 4I0WA 2HZCA 2MJNA 3LALA 5CYJA 3T9NA 2XS7A 1KN6A 4ED0A 2NUHA 3TZWA 1JMTA 2VASA 1U1KA 2OPSA 3D6FB 1F9HA 5D4OA 3MTKA 5AE2A 4O3QA 4LVNP 3BBFA 1XMBA 1RWUA 1ZBTA 2QSWA 1N36J 3OTCA 2XLJA 3AFGA 4DV0F 3UCGA 4NPOA 4NCAA 4UY8T 2BE9B 4C0OC 1FE4A 3T1AA 1P8GA 3UW1A 2XHCA 1YJTA 4I1TA 1QE1B 2RNEA 1VBXA 1VC5A 2CJKA 2DR8A 3KDNA 3LWMA 2JL9A 1RWXB 2C2KB 2JZ5A 2FJDB 4KO0A 1BWEA 3TZXA 3BDEA 2IC3B 5KFTA 1OMSA 3ISND 4NRTA 1U0HB 4M5NA 3GONA 2IHR1 3FQLA 1F3VA 2ZZTA 3EZUA 3JSYA 4RBUA 5HAOA 2XM3A 4UW2A 3BM7A 2B9WA 4WJBA 3C2PA 3A13A 3AJ2A 4AYBD 4Y65A 1VQOS 4HYKA 4B9VA 2HFOA 3KDOA 1X0FA 1P6TA 3FBFA 1NJWA 4J5OA 3OL7A 5L1IA 4EMDA 2R7RA 5GADU 4O3SA 1WTFA 1BE4A 3DOMA 5DDQC 4IG0B 4HACA 2EW9A 1FRIA 2Y8YA 1SXLA 2J76E 3M8PB 1BMQB 4PABA 1LWFB 1MROB 5DO2A 4FBTA 3J7AN 4TU8A 4HT7A 1BQMB 4EGLA 1PAEX 1X4BA 2M5YA 1VYAA 2ZDPA 4KKOA 3EGZA 1U45A 2YH0A 3CXCR 5ETVA 2CJYB 3ZTQA 4F3OA 2PEBA 1GX5A 2R3VA 3C14B 1HBOA 4DMZA 1PBAA 5DGAA 1NK7A 4DV7F 4W90B 1HFEL 2DY1A 1Q8IA 3M2VA 2YWWA 3VGSA 4ZMMA 3CVKA 3EMTA 3FEZA 4H4MB 7AT1B 1FWLA 3C6TB 5LMUJ 1H2TZ 3G4SS 5B0GA 1NHKL 4GVBA 4LF4J 1UVJA 3QWUA 1Q8KA 2AT1B 5F3ZA 1E6YB 2WSCC 3BB5A 1HNXJ 1GX6A 2RRNA 1SB6A 5KFLA 3OSNA 1REVB 3LP0A 2IA6A 2KFZA 1CPZA 2AJ2A 4DUZF 4A8KA 3CCZA 1HBOB 1LWXA 3CJQA 4LRDA 4LRAA 3J7YI 4KPCA 2HHSA 2DGXA 4MIBA 3L95X 4OZ0A 1H3DA 4WK1A 4P2FA 2DO0A 1HQ2A 4ZPVR 2HW3A 4WU2A 2OLWA 3MMCA 1GMUA 3CJTA 2NLWA 4B3RF 4A8XA 2R42A 1IKWA 1KVIA 3A8KA 4H4KC 3JSMB 2UUCJ 1AZSA 1YQHA 1Y7PA 3WDOA 1XNRJ 1WKKA 1WDDA 2DGVA 3Q8UA 4ANCA 3R2CJ 1F0XA 2OMOA 5IC6B 4IG3B 3NRBA 1RT7A 3T1HJ 2DXDA 2BSQE 2V4JB 2Z0GA 3IG1A 5ADZA 1IXKA 5DG8A 2HIQA 4B3SF 2VODA 1TKTA 1SBRA 1WF0A 3LP2A 2HLTA 1T9XA 4ZCIA 5D0GA 5IC4B 3BSNA 2IDLA 5KG7A 4O44B 2RMLA 3CO0P 5KFDA 1DARA 3OUYB 3QGIA 1QUPA 1Q1KA 2GJ2A 2Z58B 3W5XA 4DN0A 1U6ZA 4WP3A 3QATA 4F04B 3OSPA 1ZH5A 4I64A 2G9OA 4DV2F 4OZ2A 3UNYA 1BDVA 3CJKA 4CDIA 4K4XA 3EJMA 3K8WA 2F8MA 3NGDA 1SJ3P 1NHVA 2V63A 1R0CB 4WTYA 5IS2A 4WK3A 2MYFA 2HHTA 1DTTA 5B0CA 3TVYA 3TA2A 1C0TA 2ZWOA 5HK4A 4UUWA 2VBYA 3M2UB 2N3LA 3BKUA 2E1CA 4OX9J 4MKVA 3NS5A 5ETRA 3QJLA 3I6PA 2J7UA 2P5VA 4NLPA 5F8GA 4CO2A 1X0PA 2WVBA 2CPGA 2HZAA 3MXHP 3JXOA 5A2QU 1VHIA 1L5UA 4BC7A 1NB2A 3CPWR 4HI1A 4LSZB 4UZCA 2E5LF 5JJBA 3Q8SB 4I7FA 2MZTA 4TVAB 5A0YA 3TANA 1SJFA 1VQSA 1XIQA 3WZ0A 3V81B 4HDGA 3BDPA 4MH8A 2QYCA 2RUGA 4HHHA 1URNA 2B9YA 4J9PA 3UO0A 4F4YA 1WHVA 2Q6BA 2GW8A 5A8WB 4LF7F 4CO1A 3H5UA 2L41A 1U1PA 3HPOA 2JVRA 2W9BB 3R3TA 1TL7A 2V2ZA 1FK9B 4DOZA 3IRWP 2YX4A 1C1CB 1MNTA 2C2OB 2Z8QA 4RW8A 5E2QA 4C3KA 4LF8F 2UXCF 3IR7A 5GAGU 3KOAA 1Q5VA 2CWXA 2R2TA 3I31A 3UNGC 3TI0A 3PZPA 4DL2A 2D41A 2FVCA 1EP4A 5KFQA 3I56S 2BW7A 1KQGB 2DISA 2OP5A 3G6XA 1X4FA 4AAIA 1XEZA 1ZPVA 2NCKL 4CLPA 4YB1P 1PIEA 4ED6A 4U7UD 3AB2B 2CWKA 1KQKA 3OL8A 3GYXB 3UE2A 4FVCA 3SCLE 2CNNB 2BYCA 3HMJG 2MJUA 4FNHA 1VRTA 2QRRA 1Y4ZB 3HZGA 3N5FA 2XWXA 4J9LA 2WTFA 2BE2B 2OPQB 3AXMA 2F9DA 1S0NA 2EVZA 4V1Ak 4Q7AA 4YEAA 4NYOA 4D8JA 3F44A 3SFUA 3I5BA 2HVEA 2P9EA 2K5JA 2ZH5A 4FF2A 1KTQA 2UUAF 5B0EA 2JLEA 2CVEA 4GKKJ 2J8AA 2UUBJ 3F56A 4ZOSA 1DY3A 3R9LA 3H5YA 1TKXB 4K5RA 3TAMB 4NCBA 2VOOA 1S5ZA 3NMAA 2VBWA 4OV1A 4ZVPB 3OD2A 2HHPA 4KGZB 2WONB 4Y34A 1M1GA 2R7TA 1J2VA 1R31A 2WHOA 1DTQB 4A8WA 1FRJA 1HA1A 1RTJA 4G1QB 2AGPA 4DR3F 1HNWJ 3FC9A 3R5AA 2AYGA 1NLAA 1PO6A 1A9NB 2CZ4A 1XN9A 2RDJA 4EYIB 1IUJA 2KRBA 2EG2A 2GVDA 3IR5B 4QIEA 3TO8A 2XO6A 4OYAA 5BXIA 4LF6F 2UUAJ 4CLLA 3E3XA 1SIWB 4M5HA 3K58A 4DCJB 2UXBJ 1VGYA 4NLVA 5CQGA 4ZVHA 2XSJA 3VAJA 4FZVA 2ADLA 1FTRA 1XERA 3LP1B 5MAOA 1ZYQA 4B9SA 1CJKB 2BXJA 1RT5B 3FUYA 4RNFA 5C2CA 5C7PA 5GMKa 3OVAA 3RAMA 1HYSA 3MMJA 4USTA 4D3GA 2MZ1A 2XZDB 2DGWA 1RTHA 2OEJA 4DLGA 3MEDB 2O3DA 2WOMB 3DU6A 4HH0A 1K73T 3ZNJ1 3M8ZA 4O3OA 5GADI 2G4BA 4Y00A 2AF6A 1MSWD 3B6BA 1D9DA 4HI2A 2R7VA 4DFKA 1TKDA 2XY6A 1RHKB 1JKHA 2PT0A 2CQCA 2E44A 2RILA 2BV3A 3RTVA 2X51A 3JAMY 4I69A 3OFEA 4TY9A 2O66A 1J5EF 1DRZA 1D0EA 2B4VA 3UPFA 3MEDA 2HIYA 2OEKA 4ILLA 2CQBA 2HWTA 2VUGA 3MPUB 4J9QA 4J9MA 4ETZA 1UMJA 1R7IA 3DYAB 2AJQA 4C97A 2W4DA 1APSA 3KHHA 2XLKA 4JI3F 4RU2A 4X65F 2AZ1A 4OLOA 2MEWA 3ZTRA 3W62A 1CVJA 4ZHRB 3QBCA 4DFMA 3S8SA 3CJ0A 3PO5A 2BOPA 1JJHA 1JLEA 1FJGJ 2BMBA 2FGOA 4R8UB 2K2PA 3NGSA 3R6LB 2LQBA 4BWJA 4RW9A 2RHQB 4IDKB 4YY3J 3FBBA 3V6KA 3NS7B 1RT4B 1LV5A 1VQNS 3PV8A 5H9FK 1X4AA 1CBKA 1Y10A 4J9OA 2R2UA 1U8WA 3K5OA 2GVZA 2WB4A 2GS8A 3H2UB 3KG4A 3MM5A 1RTIA 4ZPCA 4DPWA 1ZTTA 3AD7C 3PVXA 4DF8A 2V6AA 1RTZA 1KRPA 3OW2R 4DV4F 2LDIA 1NMEB 2LU1A 2KO1A 4OYMA 2AJFE 4L72B 5ETTA 4AUKA 4F26A 4F0MA 2DH9A 5B0BA 2V69A 1HYSB 3BEGB 3EDRB 2MQQA 4FF4A 1RKIA 3IN5A 3W7BA 4I6YA 2HVIA 1IKYB 2ZNZA 5IT0A 3VAFA 2B5JA 2ZVIA 5E3PA 2DK2A 4DCPB 2FD2A 4ID8A 1DBDA 4IQMA 2QLXA 2LEBA 2RAQA 1NK5A 1JLGB 1VK8A 1UWBA 2XMVA 1N54B 3D0IE 3QFWA 3QNWB 1WJ9A 1PCAA 4L74A 4YB7A 3CJ5A 3UI3A 5IT9U 3NP5A 1H7XA 1NO8A 2D7SA 5LSLA 4IH6A 1S6QA 1EP4B 2WVEA 2NYIA 4XDDA 1HBMA 4I2PB 3HJFA 3G2XA 2HGNA 2EK6A 2ROPA 3H5SA 4P73A 4LQ9A 4TNOA 2KM8C 3JYTB 2DT9A 3OTEA 2BOAA 1RTDB 5D3GA 1YJNS 5F8NA 2LMIA 4NLUA 4X66J 3UVJA 2EC0A 1FJCA 1KHVA 2YWFA 3RJMB 2PSZA 1VC0A 5KFCA 2AJ0A 1VQ4S 1QY7A 2OIHA 2CUYA 5E5NA 2DCLA 5I3QA 3BJYA 1RP5A 1WHXA 3BQ0A 1F2HA 2ZE2A 3N4WA 2AGOA 3T9ZA 2HSEB 2YWKA 5KG4A 2BE2A 3PR5B 2L3MA 3PXGa 2KTQA 4MFBA 4DPYA 2QMXA 2YWGA 4DV3J 4M5IA 1X5SA 1PJ5A 3C6UB 2V8GA 4K59A 4I6WA 5KT3A 1L3UA 1HW8A 3KJNB 1JXVA 2ILYA 2C42A 2AY0A 1V3SA 2BANA 2BVZA 2DNPA 3CIMA 5HATA 3KLEA 2F1FA 4KGXB 2UVVA 2ZBQA 4KHPF 1LW2A 2Q43A 3ISZA 1D9FA 4LF5J 2HRTA 1N6QA 1C0UB 4LQ3A 1RZMA 2HHXA 1SH2A 3CCRS 3AXKA 3BSOA 2UV8A 3BKFA 5J2QA 1FFGB 1ICEB 2FYXA 4FPRA 1WEYA 2HNDB 2HG4A 4OZJA 4LRVA 4TYAA 4DG1A 3PKYA 3HKZD 3KYLA 2AJ1A 2KXFA 1OJ4A 2K1RB 2QO3A 4GO7X 4LFAJ 3CDUA 2VFRA 4X84A 2NS1B 3AHPA 2KHCA 5CYMB 5EWFA 4RKUC 1S10A 3MFHA 1M90T 2EK1A 4GKJJ 3H4BA 1R3NA 4RNHA 3CJKB 2P2CB 4FYVB 2OFHX 5DG9A 2W7PA 2FHKA 3QGGA 1YBTA 3SV3A 5A0YB 1U4BA 2KRRA 4IFVA 4USJC 4OZNA 4UOFA 3T1YJ 2AN7A 1Y3KA 3LTOA 4LSNB 3WX8A 2IMWP 1LK5A 1CG2A 2IYGA 3D6HB 3JQKA 1MYKA 1B28A 1ULRA 5MLCV 2IM3A 3V6DA 1D1UA 4OI0A 2BKNA 3JTOA 3SCJE 1I1GA 3UR3C 5HN0A 2RS2A 5CABA 3HP6A 1Z4UA 2KL8A 1VC6A 4NXMF 2W7OA 3JQJA 2WVCA 3HLUA 1NK4A 3OVBA 1RT7B 5K8NA 2Z2MA 1IQZA 1NPKA 2MKCA 5KTQA 2AKWB 1YIJS 2DPJA 2ADCA 1Q8LA 2KT3A 5D4NA 2ZH2A 3EXCX 1T02A 4M5LA 2E1AA 2GIRA 4CLFA 3PACA 4PYAA 1VK3A 3KUHA 2HQCA 1QVFR 2MQMA 2PI4A 1U24A 3MAAA 5KFAA 3IS9A 1WG5A 4CO0A 2NPIA 2FJXA 3IC1A 2KXHA 3CJSA 4ZLLA 3DDKA 2HWHA 3V81A 3MECA 3L7PA 3DNCA 1WNEA 3HHNB 4DR6F 5KFVA 1NSKL 2CADA 3GFHA 1UZHA 1RLCL 1TP7A 3MM6B 4OHWA 1LWCA 2CPEA 2V67A 3DRYA 2I38A 2RQKA 4HDHA 4ZVQB 4CT8A 3DMJA 4E98A 1DLOA 1WTBA 5GMEA 3S6EA 3TYTA 2LKZA 1REVA 3D3BJ 4DSEA 2ZZMA 1TV6B 4ZIWA 2VA3A 5SZTA 1KFDA 1R89A 1REGX 2KYZA 3FSXA 2KFYA 1X9WA 4V19J 1UVKA 2V0NA 4CI0B 5B0DA 3C15A 4RNNA 3QIPA 2VZ9A 2H65B 1YLXA 2EKNA 2LQ9A 3M8QA 4MIWA 5BYQA 4DU8A 1RWKB 4ECQA 4WCEQ 2PI5A 3OTOJ 1Q86T 2BJ8A 2QFJA 3V6JA 3R1LA 1AZSB 1V3RA 3CE8A 5BJRA 4RR5A 2HRUA 2MZRA 3C14A 2DVIA 4HTIA 2Y1IA 5AE1A 3FJ2A 4QW8A 3DN9A 4LRFA 1IBLJ 4DR2J 2A10A 1XK8A 4DCOB 2YNFB 4O0NA 2MLZA 3WC2A 3NNAA 3GIMA 1ARRA 4ZIVA 1BLUA 3NAHA 2J0XA 4LR8A 2RT3A 2LA4A 4TY8B 3U27A 3GIIA 1CJVB 3GV5B 3CMAS 1E6YA 4PPZA 3PRDA 2BRKA 2DHXA 3SSSA 3RR8A 2RS8A 4ENOA 4DL0C 1HWUA 3I82A 4DPTA 4MK9A 2DHSA 3WIVA 1KONA 4R5PB 5C25B 4LSLB 2D1CA 4WF9Q 3QJJA 4GKKF 2FGCA 2RDIA 3BYRA 1JK9B 3QPIA 2RBFA 1RHUB 2HHHF 3BZQA 3J81U 1LWCB 2C2RA 1M5HA 5KFPA 1RB0A 4QU6A 2C28A 3BBBA 1SL0A 1JB0C 4JI1J 1QTNB 3JSBA 4A8MP 3MECB 3WC0A 3G86A 5HO4A 3G71S 4J9KA 2Y9HA 5CZVA 2ZH7A 4OL8A 4JYAJ 3O1LA 1BQMA 2R8JA 2YH1A 4N41A 1GQEA 4DR2F 2CJXB 1N0VC 1VBKA 4LBIA 4CLWA 4XPCA 2QLFB 4IQXA 3LQVA 3MEKA 2ZFHA 3OPKA 2N7YA 4PG4A 1PJ7A 1U2RA 1UW4A 3C3LA 3X3UA 4TLRA 3R7BB 3TNVA 1S9EA 2I1RA 4XO0A 2V4RA 1ZTWA 1YRXA 1S79A 3AA8A 3MWBA 3CJ2A 4J9RA 1WORA 3RBZA 5L38A 1TZ0A 3VHQA 2FLOA 4QIGA 1KP6A 2DNMA 2W2MP 1VBZA 2V8PA 1JWWA 2D3ZA 3ULHA 1RBLA 1SKUB 1QD1A 2WAQD 3O44A 5HL7Q 5JXSA 2PMWA 3NOGA 4QIWD 2W8KA 3QLHB 3VAHA 1HHSA 2IJFA 2XMWA 4ECYA 3IM8A 5IM0A 4Y0FA 3KUEA 3JAMU 3NWGA 1XMQF 2V34A 5K20B 1G3OA 3QSIA 3ETOA 3LGNA 4JYAF 2HPUA 4WWSA 4YR0A 2F9JA 4USHA 3I9ZA 3KG1A 3V2UC 4IYQA 4CRJA 3W61A 2NSBA 5J2NB 1PYOB 4F8RA 1AUSL 3DLKB 2EFOA 3DRRA 4KHMA 3KTQA 3TEGA 5IQ6A 2EFNA 3DRPB 4RNOA 1LXJA 4E2FB 3RYLA 1C0UA 3G8TA 1N6QB 2UU9F 4TKTA 2KJVA 4UQTA 1AFIA 4OX8A 2HFNA 3TVKA 4Y2CA 5DDPC 5KFMA 3MOZA 1BGXT 2B4OA 1UVLA 3D1HA 2CYYA 3G6ES 2C2DA 1HR0F 3EYZA 3BBCA 4Q5VA 3PRVA 3GYNA 2OI2A 1U49A 3HO1A 4Y3CA 4OJGA 1A7GE 1EQMA 2WBRA 1U0SA 2GHWA 4AQYF 3W2VA 4O3RA 1GXTA 1VS3A 3GWCA 3UN3A 2AGQA 2K9IA 5M2RA 5AXMA 5KT7A 2CQPA 4Q0BA 4JV0A 5D4LA 5M2UA 4IKAA 5DQIA 2XZTB 2VC0A 3KLGA 2J0SD 1S6UA 2VQEF 2FJBB 1BC6A 5LSRA 1IM4A 3M6UA 5HLFB 1V9OA 3GE9A 5I3UB 2ILZA 2HKEA 2JC0A 2WW8A 2WSFC 4KGMA 4OLPA 1XMOJ 3UFCX 4C0HA 1YSJA 2CQHA 2XBPA 1FXDA 3K7RA 3HSDA 1PJ6A 4DPOA 1B7YB 1P1LA 3IXQA 2FHJD 2VQFJ 2EPIA 3ITHA 2W4CA 2PMZD 2NZCA 2RVJA 2WBMA 4X4SA 2HQ3A 2VKZG 2R2SA 3UR0A 2KDOA 4DDFA 1S1VB 3U1LA 3DGPA 3O6QA 4KQZA 3D5MA 2ZHBA 1GMWD 3ISNC 4CLSA 4CM0A 1UA1A 4XIUA 4HKQA 4WZMA 4P75A 1RADB 2HZVA 3OJUA 1NLKL 3OJSA 2QL5B 4KBIA 2H4WB 4ZP8A 4EO8A 4V19X 1Q79A 4ER8A 2YXLA 1Q81T 1NZAA 2CJBA 1D3WA 4KHPJ 2W24A 3ILIA 4LFBF 4CZCA 3H87C 1IBMF 1IBKJ 2X7IA 3OQ2A 1Q0NA 4PPDA 3TAQA 2DYAA 4NLDA 1S0VA 1T95A 1ZAVA 3QO9B 3W9HA 3FFIA 4C8NA 5HI7A 1YZ6A 4URQU 4C98A 1FRXA 2FUG9 2C3PA 2OPPA 3PHEA 3ZZPA 3CC2S 1CEZA 2AYMA 2ZBIA 3BO3A 1KLMB 3JSRA 1TKZB 3BO4A 2NSCA 3E01B 3H2LA 1F6TA 4RW9B 1VHFA 4U96A 4C3MA 2AX0A 3BGUA 4R8UA 1KOHA 2PFDA 4X4OA 1UA0A 1Z2LA 3NG8A 4CLUA 1FX2A 3BKTA 1TK8A 2BNZA 5FDLA 2VONA 4P2SA 4MMOA 1KNZA 1PC5A 4OX6A 3A1YG 1NB7A 2LCWA 2O01C 2W2OP 4LJMA 2XLIA 4NASA 1JLFB 1HQEA 3A8EA 5FD1A 2UUWA 1HMVA 4NLGA 4R0JA 1FNXH 1M5VC 4OHXA 5K8OA 3C19A 1OYDA 3K89A 2M7SA 1U8SA 4PAAA 1Q16A 3H42A 2KXNB 1VRUB 1WKJA 4W4MA 2KB2A 2ZH4A 1M5KC 2MZQA 5EX0A 1JLFA 3ILOA 4CO4A 4B9NA 3D6TB 5HMXA 2DPIA 1GT8A 1T9WA 1ACMB 4WIIA 1L3TA 2HNZA 1JJ2R 3G9CA 1FRHA 1UL3A 1OSCA 2PA3A 2BM0A 2E7VA 2EEYA 2F8HA 1TL1A 1RDRA 1T3OA 1RT5A 2W2QP 5IV4A 2FDNA 4FDFA 3LW5C 2MHNA 5KFYA 5HJYA 1H2UX 2KKHA 3CO9A 4CYUA 1GK8A 1SV5A 3M30B 4USUA 4B3RJ 2QT7A 3HF5A 1C1BA 5HROA 1NSPA 1S99A 1WC6A 1NH8A 2FY8A 4L75A 2MY7A 4YY3F 3T6BA 4B9LA 3M1VA 2YWEA 3U1NA 3FFIB 2HMIB 2EWHA 1WC0A 1WWHA 1NK8A 3J80U 3MM9A 4ZLPA 2HHHJ 1N5SA 4G3IA 2A6OA 4RL1A 3MEEA 2QEXS 2KJWA 3DOLB 4ZVRB 2UZAA 2M3DA 1LWEA 3DLLQ 4B3OB 3DLBA 2F3JA 4ID5A 3UDEA 4KTQA 1IVZA 3TR5A 3PYDA 4NOHA 2GCFA 3EICA 5ETSA 5KFZA 2BJEA 4Y28C 4BHQA 1AW0A 2QG9B 4KE5A 2HBZB 2A2DA 2W1BA 1S1VA 2MZSA 2YQ3A 2K3IA 1AYEA 1K8AT 3MD3A 4IOCQ 2MSTA 3NLCA 3RZAA 1R6VA 2OPQA 4H4OB 1FDBA 3VEBA 4NRUA 2ZOFA 1WF2A 3G87A 4F36A 4F2SA 3L7UA 4U67Q 2MHEA 4HR2A 3FVYA 1SUQB 1XR6A 1FKAF 2D3O1 3MUMP 4PR6A 1T05B 3OL9A 1RT6B 1NPRA 1GXUA 3DCAA 2J6TA 4ALZA 3TVZA 2CPDA 5E0OA 2VIHA 4C8OA 3PX6A 1SC1B 2ASJA 1TMMA 2C3YA 3LF0A 3P4UB 3O8WA 4CH1A 1S1UB 1YKWA 1ZAXA 2MKJA 2OD4A 2RF2B 1JLBB 1CC8A 2HLUA 4NLSA 4OI3A 2IJRA 2BABA 2CVIA 4AT1B 1T3NA 4IH5A 3CW2C 4NZ6A 2J9EA 1NZ8A 3W2VB 4RJVA 2W2PP 4P72A 4GO5X 2EC2A 2BJ3A 1NDPA 3KJVB 2YX1A 3CMES 4K4UA 3K8VA 4C11B 5AXNA 2GJFA 4LF4F 2ASYA 5DLGA 2LXFA 7FDRA 4KV8A 1GMWA 2QSFA 1PAUB 3VVTA 1VQYA 4RUCA 2HBYB 3EWGA 4BC9A 1KQSR 3PW0A 1EQ0A 1FD2A 4JBCA 1S57A 1HBUA 5DRKA 1U25A 3HVWA 1EARA 3M2RB 3TX8A 2Z30B 4C3LA 4CWBA 4WU3A 4NXNF 1H73A 1TAUA 3A12A 1MN7A 2P8IA 3W5ZA 3PW2A 5DDRC 4PRFA 4FVMA 4QU7A 4YQWA 2HBRB 1R8CA 2K06A 2ZITA 3AB4B 2L48A 3RBDA 2LA6A 1Z2ZA 3K17A 4G6VB 5EHHA 3MPWA 1QVGR 5LJ3Y 2ROEA 2C1EB 2GO9A 1LFPA 1SC3B 1FA0A 2EBGA 3AQOA 2MGZB 3RB4A 2C3UA 2CRLA 3E2EA 1MU2A 1H0HB 1P27B 4M63A 4A46A 5KT4A 1NKEA 1N33F 3M8YA 4ZN3A 1LOUA 2BJ7A 2ZKUA 2HMIA 2HS3A 4PXCA 4AXIA 4LF8J 1XNQF 2NPFA 1HIYA 3OUYA 2LXUA 1C1BB 1RI7A 3IM9A 2AMCB 3QWPA 2APOA 4ZK7M 5HROB 3QIDA 3KHGA 3FMBA 3KHLA 1JLQB 1RWWB 4ECUA 1S72S 5HP1A 2HS0A 2E9RX 2RB7A 3PKMA 3QRPA 1AFJA 3FKBA 3I0SB 3IBFB 2D9PA 1QSLA 3AD9C 4NZ7A 1UEUA 3KXDA 1FKOA 4U8YA 2KG1A 5DDOC 1HBNB 1M5OC 4H4KA 3OHAA 1QDUB 4F4AA 1S7IA 2YKAA 5A6WA 1N56A 1O0PA 1Y00A 3NEKA 3GIRA 2GMLA 3N0VA 3VWSA 3W9JA 3CJ3A 3JSMA 1VLOA 1GTHA 3D2WA 2ZJRQ 5DM7Q 1IKWB 2P6TA 5FIIA 2MKIA 1NKBA 2AYBA 3WBZA 2J9CA 3KWMA 3H2VE 1NJZA 3AAWB 3R5BA 3I4HX 1UJ6A 5J1EB 4CO5A 3BQ2A 2QA4G 4ZPDA 4DL4A 4JOUA 5BYSA 1FJGF 2XMKA 4MJKA 3MPYA 3A3NB 2IVMA 5HMWA 3LP0B 1N32J 3UD3P 2HFUA 2NZ4A 2Y0BB 2FZKB 2XWYA 2V2KA 4RWWA 1MWYA 2OSRA 5KFSA 2Z57B 1TQLA 3LGHA 3DM2A 4QR2A 5HMYA 5K8MA 3R2DJ 3QGPA 1S0MA 2KZZA 2M2BA 1RU1A 1FXLA 3ZO7A 3RB0A 4B3MF 1RGVA 1YJUA 3ICLA 3H4DA 1HNIA 1X8DA 5D78A 5JVGQ 1EHWA 3KG0A 4C8KA 3VF0B 1BUXA 3OT9A 3QRQA 5LL6d 1KLMA 1TU0B 1JQGA 2PA8D 4NE9C 4NEZA 4DZDA 3OFHA 2RH3A 4QWAA 3UDVA 5KFUA 5J1PA 3TEHB 2HVHA 4HH1A 2GMHA 1IRQA 4RWXA 3JTNA 4N77A 1KWMA 2ZKTA 4YMEA 5A8KA 2HK3A 3DLEA 4W98A 3CNQP 3GJTB 5AXLA 1TVRB 4NCGA 2VH7A 4A4JA 1KVJA 1XR7A 2HAIA 5J2MB 3B4MA 2VL1A 3IGVA 1IBKF 5HQMA 5ETNA 1NDLA 4J9VA 5G0RA 4LIRA 3OR2B 1SJQA 3VCDA 2CXEA 2J0WA 3QSYB 3MUVP 2EFGA 2ZHAA 3MM7A 1F5AA 5HBMA 1Q4RA 1T0TV 1U26A 5CA5A 5EWEA 3DGPB 3T5KA 1UJ5A 4YP3A 1UTAA 4DR5F 1KFSA 2W7AA 3ZNUA 4B02A 3CGIA 3GU0A 3IAS9 1NSAA 3HHLD 3TZZA 1RT1A 5KG5A 2UXDF 3TJAA 4PQUB 2DB1A 3CT9A 3MURP 3PJXA 2CQ3A 4F0HA 4RBVA 3EGNA 3R5CA 4ED4A 3K5NA 2ALZA 4ES1A 5I42A 1SIZA 3SIPB 2BKOA 3CCTA 4P2MA 3RAXA 1L3SA 1FTCA 1LKZA 2DGUA 5L1JA 2LXIA 2XY7A 2DITA 1QE1A 2DXFA 1OPIA 3IS9B 3GB0A 4JI2F 4I2QA 4JP8A 3P3DA 1YVFA 4NLRA 3NAIA 2XGPA 3KLIB 2W9AA 2FB0A 2XTJP 5LMUF 1IM6A 2PEHA 3CUNA 4DQIA 3IGNA 3QT7A 1VI7A 2FVRA 4IR9A 1HBNA 2AEJA 4OX7A 2CPJA 2R8KA 2I9SA 3N01A 1FI4A 2Y1LB 1VLYA 1EB0A 3HULA 4ZVGA 3VV2B 4DEZA 3K57A 3T5HA 3KNAA 2FHJA 1X5PA 3M9NB 5L9NA 4X2BA 3B54A 3CB4A 4MKBA 2K7JA 2GV1A 1DQ8A 3POTB 1FRKA 2YQ0A 1RSCA 5KFOA 5FLXU 1YG0A 4YB5A 4N7TA 4R0EA 2UUCF 3QJPA 1PYSB 3WQPA 1RCOB 2OFGX 1DHMA 3NCPA 4P2XA 4ES2A 4Q44A 1I6JA 4ERDA 3AOBA 1OHNA 2IAJA 2HQIA 4HHJA 2C3OA 5K9FA 2MGZA 5KG2A 2BJ1A 5CCMA 5IV3A 2ZBPA 1B99A 1RHRB 2XYHB 1X4EA 1D09B 3Q8PB 1HWLA 2E9TA 4WFZA 2K1RA 3D0HE 3M6VA 4MIAA 2IMOA 3MMAB 3TOQA 8AT1B 4DZ6A 3DRPA 2HNDA 2DIVA 2CDQA 2E7XA 4O3NA 3ZTSA 3K5LA 3SI8A 1N36F 4JI7J 1HWIA 1TL3A 1WC4A 3OBIA 2CZVC 1SH3A 4ZA1A 3VAKA 5KFWA 2IBKA 3Q8YA 4NWBA 4KPYA 2MTLA 4M5KA 2VBZA 3TUPA 1HHQA 3W1YC 2AWZA 3M2RA 4LMZA 1LW2B 2K7KA 1VCTA 2XMTA 3EGWB 3EGVA 2R8GA 2E5LJ 2KH9A 2QA4S 4DLEA 4MYTA 1NAQA 4K4WA 4KH0B 4RPFA 3ELHA 3OFGA 4DQRA 2EG1A 2H3AA 1NDCA 4ZCLA 2ZD1B 1Z1ZA 1Y5NB 3KLHB 2ZM6F 3KJVA 1R43A 1S1TB 1U7LA 1HPZB 3CCSS 3AD8C 3HFZB 1RYRA 1PSDA 4D3HA 4F25A 2UUBF 4WIQA 3FMTA 3ILJA 2VFTA 1NK6A 2K29A 1VISA 3PRBA 3R1HA 1RAEB 2JVOA 4HV0A 1NH7A 2XY5A 4YS2A 4FXEA 1NU4A 3CCMS 1S9EB 3PYEA 1VDHA 2GC8A 1RA6A 1P94A 4PXBA 2WRMA 3MUTP 3GV8B 1VQ9S 4C9DA 4YHHF 4CLYA 2ZH1A 1FVQA 1S49A 1NPPA 1W25A 1JX4A 2VQEJ 4BS2A 1KOOA 3DOKB 4NLYA 4DR4F 3MR3A 5CYQB 2WZ1A 3FNNA 1VFJA 3HI9A 2CNKB 2OHDA 1O51A 5HQ8A 1T05A 1SUQA 1KDNA 5I3PA 1U1OA 2DGTA 1CC7A 5I42B 3MGJA 3NGKA 4UQGA 2VOPA 1HNZF 4KRWA 1UWBB 3BGRB 4I56A 2YPYA 1S6OA 2I6WA 2ALYB 1T8EA 2V5HG 4DSIA 4CLTA 1X4GA 2OPRB 4RW4A 1XNRF 4RW7B 1SJ1A 4QR1A 1TELA 4K2JA 1ZM9A 3GXQA 4ICLB 3KK1B 2HFZA 4B9MA 1V5IB 2H54B 3W8PA 3PX4A 3M6XA 3GMGA 4KIAA 4B9TA 3OR2A 1FT8A 5G0RB 3W5YA 4ZLNA 1CJVA 2KU7A 4HVZA 4TY8A 3WHIA 1KHWA 5B0AA 5DM6Q 3QZ8A 1RTIB 3RUBL 2QL7B 2V94A 1MWQA 2NXEA 3E8OA 4F67A 1URRA 3J7A1 2Z2LA 5F9LA 4MKYA 2JXHA 2YNFA 3SBMA 3HCXA 1CLFA 2FJWA 4NA1A 1QSSA 1VQ6S 4A8QA 1XC9A 2ZH3A 2BA3A 1FRMA 3DGVA 4J90A 3MPDA 1RHJB 4TXSA 3ZZUA 3BH6B 3JQMA 2I0XA 2BJ9A 3P96A 3RG6A 4EWTA 4DV5F 1RCXB 5A8RA 2KELA 1F60B 1TUVA 1HLWA 2U1AA 3M30A 4DX6A 3M9MB 3H40A 1I94J 5GVQA 1JLEB 1J27A 2R7QA 4OYPA 3P49B 1SKWA 1UPMB 3M8QB 2IM2A 4UTGA 3QIPB 2AQ4A 3C15B 3FRZA 3H7HB 1K0TA 4LFCJ 3Q86A 1X4CA 1BQNA 1T9VA 3HKWA 1HI0P 2D9OA 1RWPB 2GGPB 3LAKA 1AA1B 1IBLF 2R7SA 1DJ0A 1HKAA 4F7VA 2XCPA 4DR7J 4EFAC 1S48A 3H0PA 2ZOMA 5A2QY 3AJDA 1Q82T 3A8JA 4P7VA 4ES3A 1VRUA 1JIHA 1RBOB 1BHNA 5LXRA 2ZDOA 3IWXA 4ED7A 1V5VA 1RQ0A 4ECSA 3BSAA 3TP2A 4Q8FA 3A4TA 1X31C 1JKHB 1Q53A 2SXLA 4OZ1A 3UCZP 5D8HB 2KVQE 3MAHA 4LR9A 4J91A 1YGYA 2ACYA 4HEA9 2RJZA 1MWZA 3MM8B 1XR5A 4NX9A 5F0UA 5F3TA 1WEZA 4CNZA 5HSPA 4EBEA 2BR0A 2QLWA 3QFHA 4ANEA 2LQJA 4CLKA 4JI5J 4WYWA 3FT7A 4ZPBA 4ZPTR 1SVDA 4ED3A 5GAGI 4P71A 3T41A 3TQEA 1VQ8S 2QMWA 3NY0A 5FDLB 4C2MA 4GMKA 1FKOB 3VTIA 1V3ZA 2ZH8A 4DQQA 5H9EJ 1HI1A 4MTPA 1TUWA 5I4MA 3FEYB 4L6V3 3VGVA 2Y1JA 4FYWB 4ZP6A 4NL5A 1GNKA 1LW0A 1WI6A 2DBBA 4LF2A 4DL7A 2FPHX 3N6MA 5D0HA 4DR3J 1HNWF 4HL9A 4A8OA 3V6DB 1PGZA 4JV5F 4OFZA 1ZZNA 3J81j 4DV7J 2H5IB 2OPPB 2WW4A 1UPPA 2XSFA 3IRXB 4U7CA 3K5MA 2FLNA 2ZUGA 1S9FA 4FXVA 4ED1A 2AEFA 1YDLA 1MU2B 1RTJB 4G1QA 1U48A 5CYMA 1DTQA 4CP5A 3MCNA 4ECRA 3HFKA 4URSA 4DX5A 3RBEA 2FLPA 4NLQA 1XWLA 3PY8A 2MQOA 3I5AA 2DJWA 1SPBP 5B0FA 3AT1B 5C24B 5DG7A 2P6SA 2QE5A 3IP0A 2PC6A 3ENVA 2CPZA 4WE1A 3FQKA 3ETMA 2B8PA 4JI8F 3THTA 2N82B 2VHGA 2XGQA 2VJUA 3BYPA 3CJ8A 4MAKA 1B3TA 3CULA 1VR6A 2DTJA 3H20A 3ZTOA 3DXSX 4DFJA 3CDWA 4C8ZA 2W01A 1NM2A 2BANB 2JSXA 5ETMA 3KLEB 2PMHA 2ZH6A 1PYTA 2HBQB 2G0CA 3C6UA 4OZ5A 3KKFA 1VBYA 1Y5IB 3RR7A 1DFDA 4PWDA 2RQ4A 1GH8A 3BPDA 3MDFA 4DUTA 4IR1A 4HT5A 1CQNA 1N5TA 3NKYA 3VZHA 3Q24A 5I3UA 1T9TA 4JI8J 2DD8S 3PO4A 4P9SA 4ECWA 5CXTA 2JRSA 3NCQA 1OS5A 2VKRA 4TQSA 3UVJB 4TYBA 3LAMA 5D3GB 1D8ZA 1RU2A 3JYTA 3BN7A 2FHMA 2R7OA 3O3LA 4ZP7A 3FZBA 3RW6A 4K4SA 2B6AB 4WFAQ 1B70B 3V4IA 1H72C 1UCNA 2BNWA 2FIUA 2N4DA 1KC8T 1NDKA 2RE1A 4M5DA 2WSEC 1RT6A 1W7WA 3C66A 4CM2A 4AL6A 2IPOB 1NK0A 1S59A 4MYUA 5HMZA 2CQ0A 3VW4A 1ZA1B 2IRXA 1FCAA 3GPAA 3GSDA 4YUDA 3CJ4A 3MTJA 4I7FB 2FY1A 4DL6A 3BN4A 1F5BA 1OWXA 1N52B 5T7LA 4M94A 3EVOA 1Q78A 2ZNYA 1R0AB 3SQGA 4WKYA 2HHQA 3BPSP 1QLNA 1IKXB 2M70A 1ZS6A 3SDEB 1ZAWA 3IBCB 1WF1A 2BQRA 2DGSA 3RRHA 1RAGB 2B56A 3ADAC 3DRRB 3E51A 2C22A 5E3CA 1A0OB 4L3KA 1C0TB 4ID5B 4B3OA 2OAUA 4A48A 2AW0A 2B51A 2VJVA 4OMFG 4ECXA 1B01A 2HRYA 2MKHA 4LFCF 2EFVA 3VQTA 3IWNC 2Z2ZA 1AT1B 4N8NA 1RT2A 2XMUA 3L7OA 2DIUA 4X4PA 4RBTA 5IM0B 2NXCA 3NBPB 3M1VB 4DR4J 3IRXA 1FF2A 1U6FA 2KKEA 3S01A 3D7SB 1RT4A 3ENWA 1T94A 2V2VA 4O44A 1KQFB 3RBXA 4IDKA 5EDWA 1SV5B 3PW4A 4WFNQ 1FJEB 4QYRA 1T7PA 2UVRA 5KAKA 3GLJA 3W2WB 1FE0A 5E3RA 5DLFA 1GXLA 3OL6A 1N48A 2FLLA 2OTLS 4JI1F 2VC1A 5GMDA 3ZZ0A 2XCAA 4ZLJA 1RJJA 2M8DB 2BDPA 4M5MA 4FKXA 4NI2A 4M5JA 2CQIA 2ZM6J 1RK8A 3TX0A 3H25A 1RE1B 2B7CB 1UJ4A 3DLHA 1U1RA 4F3QA 3MR5A 5LOQA 2IM0A 3DLJA 2MQPA 2ZJQQ 1WC5A 4DSFA 4Q43A 2J6SA 3MMBB 3QT8A 3FCHA 2F63A 3MMCB 4K50A 4QJVA 1ZM3A 4A8FA 2IIHA 3PYFA 2VG7A 2RKIA 2XZWA 2GAGC 2PD1A 3M8WA 4ZJLA 3THPA 1MMDA 4Y2AA 5IWAJ 4KYZA 3BSCA 4ZVTB 3I5CA 4C6AA 2Y8WA 1RWOB 1G2EA 1RAHB 3FZ2A 2Y0SD 3N6NA 4I4BA 4KY3A 4LSLA 2DEIA 4EUVA 5C25A 5HQLA 4H54A 4DV2J 1NJYA 4JI3J 4YDXA 1MG7A 1VQPS 3IA0A 4KT0C 4OQJA 1CJKA 1MYLA 4K7QA 4DF4A 2VFVA 1N34J 3LP1A 3M05A 5JVHQ 3NOCA 2QLJB 5GAEU 2ZH9A 1LNQA 5SUHA 1NHUA 2D3UA 2PIIA 2VQFF 1ZETA 3A3OB 2E9ZA 2PO4A 5A8RB 4GKJF 3HXMA 3HHDA 4DFPA 3CD5A 4CO3A 3U02A 2H1OE 1OIAA 4K0KF 4KGVB 1SI9A 1LEOA 4KKOB 3QO9A 1G7CB 4NLOA 4WFBQ 4JI0F 1RA7A 1BDTA 1S4EA 4BBYA 1NXIA 1WC1A 2ZBRA 3M32B 2BQUA 3M8PA 3MZIA 1BXNA 2HAFA 4HACB 1DURA 3FK4A 3G82B 1KVKA 4LFBJ 2L08A 5KFFA 3GCWP 4DI6A 2ROGA 4FXWA 5BYRA 3QT5A 4CT9A 1T11A 1VQ5S 2BKPA 2AYEA 2ACMA 4RW4B 4S0MA 4USKA 2DNQA 3RU0A 1RXOB 2LDYA 2NYHA 2FHOB 3PNIA 5AXKA 2OELA 2UP1A 4QCLA 4ZITA 1U0HA 5KFXA 3CCUS 1S1WB 2R8HA 5EN1A 1CQMA 5KT6A 1N5QA 2MQ8A 1NK9A 1YRUA 2RRBA 4GRSA 3I0RA 4F2RA 2KZMA 3Q8QB 3M8RA 1S77D 1QAYA 2QJ3A 1B0VA 2VV5A 4FS2A 2DHGA 1LXNA 2FC9A 2GJIA 3PEHA 2GPEA 4UUXA 4OYBA 4RO0A 2M8HA 4E8UA 9ATCB 3KHRA 3HVAA 3DOKA 3NL0A 2Q6CA 1IR0A 3KJFB 3DFEA 2ZC4A 5E33A 1YJVA 3D68A 2EFQA 2DNHA 3IR7B 1SL2A 2YKMB 1G6BA 2ZOGA 3NCRA 4RW8B 4EI2A 2F5GA 4UOCA 1AB8A 1C1CA 1RUSA 4LFAF 1JLAA 1YZ7A 1OSDA 2OPSB 2VG6B 4ZVUB 2IRUA 3DRSB 2BUNA 2B0GA 6FD1A 1FVSA 1J5OB 1SQGA 4KJIA 2QN6B 3FRYA 3VALA 3N79A 1S1TA 2W8LA 2JH3A 3HHEA 4IRDA 3SSRA 4Q2LA 3X1LB 4LSNA 3P45B 2AX1A 2DH7A 2POKA 2YKPA 5A76A 3CDBA 4AE5A 2BZ2A 3T6JA 1FJ7A 2XMAA 3OR1A 1JNRB 1HNVB 4OZLA 1JLCB 3MEGA 1YRTA 1S12A 3I87A 5D6GA 1VQKS 1GMVA 4PWWA 3M7VA 1ROFA 2OSQA 4IFYB 5IXUA 4EZ6A 2I2YA 1PBUA 3DHWC 3GFXA 4Z37A 3LPYA 5LXYA 4LBPA 2HGLA 1GAOA 5D77A 4LF9J 5DS7A 4O23A 2VPWB 4QYZJ 5J2QB 2F4FA 3DLKA 3Q8RB 3HDSA 2JFDA 3M2UA 4DUYF 1SL1A 4OX9F 2ZJPQ 3DDNA 4Y2MA 1DTTB 3H98A 1KKHA 3CWJA 4KFBB 4O3PA 4DS5A 5F8HA 3KJQB 1B7FA 2CQ1A 2JBVA 4DPUA 2VD3A 3GV7B 2FQQB 4Z7CA 5HVFA 3R5GA 4PEOA 3MF5A 1MLAA 3I55S 3QMQA 2JLFA 2Y3YA 1TMJA 2CJQA 3ZFVA 5AE3A 4F4XA 3HK2A 4PG6A 2HNYB 3QLHA 2R7UA 4F02A 1R8HA 3CD6S 1YJWS 1NUEA 3D0GE 4X62J 3M8SA 1OY8A 2XS2A 1FDDA 1TAQA 2QV6A 2E1PA 4LR7A 3LP2B 2XC9A 1TKTB 2XB2D 1WHYA 2L9DA 6AT1B 2LEAA 3IG1B 4RUHA 3CSKA 3HT0A 4DUZJ 2G2YA 1JLAB 2VG6A 3VGTA 1IN0A 3G96A 2IDEA 4QWCA 1J5EJ 3BS9A 2YKMA 1RTDA 1QJHA 2A1BA 1WOPA 2R7WA 1WACA 2LP4A 4G1PA 2BA9A 1VJQA 4ZKAA 1V6HA 1H2VZ 2M88A 4PG8A 4AFFA 3MCMA 1CULB 4YR3A 1S6QB 1IR2A 1VIOA 3D3CJ 3KLFB 3H5XA 2EKYA 3MFIA 3G8SA 4O4RA 4TQRA 2LQ5A 5F41A 3DI6B 3CTRA 4WPAA 4ZN1A 3BO2A 1RLDA 2HHWA 3W63A 2RD5C 2Y1RI 2KYXA 2FVSA 1SC4B 2MB0B 4NLXA 1AUDA 4LF7J 1DQ9A 1Y11A 2ZC3A 3IFEA 4PG7A 3VZIA 3TUZC 4O0IA 1PKUA 4DV5J 4ECZA 3UDCA 1JJCB 2QA1A 1RACB 3K5PA 1Q8BA 2E5GA 5D4PA 2AJ4A 1SJ4P 2CNLB 4EYHB 2A6MA 1OO0B 3OV7A 4ELVA 4EEYA 4K4VA 3AOCA 4DUYJ 4CTAB 4EBDA 2COLA 1KTVA 4YDDB 3G82A 5KFGA 3PIPQ 2AHOB 4WXWA 3PW5A 2PFFB 3PHTA 1UW9A 2MSSA 4ELTA 2KN4A 3CD0A 4IOAQ 3BF4A 3DLEB 1B4SA 3U7JA 1UAWA 4DX7A 2YKQA 1L3KA 1UVMA 5EGYA 1EA4A 4KH1B 1U2CA 4RLEA 1F9EB 4DQPA 4ZPAA 2DNRA 1U47A 1M5SA 1MROA 1NJIT 1IKVA 2F7VA 4FPIA 1RBAA 1CSJA 4IG0A 1ITPA 2Z56B 4ATNA 4DN9A 2DNZA 1HNIB 5DZ7A 1TK0A 1WD6A 4C7QA 1O5JA 1TFYA 4YN3B 3MCOA 4ZHRA 1OY9A 3PFOA 2MMYA 4DS4A 4GC7A 1TV6A 4TN2A 3OTBA 2RQCA 1P9YA 1RWNB 3L3CA 2OUGA 1RT3B 1T9YA 1FDNA 2H5EA 2I5JB 1EAYC 2JX2A 1U1MA 1XMOF 1YJ7A 2RKIB 1QM9A 1Q5YA 5EX3A 3NBPA 2DNYA 3GQCA 2V8DA 2A2BA 1RT2B 3L09A 2VBXA 3PTWA 4OYOA 2YNHA 3MAAB 1HR0J 4F3MA 3BGLA 3R6GB 3JTPA 2E29A 2WOMA 3GR0A 2ZEJA 1NSQA 5H1SV 1EJ7L 1UP1A 2D69A 3H8YA 9RUBA 4YFUA 1KLNA 2UVWA 3VQSA 4AQYJ 2ZHOA 4EU0A 1X5OA 4WKRA 4IOBA 3RW7A 2X1FA 2H5JB 5CD4H 3D54A 3KFWX 3PW7A 3GG0A 2R4FA 1N5YA 5KG0A 5KT2A 3QAUA 5D0EA 4N76A 2F4VF 1IKXA 3BREA 3OXLA 4MT1A 3SDEA 3W2WA 1F9FA 2DR5A 2XSJB 1S76D 4ZCKA 3LUYA 1JLQA 1WG1A 2VU5A 1S7HA 1N88A 4KGKA 4OJHA 4IO1A 3SYZA 3G5OA 1LFWA 2QTWA 2HVZA 3GCXP 2G2OA 1LK7A 4Q2MA 2CPHA 1RYSA 2FJVA 3ET6A 1S6PB 1FKPB 5C42A 4USVA 3J7ZT 1M0SA 4OYZA 4XTTA 4BLGA 3NXZA 5J1NA 5DETA 2YNGA 1YHQS 2J7WA 3P5BP 2KI2A 5CCLA 4M5DB 2ADBA 2V9WA 3SV4A 2CQDA 2KM8B 4FP9A 1U1QA 4C4WA 4P74A 1VIXA 3HD2A 1HL6A 2WONA 3BGOP 2XO7A 4K4ZA 4N47A 1EKRA 5L1KA 1RHMB 4ECTA 3HHKA 4QWBA 3C46A 2MZJA 3GIKA 5K14A 4LIWA 3TAMA 4DG1B 3KK3B 2UVUA 3K59A 2OTJS 2WCXA 2NXNA 1T03B 2O1PA 1TL5A 5E3QA 2UXCJ 2W9CA 4HHUA 3N6LA 1D9AA 3US5A 3KLVA 2JLGA 2JNJA 1RABB 4IO9Q 3UD5A 2DEJA 4CH7A 2VG5B 1HBUB 3SQGB 1R0AA 1UKUA 2EXUA 1I3OB 5THWA 5U47A 4C0BA 1YITS 4PWDB 4A47A 1FFWB 4RUAA 2ZZNA 3EZOA 2VPYB 5BR8F 2B43A 4J9SA 2MLXA 3Q83A 1EX8A 1SQEA 2MKSA 4NXNJ 1VQMS 3DU5A 4MK7A 1FFSB 3OVSA 2BBEA 3P8BB 1C2PA 3VAGA 2M0GB 2VG5A 2MLYA 3V4IB 1N34F 1F1BB 2B6AA 3TW0A 1UZDA 3DXBA 1TR0A 4K0KJ 2E5HA 4PKDB 2V9KA 3GYGA 3WIUA 5L1LA 2CAXA 2B3TB 1FK9A 2Q66A 4DQSA 5C24A 1JLBA 1F3FA 2V2QA 4NYPA 2GIQA 1VOMA 4I2PA 4X66F 1HBMB 4MK8A 3CC7S 5A8WA 2VPZB 3TWZA 2XMMA 2QIFA 4AXJA 5HVHA 5IFMA 2YNGB 2WVFA 4JV2A 3HD1A 4ED5A 3CC4S 1G1XA 2EI5A 1HNXF 4OIXA 2RU3A 3EPIA 2GFFA 1OPZA 4ZCMA 5DJBA 4WFYA 1H6KX 2M4MA 1QAXA 4IH7A 3QT6A 3BQ1A 2ATLA 1JLGA 4JB8B 4QR0A 5KG6A 1RAOA 5IQQA 2YNIB 4M95A 2OO4A 2RIJA 4Y6IA 5H9EK 2B4UA 5B7WA 3M6WA 4C8LA 3HSGA 3GILA 3ZZYA 2FVQA 2BW2A 4NZ0A 1T03A 1KBRA 1E6VB 3DKDA 3W66A 1N5YB 4DSLA 2Q2KA 2AV5A 1RWVB 2HS4A 2K3KA 2RU9A 2YKNB 4LF1A 4WFXA 4UZBA 4YR2A 1Q7YT 5IT9Y 2V4QA 2LVWA 5JUMA 4P52A 5IOLA 4FNIA 4Y2IA 1LWEB 4ITSA 1IWGA 3DOLA 3MM5B 4JUZA 1I94F 3MEEB 2ASDA 2DXEA 2HQGA 2J9DA 1CJTB 4LUBA 3R7NB 1YBAA 5KOWA 1VQ7S 1KSPA 1R8PA 2GVZB 3GP9A 3JS9A 3M9OB 2JEIA 2Q3PA 1SKRA 4O4GB 4DR6J 3FGVA 1N32F 3FBCA 4Z7YA 5LM7E 1BY9A 1ZOTA 2CZ9A 5KFKA 2JHEA 3HHLC 3VR1A 4YHHJ 2J6UA 1WSRA 4BDPA 1RT3A 1SQFA 2I5JA 1WG4A 2PN6A 1Y0HA 1LW0B 2DR6A 1O6XA 2QC3A 4FYYB 4NA2A 4CQ1A 4CYUB 2HYIB 2GGPA 2YX7A 3NWRA 5LMNF 3CCES 2V4JA 2GAHC 5KT5A 3TZYA 2DHHA 3QOQA 4C48A 4IG3A 2CDRB 2MQLA 2W4PA 4QBUA 3LPEA 1DZ5A 3G6YA 3O5TB 4UOGA 2QX0A 4CLZA 3LWLA 1NRKA 4AL7A 4QPTA 2CKWA 5DQHA 5RUBA 1IQTA 2B9EA 1IKVB 3MM8A 4WZQA 2IA0A 4IUFA 3EDQB 1RISA 1MNEA 3HSJA 3FEXB 4AD6A 3J7YU 3FMWA 2J7KA 1WHWA 3SCKE 3F73A 3T1YF 3VAIA 3PJ9A 2A0FB 2J9DE 3W65A 2BQ3A 3GSIA 2JFKA 1MN9A 3BGFA 1ZA2B 1F5CA 5CAAA 3CCWA 3G6VA 4JV1A 3PG9A 2NQPA 2KT5A 4ZVOB 2FZGB 1BQNB 4R25A 5LMNJ 2K1OA 3I96A 6FDRA 2P9CA 4N56A 3C6TA 3PR4A 3KK1A 3DHXA 1Q7LB 2FJEB 4JI5F 4USMA 4QPXA 2G2ZA 1UFWA 3M2VB 2YVSA 5KOXA 1YI2S 3H59A 3B4DA 4UT4A 2GQCA 1TTHB 3CEDA 3CMQA 1RAJA 1JXEA 1SIWA 4ZVFA 1SJRA 4OYWA 4C8MA 3EZ5A 5GAEI 1U9PA 3PDNA 1GTEA 1A6LA 5FJ4A 1FWPA 5T14A 1AROP 2R9LA 1HI8A 2F8EX 1UFKA 5KFIA 2DR7A 2K6LA 1X5TA 4K2XA 3DI6A 4HLBA 4ZJOA 4DSJA 3N5BA 2LEPA 3QAEA 4DXLA 2OD6A 2HHVA 3W9IA 2N7CA 1FRLA 3DOMB 1Y9OA 2Z2YB 2JDJA 3GZ7A 5L8RC 2FJAB 1Q95G 4DPXA 4L73A 5T41A 1W2IA 3K2YA 1TKXA 2C2MB 3PX0A 5IZHA 3HVTA 2G0JA 4ICLA 5AT1B 4RNMA 2OJ3A 2NXUA 2LQ8A 3LGMA 3SSQA 2CPXA 3F41A 4LF5F 4WP8A 2ZVSA 3BH7B 3TRGA 3R5JB 2VFSA 1R0BG 3OLBA 3HZEA 3MOJB 1K1QA 1HPZA 2XHWA 2V50A 2VA2A 1WELA 2H4YB 3CCQS 4KB7A 2AD9A 2LYVA 2C2EA 4U7UK 2EBEA 1FO1A 1VRTB 4TU9A 4KHRA
chains in the Genus database with same CATH topology
2H1OE 1NLAA 1Q5YA 2WVFA 2JXHA 2Y3YA 2K6LA 2BJ7A 3VW4A 1IRQA 2CAJA 1EA4A 2BA3A 1BDVA 1X93A 2CADA 2AY0A 1BDTA 2GPEA 3VEAA 1ARRA 3QSIA 2BJ9A 2BJ1A 2F1FA 1MYKA 2CA9A 2KELA 2JXGA 1BAZA 2WVEA 1B28A 2NZCA 1QTGA 4D8JA 1ARQA 3FT7A 2K5JA 3FMTA 2K29A 2K9IA 3BKUA 3BKFA 3LGHA 2WVCA 3QOQA 3GXQA 3BKTA 2K1OA 4HV0A 1MNTA 2CAXA 4FXEA 2BNZA 2PC6A 1MYLA 2BSQE 2HZVA 1P94A 1Q5VA 2WVBA 2CPGA 2HZAA 2WVDA 3OD2A 2FGCA 2BJ8A 2BJ3A 2RBFA 1B01A 1PARA 4ME7E 3H87C 2BNWA 1U9PA 3PHTA 3VEBA 2JXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1O E;  1NLA A;  1Q5Y A;  2WVF A;  2JXH A;  2Y3Y A;  2K6L A;  2BJ7 A;  3VW4 A;  1IRQ A;  2CAJ A;  1EA4 A;  2BA3 A;  1BDV A;  1X93 A;  2CAD A;  2AY0 A;  1BDT A;  2GPE A;  3VEA A;  1ARR A;  3QSI A;  2BJ9 A;  2BJ1 A;  2F1F A;  1MYK A;  2CA9 A;  2KEL A;  2JXG A;  1BAZ A;  2WVE A;  1B28 A;  2NZC A;  1QTG A;  4D8J A;  1ARQ A;  3FT7 A;  2K5J A;  3FMT A;  2K29 A;  2K9I A;  3BKU A;  3BKF A;  3LGH A;  2WVC A;  3QOQ A;  3GXQ A;  3BKT A;  2K1O A;  4HV0 A;  1MNT A;  2CAX A;  4FXE A;  2BNZ A;  2PC6 A;  1MYL A;  2BSQ E;  2HZV A;  1P94 A;  1Q5V A;  2WVB A;  2CPG A;  2HZA A;  2WVD A;  3OD2 A;  2FGC A;  2BJ8 A;  2BJ3 A;  2RBF A;  1B01 A;  1PAR A;  4ME7 E;  3H87 C;  2BNW A;  1U9P A;  3PHT A;  3VEB A;  2JXI A; 
#chains in the Genus database with same CATH topology
 1KEK A;  4DBQ A;  1JNZ B;  4WXO A;  3P5T L;  4RU9 A;  2H9Z A;  4OJ1 A;  4CCH A;  3AJ1 A;  1EET B;  4X4V A;  1KS2 A;  1K9M T;  2ABY A;  5CYQ A;  3S1T A;  1TUG B;  3UWT A;  2B8Q A;  4P7T A;  1IWA A;  5HLF A;  1QAJ A;  3WX4 A;  4P6Q A;  1WI8 A;  2NUU G;  4ED2 A;  4I67 A;  2CG8 A;  4Z2X A;  4K4T A;  2DGO A;  5KG3 A;  4Q0B B;  3QZ7 A;  3NO7 A;  1G4C A;  2X1A A;  2FZC B;  2W9B A;  3JB9 k;  3HFV A;  4QIV A;  4M5G A;  4JI4 F;  4F50 A;  2O5D A;  1W2B R;  1N33 J;  1S4F A;  4IFY A;  3CCJ S;  2HQF A;  1NEE A;  4JI6 J;  2HFS A;  4JI6 F;  3EVW A;  1NKC A;  1HNV A;  2KT2 A;  3OR1 B;  2IAJ B;  3Q8V A;  2KVI A;  5KFJ A;  1KR4 A;  2BRL A;  4K5S A;  3D1O A;  4USI A;  3TJ9 A;  4LBH A;  2GO8 A;  4PQA A;  5EWG A;  2XYG B;  2XQC A;  3KK2 B;  4W92 B;  4FXD A;  1YK9 A;  4WYL A;  1HD1 A;  4B17 A;  2IBO A;  1W26 A;  5M2P A;  1N4L A;  1RAF B;  2LLZ A;  3CDA A;  3G8Q A;  5HJX A;  1RAI B;  4QZV B;  1J5O A;  2M52 A;  2XUL A;  4KC5 A;  4AND A;  1PIL A;  5AJ3 J;  3I4P A;  2YPZ A;  3R27 A;  3DRS A;  2ASL A;  2K8G A;  4ELU A;  1TL3 B;  2I8E A;  3TUI C;  2G1D A;  8RUC A;  4OI4 A;  4U95 A;  5KFN A;  5CD4 A;  3MMA A;  5HAN A;  4EBC A;  1FHT A;  2ZD1 A;  3W3S A;  2C2Z B;  3OXF A;  3ZZT A;  3T5J A;  3CDE A;  5IT4 A;  2H3E B;  4B08 A;  1CJU A;  1HQU B;  1R8A A;  3PYG A;  2NRE A;  3W60 A;  2ZUA A;  3MAQ A;  2QYG A;  3I0R B;  4X4T A;  1B64 A;  3CD7 A;  3UD4 P;  1XNQ J;  3I32 A;  1S1W A;  2RDD A;  2ZBC A;  3TJ8 A;  3POT A;  5K8P A;  3KMS A;  3VAM A;  2FC8 A;  4PQU A;  2LU2 A;  2LFV A;  1HW9 A;  4L76 A;  4OI6 A;  3D9B A;  5DGB A;  1HHT P;  4U8V A;  2CQ2 A;  4J37 A;  3MCS A;  3HVT B;  3GJR B;  1FXR A;  3LJP A;  1VMB A;  4G65 A;  1WKL A;  2QLB B;  3HHL A;  1YX2 A;  1BWV A;  1TL4 A;  2VB6 A;  4X4N A;  5LT5 A;  3PIO Q;  2CQG A;  2VF3 A;  3DDI A;  3OTO F;  2OKQ A;  2KFN A;  3KLI A;  5BR8 J;  1PAR A;  5J2M A;  3M32 A;  4I2Q B;  1TVR A;  2G13 A;  4PWU A;  1K1S A;  3R8Y A;  5A8K B;  2CNO B;  3T5L A;  2GMJ A;  3SZ2 A;  3C16 B;  1X4H A;  2XI3 A;  3FSY A;  2R8I A;  4C8Y A;  3TAR A;  1KD1 T;  4NEY A;  1C4C A;  2QA2 A;  2HUR A;  3TUJ C;  2DNO A;  1JJ4 A;  3NNC A;  3OTD A;  2VFU A;  1Y5L B;  1X9M A;  1H38 A;  1WC3 A;  1RT1 B;  3O2I A;  4ZP9 A;  1QTG A;  2VDH A;  3ZTP A;  3MR7 A;  5GAH I;  4DV6 J;  1QUV A;  4DR1 F;  3UN2 A;  3UQS A;  2N3O A;  1VRQ C;  2PDA A;  3J7Z 5;  4R5P A;  4ILM A;  3Q22 A;  3MM7 B;  4GVB B;  5HBM B;  2E66 A;  3OFF A;  3DM2 B;  4UOH A;  4ETX A;  5J2P A;  2CPY A;  3MHY A;  1IJF B;  3N9U C;  4H4M A;  4RW6 B;  4USW A;  5B09 A;  3B82 A;  4K8R A;  2O67 A;  2V68 A;  3R5D A;  3RRK A;  1H98 A;  5HVG A;  5F8J A;  1S9G A;  1ZZF A;  4X65 J;  3FSI A;  4BWM A;  4N5S A;  2GX8 A;  4NCG B;  2RRA A;  2VG7 B;  1UWA A;  4NXM J;  3W8G A;  4I68 A;  5D15 A;  5J1E A;  3CIZ A;  2MXY A;  2CJ9 A;  3MMB A;  4DL5 A;  1GEH A;  3Q0A A;  5E7O B;  1LWF A;  4HTJ A;  2CA9 A;  1N8R T;  2WK4 A;  3L4B C;  4RZR A;  3VVU A;  3CF5 Q;  2FTR A;  2XNQ A;  7FD1 A;  3SCI E;  1H74 A;  3PJW A;  4AL5 A;  3W64 A;  3HHL B;  4L3N A;  2DNG A;  2DNN A;  5E3A A;  3D4J A;  4NI2 B;  1I51 B;  3J80 Y;  4DV6 F;  1X9S A;  2YTC A;  3D67 A;  3I0S A;  3VGU A;  1M1K T;  3P6Y C;  4EK2 A;  2J5A A;  2H48 B;  4B3T J;  1FER A;  4QIF A;  1MW7 A;  4ZPW R;  1DLO B;  2AZ3 A;  2CIM A;  3DMJ B;  1S1X A;  4BCA A;  4EZ9 A;  3QGH A;  5DQG A;  1U1N A;  4F0K A;  4IRK A;  2YBV A;  2AP6 A;  3MM6 A;  4LVO P;  4WBF A;  3GIJ A;  2IC3 A;  2UXB F;  2IVY A;  2GQ2 A;  3KNG A;  4KO0 B;  4LRB A;  5JMN A;  1IJE B;  4IRC A;  3Q89 A;  4JI4 J;  1U6B A;  4J9U E;  3AA9 A;  5LJ5 Y;  1UVI A;  1CJT A;  2HK2 A;  3OHB A;  5EUH A;  3V6H A;  3RAQ A;  1UEV A;  2F40 A;  2V8H A;  3MPV A;  2JOQ A;  3PEJ A;  1BAZ A;  3GJQ B;  3GFY A;  2CPI A;  4ED8 A;  2F65 A;  3U1M A;  4FN5 A;  4X64 J;  1N0U A;  1XTZ A;  1ZM4 A;  3B78 A;  4DV3 F;  2XS5 A;  1PG5 B;  1Y3J A;  4FYX B;  4WP9 A;  3THV A;  2CFX A;  4E0D A;  4QQB A;  2PE8 A;  2JWN A;  4Q45 A;  1RAA B;  2RSQ A;  2XG8 A;  3IMQ J;  3OXG A;  5HP1 B;  1S0O A;  3R7S B;  2F4V J;  2YNI A;  4OI2 A;  4XDC A;  5AJ3 F;  4ME7 E;  4DWI A;  1FEH A;  1GFW B;  2OML A;  3PFE A;  5T7L B;  2LEC A;  1YTY A;  3QQC D;  2HGM A;  3AOA A;  4DHV A;  4IFV B;  2QGF B;  2E1R A;  2B9X A;  5L46 A;  2BEF A;  3PCO B;  1CS4 B;  4J7C A;  2X3D A;  1X93 A;  1WSV A;  2P9G A;  5ITH A;  4TLQ A;  3IO1 A;  2D3O R;  4LT6 A;  1EIY B;  1SH0 A;  4LRE A;  2C2N A;  3SMZ A;  1M1H A;  2DCU B;  2RHS B;  4YB6 A;  1C4A A;  2JC1 A;  4Y2K A;  1QSY A;  4XAK A;  2BAC A;  2VDI A;  3LOU A;  4PCQ A;  2J0Q D;  3DC2 A;  2B7B B;  4X64 F;  3TQ1 A;  5GAH U;  1UVN A;  3D28 A;  3SEO A;  2H1Y A;  2UUT A;  1X60 A;  2KG0 A;  2NXJ A;  3GR1 A;  2U2F A;  3DLG B;  4PUO A;  2Q1L A;  4DL3 A;  1NBE B;  1JXL A;  4QYZ K;  4PZV A;  5CHC B;  5F9N A;  5KFH A;  4Q8E A;  4QWD A;  1EET A;  4NYZ A;  4MJW A;  2IFX A;  2MDA A;  3EX7 B;  3HT3 A;  4FKY A;  1H7W A;  3BV8 A;  1B0T A;  4EO6 A;  3IWL A;  4KV8 B;  2JEF A;  1LQ9 A;  2HQD A;  5ETK A;  5H9F J;  2AU0 A;  4ZVE A;  3T1H F;  4MFB B;  3ENA A;  4H4O A;  3FCV A;  3IAM 9;  4M1K A;  3ZZR A;  3ZXW A;  1K44 A;  4C11 A;  3LH2 S;  3QYY A;  4WTO B;  1VQL S;  4B3S J;  4I6A A;  4FF3 A;  4X4U A;  2ZE2 B;  3L9Z A;  3D1Q A;  5C5J A;  2Q79 A;  1HD0 A;  2W9C B;  3LO3 A;  4WE1 B;  3K0J A;  1S97 A;  3NGU A;  3KK3 A;  1IBC B;  5G4D A;  5K14 B;  2RF2 A;  1SKS A;  5CH7 B;  1S1U A;  5KFB A;  4PXE A;  2N4C A;  2XEX A;  1WOO A;  1UFL A;  2PGC A;  2V8V A;  3GJS B;  1DAX A;  3OLA A;  3NGR A;  1IBM J;  2B4P A;  3ZC4 A;  3EPG A;  5CZX A;  2DR9 A;  4FF1 A;  4LF9 F;  3KMQ A;  1CS4 A;  2YKO A;  4GVL A;  2NR0 A;  4U6P A;  1U2F A;  2VPX B;  4OYI A;  2CAJ A;  4G1I A;  4URG A;  1S6P A;  2DGQ A;  3LA0 A;  2UV8 G;  4LRC A;  4OZ3 A;  1L3V A;  4JI7 F;  4ZVS B;  5L39 A;  1FWK A;  1UET A;  4ZDN A;  1YBU A;  4CIO A;  4A8Y A;  2R7X A;  2MY8 A;  3RRG A;  5ETQ A;  3UCU P;  2A3J A;  2RQM A;  3EM1 A;  5ETP A;  1HWJ A;  2B5J B;  1O8B A;  2G0I A;  3A3P B;  1IKY A;  4DV1 F;  3BR9 A;  2IRY A;  4QOT A;  1OQ6 A;  1U09 A;  4FS1 A;  2WB1 D;  1XQI A;  2ERR A;  4YOE A;  2MQN A;  1NCL A;  2ZWP A;  3ONQ A;  4OHY A;  4QW9 A;  1WDT A;  4DU7 A;  3NGT A;  1VJW A;  2AIR B;  1R27 B;  1EZZ B;  2BM1 A;  1FNM A;  1MMN A;  1MML A;  1FDA A;  2XI2 A;  4NML A;  2YNH B;  2YWH A;  4PG5 A;  3AY0 A;  2JXI A;  5KG1 A;  2FVP A;  1Q16 B;  1WOS A;  3MM9 B;  4DR7 F;  3D6M B;  3HSZ A;  1UEK A;  4NLT A;  1FD8 A;  1PC4 A;  1X7V A;  2A2C A;  2DKO B;  3QRR A;  1RKJ A;  1SC6 A;  4LF6 J;  4DV1 J;  4MKA A;  1S1X B;  4U9R A;  3T19 A;  5B08 A;  1OY6 A;  3AOD A;  3EVM A;  3S7R A;  3SXL A;  4KR0 B;  4FBU A;  5K5M A;  3Q2T C;  2YQ1 A;  1RWM B;  2GA7 A;  3RB6 A;  2IYI A;  1D8Y A;  1HWK A;  2UU9 J;  4OYX A;  2JEG A;  4DSK A;  4DV0 J;  1YJR A;  1BD6 A;  1TL1 B;  1T9U A;  5F8I A;  4JI2 J;  2HHU A;  1P1T A;  1R6Y A;  2QFI A;  2HEK A;  2HNZ B;  2WVD A;  2DHA A;  3DYA A;  3HJV A;  4F4Z A;  5ETO A;  4UF4 A;  3DRX A;  2EFP A;  1I5O B;  3E01 A;  1RHQ B;  4X4Q A;  2E1M C;  1EKS A;  4XK8 C;  4GC6 A;  2L9W A;  4UY8 5;  3NNE A;  4XPE A;  3H90 A;  3HM9 A;  4O4G A;  3J81 Y;  4M8L A;  4OV6 A;  4ZS6 A;  2GQQ A;  4JV5 J;  4RUB A;  4FYD A;  1QAI A;  3UDL A;  2M9K A;  1HMV B;  5KFR A;  3HVR A;  2BJD A;  1HQE B;  4ZJQ A;  3UN5 A;  1FES A;  1RTH B;  2XYP B;  1S9G B;  4OJ3 A;  3SQO P;  2ATC B;  2JJ4 D;  3GFZ A;  2Z4P A;  4RW6 A;  2RUS A;  5A6P A;  4JI0 J;  4OHV A;  2X1B A;  2YKN A;  4CTA A;  5LSO A;  3ENQ A;  4RX6 A;  1E6V A;  3D66 A;  5J2P B;  4TU7 A;  4B9U A;  2XNR A;  3FBE A;  1BQX A;  1XMQ J;  4RW7 A;  5D0R A;  4X4R A;  3RB3 A;  2OPR A;  1R8B A;  2IY5 B;  2DO4 A;  2G1H A;  3A8I A;  2HWI A;  2OGU A;  1DQA A;  1WUU A;  2C3M A;  3TA0 A;  3FDS A;  2IJN A;  8ATC B;  5F8L A;  1TK5 A;  1TKZ A;  3BGR A;  3NNH A;  3SFG A;  4F4W A;  2GIF A;  3ITH B;  3Q23 A;  2R2R A;  1XBW A;  5ETL A;  1WEX A;  3AQP A;  3F0N A;  4OI1 A;  2GVD B;  2KOE A;  5L9X A;  1SCJ B;  3ZZO A;  1X4D A;  1ZPW X;  5IWA F;  3C16 A;  4DJB A;  2CPF A;  1U1L A;  5C2G A;  4OHZ A;  4J9N A;  1CUL A;  3KLF A;  3ZZZ A;  2JXG A;  3MI7 X;  3PM9 A;  4NLW A;  5FLX Y;  3MR6 A;  3IR6 B;  3NMR A;  2GNK A;  2OEM A;  3CJR A;  1QTM A;  1FNO A;  2UXD J;  4DX8 H;  2GZO A;  3KLG B;  4ILR A;  5F8M A;  3MR2 A;  1FX4 A;  1M5P C;  2IM1 A;  2YY3 A;  1HAR A;  2DRD A;  3EUN A;  1YJ9 S;  2DH8 A;  3IBW A;  3N28 A;  5E41 A;  1ELO A;  2AEM A;  3AH6 A;  4P10 A;  2DRA A;  2CJA A;  3GG1 A;  1NND A;  4DR5 J;  2QZ8 A;  3KLH A;  3M4X A;  2HNY A;  3CCV S;  1AXQ A;  2E5I A;  4PXD A;  3V5R A;  3V4M A;  2HVD A;  3TAP A;  1OG7 A;  3LAN A;  2MPU A;  4DR1 J;  1B0P A;  4NA3 A;  1F2G A;  1P9Q C;  1U02 A;  4KSE B;  3Q2S C;  1CJU B;  1HQU A;  3I9V 9;  5KFE A;  2HFV A;  3FCW A;  3NS6 A;  3EE3 A;  4KFB A;  2DNK A;  2QMU B;  1ARQ A;  3DLG A;  4PUO B;  1N5V A;  2KHD A;  1ZM2 A;  3RGI A;  3HX9 A;  3MD1 A;  4CNY A;  3KUG A;  2BE7 D;  4QWE A;  1OQ3 A;  4K4Y A;  2X3G A;  1XJW B;  4N8O A;  1HNZ J;  1OYE A;  3ILL A;  1TL7 B;  2BX6 A;  1YWX A;  2D74 B;  2GHP A;  5J2N A;  1NJX A;  2DRB A;  3B8H A;  1K0V A;  3TA1 A;  2H51 B;  4B3M J;  2E5J A;  2X1G A;  3BR8 A;  2JEJ A;  4F4K A;  1TFW A;  5DZ6 A;  2QL9 B;  2CQ4 A;  1FEE A;  2DNL A;  2MKK A;  2J8S A;  2W25 A;  1JLC A;  3GTY X;  3MEG B;  2CG4 A;  2W2N P;  2IVF B;  2MKY A;  2OH2 A;  4X62 F;  4A8S A;  2XMJ A;  4DV4 J;  3C8Y A;  3KK2 A;  3T3F A;  2L9N A;  2DY9 A;  4NMX A;  1FKP A;  3R97 A;  3ET6 B;  4KAI A;  5C42 B;  4PYD A;  2E7W A;  3VEA A;  3CCL S;  2VIC A;  4ECV A;  2A18 A;  2GHV C;  4CH0 S;  4B3T F;  3EXY A;  1IR1 A;  5F0W A;  1K47 A;  4I0W A;  2HZC A;  2MJN A;  3LAL A;  5CYJ A;  3T9N A;  2XS7 A;  1KN6 A;  4ED0 A;  2NUH A;  3TZW A;  1JMT A;  2VAS A;  1U1K A;  2OPS A;  3D6F B;  1F9H A;  5D4O A;  3MTK A;  5AE2 A;  4O3Q A;  4LVN P;  3BBF A;  1XMB A;  1RWU A;  1ZBT A;  2QSW A;  1N36 J;  3OTC A;  2XLJ A;  3AFG A;  4DV0 F;  3UCG A;  4NPO A;  4NCA A;  4UY8 T;  2BE9 B;  4C0O C;  1FE4 A;  3T1A A;  1P8G A;  3UW1 A;  2XHC A;  1YJT A;  4I1T A;  1QE1 B;  2RNE A;  1VBX A;  1VC5 A;  2CJK A;  2DR8 A;  3KDN A;  3LWM A;  2JL9 A;  1RWX B;  2C2K B;  2JZ5 A;  2FJD B;  4KO0 A;  1BWE A;  3TZX A;  3BDE A;  2IC3 B;  5KFT A;  1OMS A;  3ISN D;  4NRT A;  1U0H B;  4M5N A;  3GON A;  2IHR 1;  3FQL A;  1F3V A;  2ZZT A;  3EZU A;  3JSY A;  4RBU A;  5HAO A;  2XM3 A;  4UW2 A;  3BM7 A;  2B9W A;  4WJB A;  3C2P A;  3A13 A;  3AJ2 A;  4AYB D;  4Y65 A;  1VQO S;  4HYK A;  4B9V A;  2HFO A;  3KDO A;  1X0F A;  1P6T A;  3FBF A;  1NJW A;  4J5O A;  3OL7 A;  5L1I A;  4EMD A;  2R7R A;  5GAD U;  4O3S A;  1WTF A;  1BE4 A;  3DOM A;  5DDQ C;  4IG0 B;  4HAC A;  2EW9 A;  1FRI A;  2Y8Y A;  1SXL A;  2J76 E;  3M8P B;  1BMQ B;  4PAB A;  1LWF B;  1MRO B;  5DO2 A;  4FBT A;  3J7A N;  4TU8 A;  4HT7 A;  1BQM B;  4EGL A;  1PAE X;  1X4B A;  2M5Y A;  1VYA A;  2ZDP A;  4KKO A;  3EGZ A;  1U45 A;  2YH0 A;  3CXC R;  5ETV A;  2CJY B;  3ZTQ A;  4F3O A;  2PEB A;  1GX5 A;  2R3V A;  3C14 B;  1HBO A;  4DMZ A;  1PBA A;  5DGA A;  1NK7 A;  4DV7 F;  4W90 B;  1HFE L;  2DY1 A;  1Q8I A;  3M2V A;  2YWW A;  3VGS A;  4ZMM A;  3CVK A;  3EMT A;  3FEZ A;  4H4M B;  7AT1 B;  1FWL A;  3C6T B;  5LMU J;  1H2T Z;  3G4S S;  5B0G A;  1NHK L;  4GVB A;  4LF4 J;  1UVJ A;  3QWU A;  1Q8K A;  2AT1 B;  5F3Z A;  1E6Y B;  2WSC C;  3BB5 A;  1HNX J;  1GX6 A;  2RRN A;  1SB6 A;  5KFL A;  3OSN A;  1REV B;  3LP0 A;  2IA6 A;  2KFZ A;  1CPZ A;  2AJ2 A;  4DUZ F;  4A8K A;  3CCZ A;  1HBO B;  1LWX A;  3CJQ A;  4LRD A;  4LRA A;  3J7Y I;  4KPC A;  2HHS A;  2DGX A;  4MIB A;  3L95 X;  4OZ0 A;  1H3D A;  4WK1 A;  4P2F A;  2DO0 A;  1HQ2 A;  4ZPV R;  2HW3 A;  4WU2 A;  2OLW A;  3MMC A;  1GMU A;  3CJT A;  2NLW A;  4B3R F;  4A8X A;  2R42 A;  1IKW A;  1KVI A;  3A8K A;  4H4K C;  3JSM B;  2UUC J;  1AZS A;  1YQH A;  1Y7P A;  3WDO A;  1XNR J;  1WKK A;  1WDD A;  2DGV A;  3Q8U A;  4ANC A;  3R2C J;  1F0X A;  2OMO A;  5IC6 B;  4IG3 B;  3NRB A;  1RT7 A;  3T1H J;  2DXD A;  2BSQ E;  2V4J B;  2Z0G A;  3IG1 A;  5ADZ A;  1IXK A;  5DG8 A;  2HIQ A;  4B3S F;  2VOD A;  1TKT A;  1SBR A;  1WF0 A;  3LP2 A;  2HLT A;  1T9X A;  4ZCI A;  5D0G A;  5IC4 B;  3BSN A;  2IDL A;  5KG7 A;  4O44 B;  2RML A;  3CO0 P;  5KFD A;  1DAR A;  3OUY B;  3QGI A;  1QUP A;  1Q1K A;  2GJ2 A;  2Z58 B;  3W5X A;  4DN0 A;  1U6Z A;  4WP3 A;  3QAT A;  4F04 B;  3OSP A;  1ZH5 A;  4I64 A;  2G9O A;  4DV2 F;  4OZ2 A;  3UNY A;  1BDV A;  3CJK A;  4CDI A;  4K4X A;  3EJM A;  3K8W A;  2F8M A;  3NGD A;  1SJ3 P;  1NHV A;  2V63 A;  1R0C B;  4WTY A;  5IS2 A;  4WK3 A;  2MYF A;  2HHT A;  1DTT A;  5B0C A;  3TVY A;  3TA2 A;  1C0T A;  2ZWO A;  5HK4 A;  4UUW A;  2VBY A;  3M2U B;  2N3L A;  3BKU A;  2E1C A;  4OX9 J;  4MKV A;  3NS5 A;  5ETR A;  3QJL A;  3I6P A;  2J7U A;  2P5V A;  4NLP A;  5F8G A;  4CO2 A;  1X0P A;  2WVB A;  2CPG A;  2HZA A;  3MXH P;  3JXO A;  5A2Q U;  1VHI A;  1L5U A;  4BC7 A;  1NB2 A;  3CPW R;  4HI1 A;  4LSZ B;  4UZC A;  2E5L F;  5JJB A;  3Q8S B;  4I7F A;  2MZT A;  4TVA B;  5A0Y A;  3TAN A;  1SJF A;  1VQS A;  1XIQ A;  3WZ0 A;  3V81 B;  4HDG A;  3BDP A;  4MH8 A;  2QYC A;  2RUG A;  4HHH A;  1URN A;  2B9Y A;  4J9P A;  3UO0 A;  4F4Y A;  1WHV A;  2Q6B A;  2GW8 A;  5A8W B;  4LF7 F;  4CO1 A;  3H5U A;  2L41 A;  1U1P A;  3HPO A;  2JVR A;  2W9B B;  3R3T A;  1TL7 A;  2V2Z A;  1FK9 B;  4DOZ A;  3IRW P;  2YX4 A;  1C1C B;  1MNT A;  2C2O B;  2Z8Q A;  4RW8 A;  5E2Q A;  4C3K A;  4LF8 F;  2UXC F;  3IR7 A;  5GAG U;  3KOA A;  1Q5V A;  2CWX A;  2R2T A;  3I31 A;  3UNG C;  3TI0 A;  3PZP A;  4DL2 A;  2D41 A;  2FVC A;  1EP4 A;  5KFQ A;  3I56 S;  2BW7 A;  1KQG B;  2DIS A;  2OP5 A;  3G6X A;  1X4F A;  4AAI A;  1XEZ A;  1ZPV A;  2NCK L;  4CLP A;  4YB1 P;  1PIE A;  4ED6 A;  4U7U D;  3AB2 B;  2CWK A;  1KQK A;  3OL8 A;  3GYX B;  3UE2 A;  4FVC A;  3SCL E;  2CNN B;  2BYC A;  3HMJ G;  2MJU A;  4FNH A;  1VRT A;  2QRR A;  1Y4Z B;  3HZG A;  3N5F A;  2XWX A;  4J9L A;  2WTF A;  2BE2 B;  2OPQ B;  3AXM A;  2F9D A;  1S0N A;  2EVZ A;  4V1A k;  4Q7A A;  4YEA A;  4NYO A;  4D8J A;  3F44 A;  3SFU A;  3I5B A;  2HVE A;  2P9E A;  2K5J A;  2ZH5 A;  4FF2 A;  1KTQ A;  2UUA F;  5B0E A;  2JLE A;  2CVE A;  4GKK J;  2J8A A;  2UUB J;  3F56 A;  4ZOS A;  1DY3 A;  3R9L A;  3H5Y A;  1TKX B;  4K5R A;  3TAM B;  4NCB A;  2VOO A;  1S5Z A;  3NMA A;  2VBW A;  4OV1 A;  4ZVP B;  3OD2 A;  2HHP A;  4KGZ B;  2WON B;  4Y34 A;  1M1G A;  2R7T A;  1J2V A;  1R31 A;  2WHO A;  1DTQ B;  4A8W A;  1FRJ A;  1HA1 A;  1RTJ A;  4G1Q B;  2AGP A;  4DR3 F;  1HNW J;  3FC9 A;  3R5A A;  2AYG A;  1NLA A;  1PO6 A;  1A9N B;  2CZ4 A;  1XN9 A;  2RDJ A;  4EYI B;  1IUJ A;  2KRB A;  2EG2 A;  2GVD A;  3IR5 B;  4QIE A;  3TO8 A;  2XO6 A;  4OYA A;  5BXI A;  4LF6 F;  2UUA J;  4CLL A;  3E3X A;  1SIW B;  4M5H A;  3K58 A;  4DCJ B;  2UXB J;  1VGY A;  4NLV A;  5CQG A;  4ZVH A;  2XSJ A;  3VAJ A;  4FZV A;  2ADL A;  1FTR A;  1XER A;  3LP1 B;  5MAO A;  1ZYQ A;  4B9S A;  1CJK B;  2BXJ A;  1RT5 B;  3FUY A;  4RNF A;  5C2C A;  5C7P A;  5GMK a;  3OVA A;  3RAM A;  1HYS A;  3MMJ A;  4UST A;  4D3G A;  2MZ1 A;  2XZD B;  2DGW A;  1RTH A;  2OEJ A;  4DLG A;  3MED B;  2O3D A;  2WOM B;  3DU6 A;  4HH0 A;  1K73 T;  3ZNJ 1;  3M8Z A;  4O3O A;  5GAD I;  2G4B A;  4Y00 A;  2AF6 A;  1MSW D;  3B6B A;  1D9D A;  4HI2 A;  2R7V A;  4DFK A;  1TKD A;  2XY6 A;  1RHK B;  1JKH A;  2PT0 A;  2CQC A;  2E44 A;  2RIL A;  2BV3 A;  3RTV A;  2X51 A;  3JAM Y;  4I69 A;  3OFE A;  4TY9 A;  2O66 A;  1J5E F;  1DRZ A;  1D0E A;  2B4V A;  3UPF A;  3MED A;  2HIY A;  2OEK A;  4ILL A;  2CQB A;  2HWT A;  2VUG A;  3MPU B;  4J9Q A;  4J9M A;  4ETZ A;  1UMJ A;  1R7I A;  3DYA B;  2AJQ A;  4C97 A;  2W4D A;  1APS A;  3KHH A;  2XLK A;  4JI3 F;  4RU2 A;  4X65 F;  2AZ1 A;  4OLO A;  2MEW A;  3ZTR A;  3W62 A;  1CVJ A;  4ZHR B;  3QBC A;  4DFM A;  3S8S A;  3CJ0 A;  3PO5 A;  2BOP A;  1JJH A;  1JLE A;  1FJG J;  2BMB A;  2FGO A;  4R8U B;  2K2P A;  3NGS A;  3R6L B;  2LQB A;  4BWJ A;  4RW9 A;  2RHQ B;  4IDK B;  4YY3 J;  3FBB A;  3V6K A;  3NS7 B;  1RT4 B;  1LV5 A;  1VQN S;  3PV8 A;  5H9F K;  1X4A A;  1CBK A;  1Y10 A;  4J9O A;  2R2U A;  1U8W A;  3K5O A;  2GVZ A;  2WB4 A;  2GS8 A;  3H2U B;  3KG4 A;  3MM5 A;  1RTI A;  4ZPC A;  4DPW A;  1ZTT A;  3AD7 C;  3PVX A;  4DF8 A;  2V6A A;  1RTZ A;  1KRP A;  3OW2 R;  4DV4 F;  2LDI A;  1NME B;  2LU1 A;  2KO1 A;  4OYM A;  2AJF E;  4L72 B;  5ETT A;  4AUK A;  4F26 A;  4F0M A;  2DH9 A;  5B0B A;  2V69 A;  1HYS B;  3BEG B;  3EDR B;  2MQQ A;  4FF4 A;  1RKI A;  3IN5 A;  3W7B A;  4I6Y A;  2HVI A;  1IKY B;  2ZNZ A;  5IT0 A;  3VAF A;  2B5J A;  2ZVI A;  5E3P A;  2DK2 A;  4DCP B;  2FD2 A;  4ID8 A;  1DBD A;  4IQM A;  2QLX A;  2LEB A;  2RAQ A;  1NK5 A;  1JLG B;  1VK8 A;  1UWB A;  2XMV A;  1N54 B;  3D0I E;  3QFW A;  3QNW B;  1WJ9 A;  1PCA A;  4L74 A;  4YB7 A;  3CJ5 A;  3UI3 A;  5IT9 U;  3NP5 A;  1H7X A;  1NO8 A;  2D7S A;  5LSL A;  4IH6 A;  1S6Q A;  1EP4 B;  2WVE A;  2NYI A;  4XDD A;  1HBM A;  4I2P B;  3HJF A;  3G2X A;  2HGN A;  2EK6 A;  2ROP A;  3H5S A;  4P73 A;  4LQ9 A;  4TNO A;  2KM8 C;  3JYT B;  2DT9 A;  3OTE A;  2BOA A;  1RTD B;  5D3G A;  1YJN S;  5F8N A;  2LMI A;  4NLU A;  4X66 J;  3UVJ A;  2EC0 A;  1FJC A;  1KHV A;  2YWF A;  3RJM B;  2PSZ A;  1VC0 A;  5KFC A;  2AJ0 A;  1VQ4 S;  1QY7 A;  2OIH A;  2CUY A;  5E5N A;  2DCL A;  5I3Q A;  3BJY A;  1RP5 A;  1WHX A;  3BQ0 A;  1F2H A;  2ZE2 A;  3N4W A;  2AGO A;  3T9Z A;  2HSE B;  2YWK A;  5KG4 A;  2BE2 A;  3PR5 B;  2L3M A;  3PXG a;  2KTQ A;  4MFB A;  4DPY A;  2QMX A;  2YWG A;  4DV3 J;  4M5I A;  1X5S A;  1PJ5 A;  3C6U B;  2V8G A;  4K59 A;  4I6W A;  5KT3 A;  1L3U A;  1HW8 A;  3KJN B;  1JXV A;  2ILY A;  2C42 A;  2AY0 A;  1V3S A;  2BAN A;  2BVZ A;  2DNP A;  3CIM A;  5HAT A;  3KLE A;  2F1F A;  4KGX B;  2UVV A;  2ZBQ A;  4KHP F;  1LW2 A;  2Q43 A;  3ISZ A;  1D9F A;  4LF5 J;  2HRT A;  1N6Q A;  1C0U B;  4LQ3 A;  1RZM A;  2HHX A;  1SH2 A;  3CCR S;  3AXK A;  3BSO A;  2UV8 A;  3BKF A;  5J2Q A;  1FFG B;  1ICE B;  2FYX A;  4FPR A;  1WEY A;  2HND B;  2HG4 A;  4OZJ A;  4LRV A;  4TYA A;  4DG1 A;  3PKY A;  3HKZ D;  3KYL A;  2AJ1 A;  2KXF A;  1OJ4 A;  2K1R B;  2QO3 A;  4GO7 X;  4LFA J;  3CDU A;  2VFR A;  4X84 A;  2NS1 B;  3AHP A;  2KHC A;  5CYM B;  5EWF A;  4RKU C;  1S10 A;  3MFH A;  1M90 T;  2EK1 A;  4GKJ J;  3H4B A;  1R3N A;  4RNH A;  3CJK B;  2P2C B;  4FYV B;  2OFH X;  5DG9 A;  2W7P A;  2FHK A;  3QGG A;  1YBT A;  3SV3 A;  5A0Y B;  1U4B A;  2KRR A;  4IFV A;  4USJ C;  4OZN A;  4UOF A;  3T1Y J;  2AN7 A;  1Y3K A;  3LTO A;  4LSN B;  3WX8 A;  2IMW P;  1LK5 A;  1CG2 A;  2IYG A;  3D6H B;  3JQK A;  1MYK A;  1B28 A;  1ULR A;  5MLC V;  2IM3 A;  3V6D A;  1D1U A;  4OI0 A;  2BKN A;  3JTO A;  3SCJ E;  1I1G A;  3UR3 C;  5HN0 A;  2RS2 A;  5CAB A;  3HP6 A;  1Z4U A;  2KL8 A;  1VC6 A;  4NXM F;  2W7O A;  3JQJ A;  2WVC A;  3HLU A;  1NK4 A;  3OVB A;  1RT7 B;  5K8N A;  2Z2M A;  1IQZ A;  1NPK A;  2MKC A;  5KTQ A;  2AKW B;  1YIJ S;  2DPJ A;  2ADC A;  1Q8L A;  2KT3 A;  5D4N A;  2ZH2 A;  3EXC X;  1T02 A;  4M5L A;  2E1A A;  2GIR A;  4CLF A;  3PAC A;  4PYA A;  1VK3 A;  3KUH A;  2HQC A;  1QVF R;  2MQM A;  2PI4 A;  1U24 A;  3MAA A;  5KFA A;  3IS9 A;  1WG5 A;  4CO0 A;  2NPI A;  2FJX A;  3IC1 A;  2KXH A;  3CJS A;  4ZLL A;  3DDK A;  2HWH A;  3V81 A;  3MEC A;  3L7P A;  3DNC A;  1WNE A;  3HHN B;  4DR6 F;  5KFV A;  1NSK L;  2CAD A;  3GFH A;  1UZH A;  1RLC L;  1TP7 A;  3MM6 B;  4OHW A;  1LWC A;  2CPE A;  2V67 A;  3DRY A;  2I38 A;  2RQK A;  4HDH A;  4ZVQ B;  4CT8 A;  3DMJ A;  4E98 A;  1DLO A;  1WTB A;  5GME A;  3S6E A;  3TYT A;  2LKZ A;  1REV A;  3D3B J;  4DSE A;  2ZZM A;  1TV6 B;  4ZIW A;  2VA3 A;  5SZT A;  1KFD A;  1R89 A;  1REG X;  2KYZ A;  3FSX A;  2KFY A;  1X9W A;  4V19 J;  1UVK A;  2V0N A;  4CI0 B;  5B0D A;  3C15 A;  4RNN A;  3QIP A;  2VZ9 A;  2H65 B;  1YLX A;  2EKN A;  2LQ9 A;  3M8Q A;  4MIW A;  5BYQ A;  4DU8 A;  1RWK B;  4ECQ A;  4WCE Q;  2PI5 A;  3OTO J;  1Q86 T;  2BJ8 A;  2QFJ A;  3V6J A;  3R1L A;  1AZS B;  1V3R A;  3CE8 A;  5BJR A;  4RR5 A;  2HRU A;  2MZR A;  3C14 A;  2DVI A;  4HTI A;  2Y1I A;  5AE1 A;  3FJ2 A;  4QW8 A;  3DN9 A;  4LRF A;  1IBL J;  4DR2 J;  2A10 A;  1XK8 A;  4DCO B;  2YNF B;  4O0N A;  2MLZ A;  3WC2 A;  3NNA A;  3GIM A;  1ARR A;  4ZIV A;  1BLU A;  3NAH A;  2J0X A;  4LR8 A;  2RT3 A;  2LA4 A;  4TY8 B;  3U27 A;  3GII A;  1CJV B;  3GV5 B;  3CMA S;  1E6Y A;  4PPZ A;  3PRD A;  2BRK A;  2DHX A;  3SSS A;  3RR8 A;  2RS8 A;  4ENO A;  4DL0 C;  1HWU A;  3I82 A;  4DPT A;  4MK9 A;  2DHS A;  3WIV A;  1KON A;  4R5P B;  5C25 B;  4LSL B;  2D1C A;  4WF9 Q;  3QJJ A;  4GKK F;  2FGC A;  2RDI A;  3BYR A;  1JK9 B;  3QPI A;  2RBF A;  1RHU B;  2HHH F;  3BZQ A;  3J81 U;  1LWC B;  2C2R A;  1M5H A;  5KFP A;  1RB0 A;  4QU6 A;  2C28 A;  3BBB A;  1SL0 A;  1JB0 C;  4JI1 J;  1QTN B;  3JSB A;  4A8M P;  3MEC B;  3WC0 A;  3G86 A;  5HO4 A;  3G71 S;  4J9K A;  2Y9H A;  5CZV A;  2ZH7 A;  4OL8 A;  4JYA J;  3O1L A;  1BQM A;  2R8J A;  2YH1 A;  4N41 A;  1GQE A;  4DR2 F;  2CJX B;  1N0V C;  1VBK A;  4LBI A;  4CLW A;  4XPC A;  2QLF B;  4IQX A;  3LQV A;  3MEK A;  2ZFH A;  3OPK A;  2N7Y A;  4PG4 A;  1PJ7 A;  1U2R A;  1UW4 A;  3C3L A;  3X3U A;  4TLR A;  3R7B B;  3TNV A;  1S9E A;  2I1R A;  4XO0 A;  2V4R A;  1ZTW A;  1YRX A;  1S79 A;  3AA8 A;  3MWB A;  3CJ2 A;  4J9R A;  1WOR A;  3RBZ A;  5L38 A;  1TZ0 A;  3VHQ A;  2FLO A;  4QIG A;  1KP6 A;  2DNM A;  2W2M P;  1VBZ A;  2V8P A;  1JWW A;  2D3Z A;  3ULH A;  1RBL A;  1SKU B;  1QD1 A;  2WAQ D;  3O44 A;  5HL7 Q;  5JXS A;  2PMW A;  3NOG A;  4QIW D;  2W8K A;  3QLH B;  3VAH A;  1HHS A;  2IJF A;  2XMW A;  4ECY A;  3IM8 A;  5IM0 A;  4Y0F A;  3KUE A;  3JAM U;  3NWG A;  1XMQ F;  2V34 A;  5K20 B;  1G3O A;  3QSI A;  3ETO A;  3LGN A;  4JYA F;  2HPU A;  4WWS A;  4YR0 A;  2F9J A;  4USH A;  3I9Z A;  3KG1 A;  3V2U C;  4IYQ A;  4CRJ A;  3W61 A;  2NSB A;  5J2N B;  1PYO B;  4F8R A;  1AUS L;  3DLK B;  2EFO A;  3DRR A;  4KHM A;  3KTQ A;  3TEG A;  5IQ6 A;  2EFN A;  3DRP B;  4RNO A;  1LXJ A;  4E2F B;  3RYL A;  1C0U A;  3G8T A;  1N6Q B;  2UU9 F;  4TKT A;  2KJV A;  4UQT A;  1AFI A;  4OX8 A;  2HFN A;  3TVK A;  4Y2C A;  5DDP C;  5KFM A;  3MOZ A;  1BGX T;  2B4O A;  1UVL A;  3D1H A;  2CYY A;  3G6E S;  2C2D A;  1HR0 F;  3EYZ A;  3BBC A;  4Q5V A;  3PRV A;  3GYN A;  2OI2 A;  1U49 A;  3HO1 A;  4Y3C A;  4OJG A;  1A7G E;  1EQM A;  2WBR A;  1U0S A;  2GHW A;  4AQY F;  3W2V A;  4O3R A;  1GXT A;  1VS3 A;  3GWC A;  3UN3 A;  2AGQ A;  2K9I A;  5M2R A;  5AXM A;  5KT7 A;  2CQP A;  4Q0B A;  4JV0 A;  5D4L A;  5M2U A;  4IKA A;  5DQI A;  2XZT B;  2VC0 A;  3KLG A;  2J0S D;  1S6U A;  2VQE F;  2FJB B;  1BC6 A;  5LSR A;  1IM4 A;  3M6U A;  5HLF B;  1V9O A;  3GE9 A;  5I3U B;  2ILZ A;  2HKE A;  2JC0 A;  2WW8 A;  2WSF C;  4KGM A;  4OLP A;  1XMO J;  3UFC X;  4C0H A;  1YSJ A;  2CQH A;  2XBP A;  1FXD A;  3K7R A;  3HSD A;  1PJ6 A;  4DPO A;  1B7Y B;  1P1L A;  3IXQ A;  2FHJ D;  2VQF J;  2EPI A;  3ITH A;  2W4C A;  2PMZ D;  2NZC A;  2RVJ A;  2WBM A;  4X4S A;  2HQ3 A;  2VKZ G;  2R2S A;  3UR0 A;  2KDO A;  4DDF A;  1S1V B;  3U1L A;  3DGP A;  3O6Q A;  4KQZ A;  3D5M A;  2ZHB A;  1GMW D;  3ISN C;  4CLS A;  4CM0 A;  1UA1 A;  4XIU A;  4HKQ A;  4WZM A;  4P75 A;  1RAD B;  2HZV A;  3OJU A;  1NLK L;  3OJS A;  2QL5 B;  4KBI A;  2H4W B;  4ZP8 A;  4EO8 A;  4V19 X;  1Q79 A;  4ER8 A;  2YXL A;  1Q81 T;  1NZA A;  2CJB A;  1D3W A;  4KHP J;  2W24 A;  3ILI A;  4LFB F;  4CZC A;  3H87 C;  1IBM F;  1IBK J;  2X7I A;  3OQ2 A;  1Q0N A;  4PPD A;  3TAQ A;  2DYA A;  4NLD A;  1S0V A;  1T95 A;  1ZAV A;  3QO9 B;  3W9H A;  3FFI A;  4C8N A;  5HI7 A;  1YZ6 A;  4URQ U;  4C98 A;  1FRX A;  2FUG 9;  2C3P A;  2OPP A;  3PHE A;  3ZZP A;  3CC2 S;  1CEZ A;  2AYM A;  2ZBI A;  3BO3 A;  1KLM B;  3JSR A;  1TKZ B;  3BO4 A;  2NSC A;  3E01 B;  3H2L A;  1F6T A;  4RW9 B;  1VHF A;  4U96 A;  4C3M A;  2AX0 A;  3BGU A;  4R8U A;  1KOH A;  2PFD A;  4X4O A;  1UA0 A;  1Z2L A;  3NG8 A;  4CLU A;  1FX2 A;  3BKT A;  1TK8 A;  2BNZ A;  5FDL A;  2VON A;  4P2S A;  4MMO A;  1KNZ A;  1PC5 A;  4OX6 A;  3A1Y G;  1NB7 A;  2LCW A;  2O01 C;  2W2O P;  4LJM A;  2XLI A;  4NAS A;  1JLF B;  1HQE A;  3A8E A;  5FD1 A;  2UUW A;  1HMV A;  4NLG A;  4R0J A;  1FNX H;  1M5V C;  4OHX A;  5K8O A;  3C19 A;  1OYD A;  3K89 A;  2M7S A;  1U8S A;  4PAA A;  1Q16 A;  3H42 A;  2KXN B;  1VRU B;  1WKJ A;  4W4M A;  2KB2 A;  2ZH4 A;  1M5K C;  2MZQ A;  5EX0 A;  1JLF A;  3ILO A;  4CO4 A;  4B9N A;  3D6T B;  5HMX A;  2DPI A;  1GT8 A;  1T9W A;  1ACM B;  4WII A;  1L3T A;  2HNZ A;  1JJ2 R;  3G9C A;  1FRH A;  1UL3 A;  1OSC A;  2PA3 A;  2BM0 A;  2E7V A;  2EEY A;  2F8H A;  1TL1 A;  1RDR A;  1T3O A;  1RT5 A;  2W2Q P;  5IV4 A;  2FDN A;  4FDF A;  3LW5 C;  2MHN A;  5KFY A;  5HJY A;  1H2U X;  2KKH A;  3CO9 A;  4CYU A;  1GK8 A;  1SV5 A;  3M30 B;  4USU A;  4B3R J;  2QT7 A;  3HF5 A;  1C1B A;  5HRO A;  1NSP A;  1S99 A;  1WC6 A;  1NH8 A;  2FY8 A;  4L75 A;  2MY7 A;  4YY3 F;  3T6B A;  4B9L A;  3M1V A;  2YWE A;  3U1N A;  3FFI B;  2HMI B;  2EWH A;  1WC0 A;  1WWH A;  1NK8 A;  3J80 U;  3MM9 A;  4ZLP A;  2HHH J;  1N5S A;  4G3I A;  2A6O A;  4RL1 A;  3MEE A;  2QEX S;  2KJW A;  3DOL B;  4ZVR B;  2UZA A;  2M3D A;  1LWE A;  3DLL Q;  4B3O B;  3DLB A;  2F3J A;  4ID5 A;  3UDE A;  4KTQ A;  1IVZ A;  3TR5 A;  3PYD A;  4NOH A;  2GCF A;  3EIC A;  5ETS A;  5KFZ A;  2BJE A;  4Y28 C;  4BHQ A;  1AW0 A;  2QG9 B;  4KE5 A;  2HBZ B;  2A2D A;  2W1B A;  1S1V A;  2MZS A;  2YQ3 A;  2K3I A;  1AYE A;  1K8A T;  3MD3 A;  4IOC Q;  2MST A;  3NLC A;  3RZA A;  1R6V A;  2OPQ A;  4H4O B;  1FDB A;  3VEB A;  4NRU A;  2ZOF A;  1WF2 A;  3G87 A;  4F36 A;  4F2S A;  3L7U A;  4U67 Q;  2MHE A;  4HR2 A;  3FVY A;  1SUQ B;  1XR6 A;  1FKA F;  2D3O 1;  3MUM P;  4PR6 A;  1T05 B;  3OL9 A;  1RT6 B;  1NPR A;  1GXU A;  3DCA A;  2J6T A;  4ALZ A;  3TVZ A;  2CPD A;  5E0O A;  2VIH A;  4C8O A;  3PX6 A;  1SC1 B;  2ASJ A;  1TMM A;  2C3Y A;  3LF0 A;  3P4U B;  3O8W A;  4CH1 A;  1S1U B;  1YKW A;  1ZAX A;  2MKJ A;  2OD4 A;  2RF2 B;  1JLB B;  1CC8 A;  2HLU A;  4NLS A;  4OI3 A;  2IJR A;  2BAB A;  2CVI A;  4AT1 B;  1T3N A;  4IH5 A;  3CW2 C;  4NZ6 A;  2J9E A;  1NZ8 A;  3W2V B;  4RJV A;  2W2P P;  4P72 A;  4GO5 X;  2EC2 A;  2BJ3 A;  1NDP A;  3KJV B;  2YX1 A;  3CME S;  4K4U A;  3K8V A;  4C11 B;  5AXN A;  2GJF A;  4LF4 F;  2ASY A;  5DLG A;  2LXF A;  7FDR A;  4KV8 A;  1GMW A;  2QSF A;  1PAU B;  3VVT A;  1VQY A;  4RUC A;  2HBY B;  3EWG A;  4BC9 A;  1KQS R;  3PW0 A;  1EQ0 A;  1FD2 A;  4JBC A;  1S57 A;  1HBU A;  5DRK A;  1U25 A;  3HVW A;  1EAR A;  3M2R B;  3TX8 A;  2Z30 B;  4C3L A;  4CWB A;  4WU3 A;  4NXN F;  1H73 A;  1TAU A;  3A12 A;  1MN7 A;  2P8I A;  3W5Z A;  3PW2 A;  5DDR C;  4PRF A;  4FVM A;  4QU7 A;  4YQW A;  2HBR B;  1R8C A;  2K06 A;  2ZIT A;  3AB4 B;  2L48 A;  3RBD A;  2LA6 A;  1Z2Z A;  3K17 A;  4G6V B;  5EHH A;  3MPW A;  1QVG R;  5LJ3 Y;  2ROE A;  2C1E B;  2GO9 A;  1LFP A;  1SC3 B;  1FA0 A;  2EBG A;  3AQO A;  2MGZ B;  3RB4 A;  2C3U A;  2CRL A;  3E2E A;  1MU2 A;  1H0H B;  1P27 B;  4M63 A;  4A46 A;  5KT4 A;  1NKE A;  1N33 F;  3M8Y A;  4ZN3 A;  1LOU A;  2BJ7 A;  2ZKU A;  2HMI A;  2HS3 A;  4PXC A;  4AXI A;  4LF8 J;  1XNQ F;  2NPF A;  1HIY A;  3OUY A;  2LXU A;  1C1B B;  1RI7 A;  3IM9 A;  2AMC B;  3QWP A;  2APO A;  4ZK7 M;  5HRO B;  3QID A;  3KHG A;  3FMB A;  3KHL A;  1JLQ B;  1RWW B;  4ECU A;  1S72 S;  5HP1 A;  2HS0 A;  2E9R X;  2RB7 A;  3PKM A;  3QRP A;  1AFJ A;  3FKB A;  3I0S B;  3IBF B;  2D9P A;  1QSL A;  3AD9 C;  4NZ7 A;  1UEU A;  3KXD A;  1FKO A;  4U8Y A;  2KG1 A;  5DDO C;  1HBN B;  1M5O C;  4H4K A;  3OHA A;  1QDU B;  4F4A A;  1S7I A;  2YKA A;  5A6W A;  1N56 A;  1O0P A;  1Y00 A;  3NEK A;  3GIR A;  2GML A;  3N0V A;  3VWS A;  3W9J A;  3CJ3 A;  3JSM A;  1VLO A;  1GTH A;  3D2W A;  2ZJR Q;  5DM7 Q;  1IKW B;  2P6T A;  5FII A;  2MKI A;  1NKB A;  2AYB A;  3WBZ A;  2J9C A;  3KWM A;  3H2V E;  1NJZ A;  3AAW B;  3R5B A;  3I4H X;  1UJ6 A;  5J1E B;  4CO5 A;  3BQ2 A;  2QA4 G;  4ZPD A;  4DL4 A;  4JOU A;  5BYS A;  1FJG F;  2XMK A;  4MJK A;  3MPY A;  3A3N B;  2IVM A;  5HMW A;  3LP0 B;  1N32 J;  3UD3 P;  2HFU A;  2NZ4 A;  2Y0B B;  2FZK B;  2XWY A;  2V2K A;  4RWW A;  1MWY A;  2OSR A;  5KFS A;  2Z57 B;  1TQL A;  3LGH A;  3DM2 A;  4QR2 A;  5HMY A;  5K8M A;  3R2D J;  3QGP A;  1S0M A;  2KZZ A;  2M2B A;  1RU1 A;  1FXL A;  3ZO7 A;  3RB0 A;  4B3M F;  1RGV A;  1YJU A;  3ICL A;  3H4D A;  1HNI A;  1X8D A;  5D78 A;  5JVG Q;  1EHW A;  3KG0 A;  4C8K A;  3VF0 B;  1BUX A;  3OT9 A;  3QRQ A;  5LL6 d;  1KLM A;  1TU0 B;  1JQG A;  2PA8 D;  4NE9 C;  4NEZ A;  4DZD A;  3OFH A;  2RH3 A;  4QWA A;  3UDV A;  5KFU A;  5J1P A;  3TEH B;  2HVH A;  4HH1 A;  2GMH A;  1IRQ A;  4RWX A;  3JTN A;  4N77 A;  1KWM A;  2ZKT A;  4YME A;  5A8K A;  2HK3 A;  3DLE A;  4W98 A;  3CNQ P;  3GJT B;  5AXL A;  1TVR B;  4NCG A;  2VH7 A;  4A4J A;  1KVJ A;  1XR7 A;  2HAI A;  5J2M B;  3B4M A;  2VL1 A;  3IGV A;  1IBK F;  5HQM A;  5ETN A;  1NDL A;  4J9V A;  5G0R A;  4LIR A;  3OR2 B;  1SJQ A;  3VCD A;  2CXE A;  2J0W A;  3QSY B;  3MUV P;  2EFG A;  2ZHA A;  3MM7 A;  1F5A A;  5HBM A;  1Q4R A;  1T0T V;  1U26 A;  5CA5 A;  5EWE A;  3DGP B;  3T5K A;  1UJ5 A;  4YP3 A;  1UTA A;  4DR5 F;  1KFS A;  2W7A A;  3ZNU A;  4B02 A;  3CGI A;  3GU0 A;  3IAS 9;  1NSA A;  3HHL D;  3TZZ A;  1RT1 A;  5KG5 A;  2UXD F;  3TJA A;  4PQU B;  2DB1 A;  3CT9 A;  3MUR P;  3PJX A;  2CQ3 A;  4F0H A;  4RBV A;  3EGN A;  3R5C A;  4ED4 A;  3K5N A;  2ALZ A;  4ES1 A;  5I42 A;  1SIZ A;  3SIP B;  2BKO A;  3CCT A;  4P2M A;  3RAX A;  1L3S A;  1FTC A;  1LKZ A;  2DGU A;  5L1J A;  2LXI A;  2XY7 A;  2DIT A;  1QE1 A;  2DXF A;  1OPI A;  3IS9 B;  3GB0 A;  4JI2 F;  4I2Q A;  4JP8 A;  3P3D A;  1YVF A;  4NLR A;  3NAI A;  2XGP A;  3KLI B;  2W9A A;  2FB0 A;  2XTJ P;  5LMU F;  1IM6 A;  2PEH A;  3CUN A;  4DQI A;  3IGN A;  3QT7 A;  1VI7 A;  2FVR A;  4IR9 A;  1HBN A;  2AEJ A;  4OX7 A;  2CPJ A;  2R8K A;  2I9S A;  3N01 A;  1FI4 A;  2Y1L B;  1VLY A;  1EB0 A;  3HUL A;  4ZVG A;  3VV2 B;  4DEZ A;  3K57 A;  3T5H A;  3KNA A;  2FHJ A;  1X5P A;  3M9N B;  5L9N A;  4X2B A;  3B54 A;  3CB4 A;  4MKB A;  2K7J A;  2GV1 A;  1DQ8 A;  3POT B;  1FRK A;  2YQ0 A;  1RSC A;  5KFO A;  5FLX U;  1YG0 A;  4YB5 A;  4N7T A;  4R0E A;  2UUC F;  3QJP A;  1PYS B;  3WQP A;  1RCO B;  2OFG X;  1DHM A;  3NCP A;  4P2X A;  4ES2 A;  4Q44 A;  1I6J A;  4ERD A;  3AOB A;  1OHN A;  2IAJ A;  2HQI A;  4HHJ A;  2C3O A;  5K9F A;  2MGZ A;  5KG2 A;  2BJ1 A;  5CCM A;  5IV3 A;  2ZBP A;  1B99 A;  1RHR B;  2XYH B;  1X4E A;  1D09 B;  3Q8P B;  1HWL A;  2E9T A;  4WFZ A;  2K1R A;  3D0H E;  3M6V A;  4MIA A;  2IMO A;  3MMA B;  3TOQ A;  8AT1 B;  4DZ6 A;  3DRP A;  2HND A;  2DIV A;  2CDQ A;  2E7X A;  4O3N A;  3ZTS A;  3K5L A;  3SI8 A;  1N36 F;  4JI7 J;  1HWI A;  1TL3 A;  1WC4 A;  3OBI A;  2CZV C;  1SH3 A;  4ZA1 A;  3VAK A;  5KFW A;  2IBK A;  3Q8Y A;  4NWB A;  4KPY A;  2MTL A;  4M5K A;  2VBZ A;  3TUP A;  1HHQ A;  3W1Y C;  2AWZ A;  3M2R A;  4LMZ A;  1LW2 B;  2K7K A;  1VCT A;  2XMT A;  3EGW B;  3EGV A;  2R8G A;  2E5L J;  2KH9 A;  2QA4 S;  4DLE A;  4MYT A;  1NAQ A;  4K4W A;  4KH0 B;  4RPF A;  3ELH A;  3OFG A;  4DQR A;  2EG1 A;  2H3A A;  1NDC A;  4ZCL A;  2ZD1 B;  1Z1Z A;  1Y5N B;  3KLH B;  2ZM6 F;  3KJV A;  1R43 A;  1S1T B;  1U7L A;  1HPZ B;  3CCS S;  3AD8 C;  3HFZ B;  1RYR A;  1PSD A;  4D3H A;  4F25 A;  2UUB F;  4WIQ A;  3FMT A;  3ILJ A;  2VFT A;  1NK6 A;  2K29 A;  1VIS A;  3PRB A;  3R1H A;  1RAE B;  2JVO A;  4HV0 A;  1NH7 A;  2XY5 A;  4YS2 A;  4FXE A;  1NU4 A;  3CCM S;  1S9E B;  3PYE A;  1VDH A;  2GC8 A;  1RA6 A;  1P94 A;  4PXB A;  2WRM A;  3MUT P;  3GV8 B;  1VQ9 S;  4C9D A;  4YHH F;  4CLY A;  2ZH1 A;  1FVQ A;  1S49 A;  1NPP A;  1W25 A;  1JX4 A;  2VQE J;  4BS2 A;  1KOO A;  3DOK B;  4NLY A;  4DR4 F;  3MR3 A;  5CYQ B;  2WZ1 A;  3FNN A;  1VFJ A;  3HI9 A;  2CNK B;  2OHD A;  1O51 A;  5HQ8 A;  1T05 A;  1SUQ A;  1KDN A;  5I3P A;  1U1O A;  2DGT A;  1CC7 A;  5I42 B;  3MGJ A;  3NGK A;  4UQG A;  2VOP A;  1HNZ F;  4KRW A;  1UWB B;  3BGR B;  4I56 A;  2YPY A;  1S6O A;  2I6W A;  2ALY B;  1T8E A;  2V5H G;  4DSI A;  4CLT A;  1X4G A;  2OPR B;  4RW4 A;  1XNR F;  4RW7 B;  1SJ1 A;  4QR1 A;  1TEL A;  4K2J A;  1ZM9 A;  3GXQ A;  4ICL B;  3KK1 B;  2HFZ A;  4B9M A;  1V5I B;  2H54 B;  3W8P A;  3PX4 A;  3M6X A;  3GMG A;  4KIA A;  4B9T A;  3OR2 A;  1FT8 A;  5G0R B;  3W5Y A;  4ZLN A;  1CJV A;  2KU7 A;  4HVZ A;  4TY8 A;  3WHI A;  1KHW A;  5B0A A;  5DM6 Q;  3QZ8 A;  1RTI B;  3RUB L;  2QL7 B;  2V94 A;  1MWQ A;  2NXE A;  3E8O A;  4F67 A;  1URR A;  3J7A 1;  2Z2L A;  5F9L A;  4MKY A;  2JXH A;  2YNF A;  3SBM A;  3HCX A;  1CLF A;  2FJW A;  4NA1 A;  1QSS A;  1VQ6 S;  4A8Q A;  1XC9 A;  2ZH3 A;  2BA3 A;  1FRM A;  3DGV A;  4J90 A;  3MPD A;  1RHJ B;  4TXS A;  3ZZU A;  3BH6 B;  3JQM A;  2I0X A;  2BJ9 A;  3P96 A;  3RG6 A;  4EWT A;  4DV5 F;  1RCX B;  5A8R A;  2KEL A;  1F60 B;  1TUV A;  1HLW A;  2U1A A;  3M30 A;  4DX6 A;  3M9M B;  3H40 A;  1I94 J;  5GVQ A;  1JLE B;  1J27 A;  2R7Q A;  4OYP A;  3P49 B;  1SKW A;  1UPM B;  3M8Q B;  2IM2 A;  4UTG A;  3QIP B;  2AQ4 A;  3C15 B;  3FRZ A;  3H7H B;  1K0T A;  4LFC J;  3Q86 A;  1X4C A;  1BQN A;  1T9V A;  3HKW A;  1HI0 P;  2D9O A;  1RWP B;  2GGP B;  3LAK A;  1AA1 B;  1IBL F;  2R7S A;  1DJ0 A;  1HKA A;  4F7V A;  2XCP A;  4DR7 J;  4EFA C;  1S48 A;  3H0P A;  2ZOM A;  5A2Q Y;  3AJD A;  1Q82 T;  3A8J A;  4P7V A;  4ES3 A;  1VRU A;  1JIH A;  1RBO B;  1BHN A;  5LXR A;  2ZDO A;  3IWX A;  4ED7 A;  1V5V A;  1RQ0 A;  4ECS A;  3BSA A;  3TP2 A;  4Q8F A;  3A4T A;  1X31 C;  1JKH B;  1Q53 A;  2SXL A;  4OZ1 A;  3UCZ P;  5D8H B;  2KVQ E;  3MAH A;  4LR9 A;  4J91 A;  1YGY A;  2ACY A;  4HEA 9;  2RJZ A;  1MWZ A;  3MM8 B;  1XR5 A;  4NX9 A;  5F0U A;  5F3T A;  1WEZ A;  4CNZ A;  5HSP A;  4EBE A;  2BR0 A;  2QLW A;  3QFH A;  4ANE A;  2LQJ A;  4CLK A;  4JI5 J;  4WYW A;  3FT7 A;  4ZPB A;  4ZPT R;  1SVD A;  4ED3 A;  5GAG I;  4P71 A;  3T41 A;  3TQE A;  1VQ8 S;  2QMW A;  3NY0 A;  5FDL B;  4C2M A;  4GMK A;  1FKO B;  3VTI A;  1V3Z A;  2ZH8 A;  4DQQ A;  5H9E J;  1HI1 A;  4MTP A;  1TUW A;  5I4M A;  3FEY B;  4L6V 3;  3VGV A;  2Y1J A;  4FYW B;  4ZP6 A;  4NL5 A;  1GNK A;  1LW0 A;  1WI6 A;  2DBB A;  4LF2 A;  4DL7 A;  2FPH X;  3N6M A;  5D0H A;  4DR3 J;  1HNW F;  4HL9 A;  4A8O A;  3V6D B;  1PGZ A;  4JV5 F;  4OFZ A;  1ZZN A;  3J81 j;  4DV7 J;  2H5I B;  2OPP B;  2WW4 A;  1UPP A;  2XSF A;  3IRX B;  4U7C A;  3K5M A;  2FLN A;  2ZUG A;  1S9F A;  4FXV A;  4ED1 A;  2AEF A;  1YDL A;  1MU2 B;  1RTJ B;  4G1Q A;  1U48 A;  5CYM A;  1DTQ A;  4CP5 A;  3MCN A;  4ECR A;  3HFK A;  4URS A;  4DX5 A;  3RBE A;  2FLP A;  4NLQ A;  1XWL A;  3PY8 A;  2MQO A;  3I5A A;  2DJW A;  1SPB P;  5B0F A;  3AT1 B;  5C24 B;  5DG7 A;  2P6S A;  2QE5 A;  3IP0 A;  2PC6 A;  3ENV A;  2CPZ A;  4WE1 A;  3FQK A;  3ETM A;  2B8P A;  4JI8 F;  3THT A;  2N82 B;  2VHG A;  2XGQ A;  2VJU A;  3BYP A;  3CJ8 A;  4MAK A;  1B3T A;  3CUL A;  1VR6 A;  2DTJ A;  3H20 A;  3ZTO A;  3DXS X;  4DFJ A;  3CDW A;  4C8Z A;  2W01 A;  1NM2 A;  2BAN B;  2JSX A;  5ETM A;  3KLE B;  2PMH A;  2ZH6 A;  1PYT A;  2HBQ B;  2G0C A;  3C6U A;  4OZ5 A;  3KKF A;  1VBY A;  1Y5I B;  3RR7 A;  1DFD A;  4PWD A;  2RQ4 A;  1GH8 A;  3BPD A;  3MDF A;  4DUT A;  4IR1 A;  4HT5 A;  1CQN A;  1N5T A;  3NKY A;  3VZH A;  3Q24 A;  5I3U A;  1T9T A;  4JI8 J;  2DD8 S;  3PO4 A;  4P9S A;  4ECW A;  5CXT A;  2JRS A;  3NCQ A;  1OS5 A;  2VKR A;  4TQS A;  3UVJ B;  4TYB A;  3LAM A;  5D3G B;  1D8Z A;  1RU2 A;  3JYT A;  3BN7 A;  2FHM A;  2R7O A;  3O3L A;  4ZP7 A;  3FZB A;  3RW6 A;  4K4S A;  2B6A B;  4WFA Q;  1B70 B;  3V4I A;  1H72 C;  1UCN A;  2BNW A;  2FIU A;  2N4D A;  1KC8 T;  1NDK A;  2RE1 A;  4M5D A;  2WSE C;  1RT6 A;  1W7W A;  3C66 A;  4CM2 A;  4AL6 A;  2IPO B;  1NK0 A;  1S59 A;  4MYU A;  5HMZ A;  2CQ0 A;  3VW4 A;  1ZA1 B;  2IRX A;  1FCA A;  3GPA A;  3GSD A;  4YUD A;  3CJ4 A;  3MTJ A;  4I7F B;  2FY1 A;  4DL6 A;  3BN4 A;  1F5B A;  1OWX A;  1N52 B;  5T7L A;  4M94 A;  3EVO A;  1Q78 A;  2ZNY A;  1R0A B;  3SQG A;  4WKY A;  2HHQ A;  3BPS P;  1QLN A;  1IKX B;  2M70 A;  1ZS6 A;  3SDE B;  1ZAW A;  3IBC B;  1WF1 A;  2BQR A;  2DGS A;  3RRH A;  1RAG B;  2B56 A;  3ADA C;  3DRR B;  3E51 A;  2C22 A;  5E3C A;  1A0O B;  4L3K A;  1C0T B;  4ID5 B;  4B3O A;  2OAU A;  4A48 A;  2AW0 A;  2B51 A;  2VJV A;  4OMF G;  4ECX A;  1B01 A;  2HRY A;  2MKH A;  4LFC F;  2EFV A;  3VQT A;  3IWN C;  2Z2Z A;  1AT1 B;  4N8N A;  1RT2 A;  2XMU A;  3L7O A;  2DIU A;  4X4P A;  4RBT A;  5IM0 B;  2NXC A;  3NBP B;  3M1V B;  4DR4 J;  3IRX A;  1FF2 A;  1U6F A;  2KKE A;  3S01 A;  3D7S B;  1RT4 A;  3ENW A;  1T94 A;  2V2V A;  4O44 A;  1KQF B;  3RBX A;  4IDK A;  5EDW A;  1SV5 B;  3PW4 A;  4WFN Q;  1FJE B;  4QYR A;  1T7P A;  2UVR A;  5KAK A;  3GLJ A;  3W2W B;  1FE0 A;  5E3R A;  5DLF A;  1GXL A;  3OL6 A;  1N48 A;  2FLL A;  2OTL S;  4JI1 F;  2VC1 A;  5GMD A;  3ZZ0 A;  2XCA A;  4ZLJ A;  1RJJ A;  2M8D B;  2BDP A;  4M5M A;  4FKX A;  4NI2 A;  4M5J A;  2CQI A;  2ZM6 J;  1RK8 A;  3TX0 A;  3H25 A;  1RE1 B;  2B7C B;  1UJ4 A;  3DLH A;  1U1R A;  4F3Q A;  3MR5 A;  5LOQ A;  2IM0 A;  3DLJ A;  2MQP A;  2ZJQ Q;  1WC5 A;  4DSF A;  4Q43 A;  2J6S A;  3MMB B;  3QT8 A;  3FCH A;  2F63 A;  3MMC B;  4K50 A;  4QJV A;  1ZM3 A;  4A8F A;  2IIH A;  3PYF A;  2VG7 A;  2RKI A;  2XZW A;  2GAG C;  2PD1 A;  3M8W A;  4ZJL A;  3THP A;  1MMD A;  4Y2A A;  5IWA J;  4KYZ A;  3BSC A;  4ZVT B;  3I5C A;  4C6A A;  2Y8W A;  1RWO B;  1G2E A;  1RAH B;  3FZ2 A;  2Y0S D;  3N6N A;  4I4B A;  4KY3 A;  4LSL A;  2DEI A;  4EUV A;  5C25 A;  5HQL A;  4H54 A;  4DV2 J;  1NJY A;  4JI3 J;  4YDX A;  1MG7 A;  1VQP S;  3IA0 A;  4KT0 C;  4OQJ A;  1CJK A;  1MYL A;  4K7Q A;  4DF4 A;  2VFV A;  1N34 J;  3LP1 A;  3M05 A;  5JVH Q;  3NOC A;  2QLJ B;  5GAE U;  2ZH9 A;  1LNQ A;  5SUH A;  1NHU A;  2D3U A;  2PII A;  2VQF F;  1ZET A;  3A3O B;  2E9Z A;  2PO4 A;  5A8R B;  4GKJ F;  3HXM A;  3HHD A;  4DFP A;  3CD5 A;  4CO3 A;  3U02 A;  2H1O E;  1OIA A;  4K0K F;  4KGV B;  1SI9 A;  1LEO A;  4KKO B;  3QO9 A;  1G7C B;  4NLO A;  4WFB Q;  4JI0 F;  1RA7 A;  1BDT A;  1S4E A;  4BBY A;  1NXI A;  1WC1 A;  2ZBR A;  3M32 B;  2BQU A;  3M8P A;  3MZI A;  1BXN A;  2HAF A;  4HAC B;  1DUR A;  3FK4 A;  3G82 B;  1KVK A;  4LFB J;  2L08 A;  5KFF A;  3GCW P;  4DI6 A;  2ROG A;  4FXW A;  5BYR A;  3QT5 A;  4CT9 A;  1T11 A;  1VQ5 S;  2BKP A;  2AYE A;  2ACM A;  4RW4 B;  4S0M A;  4USK A;  2DNQ A;  3RU0 A;  1RXO B;  2LDY A;  2NYH A;  2FHO B;  3PNI A;  5AXK A;  2OEL A;  2UP1 A;  4QCL A;  4ZIT A;  1U0H A;  5KFX A;  3CCU S;  1S1W B;  2R8H A;  5EN1 A;  1CQM A;  5KT6 A;  1N5Q A;  2MQ8 A;  1NK9 A;  1YRU A;  2RRB A;  4GRS A;  3I0R A;  4F2R A;  2KZM A;  3Q8Q B;  3M8R A;  1S77 D;  1QAY A;  2QJ3 A;  1B0V A;  2VV5 A;  4FS2 A;  2DHG A;  1LXN A;  2FC9 A;  2GJI A;  3PEH A;  2GPE A;  4UUX A;  4OYB A;  4RO0 A;  2M8H A;  4E8U A;  9ATC B;  3KHR A;  3HVA A;  3DOK A;  3NL0 A;  2Q6C A;  1IR0 A;  3KJF B;  3DFE A;  2ZC4 A;  5E33 A;  1YJV A;  3D68 A;  2EFQ A;  2DNH A;  3IR7 B;  1SL2 A;  2YKM B;  1G6B A;  2ZOG A;  3NCR A;  4RW8 B;  4EI2 A;  2F5G A;  4UOC A;  1AB8 A;  1C1C A;  1RUS A;  4LFA F;  1JLA A;  1YZ7 A;  1OSD A;  2OPS B;  2VG6 B;  4ZVU B;  2IRU A;  3DRS B;  2BUN A;  2B0G A;  6FD1 A;  1FVS A;  1J5O B;  1SQG A;  4KJI A;  2QN6 B;  3FRY A;  3VAL A;  3N79 A;  1S1T A;  2W8L A;  2JH3 A;  3HHE A;  4IRD A;  3SSR A;  4Q2L A;  3X1L B;  4LSN A;  3P45 B;  2AX1 A;  2DH7 A;  2POK A;  2YKP A;  5A76 A;  3CDB A;  4AE5 A;  2BZ2 A;  3T6J A;  1FJ7 A;  2XMA A;  3OR1 A;  1JNR B;  1HNV B;  4OZL A;  1JLC B;  3MEG A;  1YRT A;  1S12 A;  3I87 A;  5D6G A;  1VQK S;  1GMV A;  4PWW A;  3M7V A;  1ROF A;  2OSQ A;  4IFY B;  5IXU A;  4EZ6 A;  2I2Y A;  1PBU A;  3DHW C;  3GFX A;  4Z37 A;  3LPY A;  5LXY A;  4LBP A;  2HGL A;  1GAO A;  5D77 A;  4LF9 J;  5DS7 A;  4O23 A;  2VPW B;  4QYZ J;  5J2Q B;  2F4F A;  3DLK A;  3Q8R B;  3HDS A;  2JFD A;  3M2U A;  4DUY F;  1SL1 A;  4OX9 F;  2ZJP Q;  3DDN A;  4Y2M A;  1DTT B;  3H98 A;  1KKH A;  3CWJ A;  4KFB B;  4O3P A;  4DS5 A;  5F8H A;  3KJQ B;  1B7F A;  2CQ1 A;  2JBV A;  4DPU A;  2VD3 A;  3GV7 B;  2FQQ B;  4Z7C A;  5HVF A;  3R5G A;  4PEO A;  3MF5 A;  1MLA A;  3I55 S;  3QMQ A;  2JLF A;  2Y3Y A;  1TMJ A;  2CJQ A;  3ZFV A;  5AE3 A;  4F4X A;  3HK2 A;  4PG6 A;  2HNY B;  3QLH A;  2R7U A;  4F02 A;  1R8H A;  3CD6 S;  1YJW S;  1NUE A;  3D0G E;  4X62 J;  3M8S A;  1OY8 A;  2XS2 A;  1FDD A;  1TAQ A;  2QV6 A;  2E1P A;  4LR7 A;  3LP2 B;  2XC9 A;  1TKT B;  2XB2 D;  1WHY A;  2L9D A;  6AT1 B;  2LEA A;  3IG1 B;  4RUH A;  3CSK A;  3HT0 A;  4DUZ J;  2G2Y A;  1JLA B;  2VG6 A;  3VGT A;  1IN0 A;  3G96 A;  2IDE A;  4QWC A;  1J5E J;  3BS9 A;  2YKM A;  1RTD A;  1QJH A;  2A1B A;  1WOP A;  2R7W A;  1WAC A;  2LP4 A;  4G1P A;  2BA9 A;  1VJQ A;  4ZKA A;  1V6H A;  1H2V Z;  2M88 A;  4PG8 A;  4AFF A;  3MCM A;  1CUL B;  4YR3 A;  1S6Q B;  1IR2 A;  1VIO A;  3D3C J;  3KLF B;  3H5X A;  2EKY A;  3MFI A;  3G8S A;  4O4R A;  4TQR A;  2LQ5 A;  5F41 A;  3DI6 B;  3CTR A;  4WPA A;  4ZN1 A;  3BO2 A;  1RLD A;  2HHW A;  3W63 A;  2RD5 C;  2Y1R I;  2KYX A;  2FVS A;  1SC4 B;  2MB0 B;  4NLX A;  1AUD A;  4LF7 J;  1DQ9 A;  1Y11 A;  2ZC3 A;  3IFE A;  4PG7 A;  3VZI A;  3TUZ C;  4O0I A;  1PKU A;  4DV5 J;  4ECZ A;  3UDC A;  1JJC B;  2QA1 A;  1RAC B;  3K5P A;  1Q8B A;  2E5G A;  5D4P A;  2AJ4 A;  1SJ4 P;  2CNL B;  4EYH B;  2A6M A;  1OO0 B;  3OV7 A;  4ELV A;  4EEY A;  4K4V A;  3AOC A;  4DUY J;  4CTA B;  4EBD A;  2COL A;  1KTV A;  4YDD B;  3G82 A;  5KFG A;  3PIP Q;  2AHO B;  4WXW A;  3PW5 A;  2PFF B;  3PHT A;  1UW9 A;  2MSS A;  4ELT A;  2KN4 A;  3CD0 A;  4IOA Q;  3BF4 A;  3DLE B;  1B4S A;  3U7J A;  1UAW A;  4DX7 A;  2YKQ A;  1L3K A;  1UVM A;  5EGY A;  1EA4 A;  4KH1 B;  1U2C A;  4RLE A;  1F9E B;  4DQP A;  4ZPA A;  2DNR A;  1U47 A;  1M5S A;  1MRO A;  1NJI T;  1IKV A;  2F7V A;  4FPI A;  1RBA A;  1CSJ A;  4IG0 A;  1ITP A;  2Z56 B;  4ATN A;  4DN9 A;  2DNZ A;  1HNI B;  5DZ7 A;  1TK0 A;  1WD6 A;  4C7Q A;  1O5J A;  1TFY A;  4YN3 B;  3MCO A;  4ZHR A;  1OY9 A;  3PFO A;  2MMY A;  4DS4 A;  4GC7 A;  1TV6 A;  4TN2 A;  3OTB A;  2RQC A;  1P9Y A;  1RWN B;  3L3C A;  2OUG A;  1RT3 B;  1T9Y A;  1FDN A;  2H5E A;  2I5J B;  1EAY C;  2JX2 A;  1U1M A;  1XMO F;  1YJ7 A;  2RKI B;  1QM9 A;  1Q5Y A;  5EX3 A;  3NBP A;  2DNY A;  3GQC A;  2V8D A;  2A2B A;  1RT2 B;  3L09 A;  2VBX A;  3PTW A;  4OYO A;  2YNH A;  3MAA B;  1HR0 J;  4F3M A;  3BGL A;  3R6G B;  3JTP A;  2E29 A;  2WOM A;  3GR0 A;  2ZEJ A;  1NSQ A;  5H1S V;  1EJ7 L;  1UP1 A;  2D69 A;  3H8Y A;  9RUB A;  4YFU A;  1KLN A;  2UVW A;  3VQS A;  4AQY J;  2ZHO A;  4EU0 A;  1X5O A;  4WKR A;  4IOB A;  3RW7 A;  2X1F A;  2H5J B;  5CD4 H;  3D54 A;  3KFW X;  3PW7 A;  3GG0 A;  2R4F A;  1N5Y A;  5KG0 A;  5KT2 A;  3QAU A;  5D0E A;  4N76 A;  2F4V F;  1IKX A;  3BRE A;  3OXL A;  4MT1 A;  3SDE A;  3W2W A;  1F9F A;  2DR5 A;  2XSJ B;  1S76 D;  4ZCK A;  3LUY A;  1JLQ A;  1WG1 A;  2VU5 A;  1S7H A;  1N88 A;  4KGK A;  4OJH A;  4IO1 A;  3SYZ A;  3G5O A;  1LFW A;  2QTW A;  2HVZ A;  3GCX P;  2G2O A;  1LK7 A;  4Q2M A;  2CPH A;  1RYS A;  2FJV A;  3ET6 A;  1S6P B;  1FKP B;  5C42 A;  4USV A;  3J7Z T;  1M0S A;  4OYZ A;  4XTT A;  4BLG A;  3NXZ A;  5J1N A;  5DET A;  2YNG A;  1YHQ S;  2J7W A;  3P5B P;  2KI2 A;  5CCL A;  4M5D B;  2ADB A;  2V9W A;  3SV4 A;  2CQD A;  2KM8 B;  4FP9 A;  1U1Q A;  4C4W A;  4P74 A;  1VIX A;  3HD2 A;  1HL6 A;  2WON A;  3BGO P;  2XO7 A;  4K4Z A;  4N47 A;  1EKR A;  5L1K A;  1RHM B;  4ECT A;  3HHK A;  4QWB A;  3C46 A;  2MZJ A;  3GIK A;  5K14 A;  4LIW A;  3TAM A;  4DG1 B;  3KK3 B;  2UVU A;  3K59 A;  2OTJ S;  2WCX A;  2NXN A;  1T03 B;  2O1P A;  1TL5 A;  5E3Q A;  2UXC J;  2W9C A;  4HHU A;  3N6L A;  1D9A A;  3US5 A;  3KLV A;  2JLG A;  2JNJ A;  1RAB B;  4IO9 Q;  3UD5 A;  2DEJ A;  4CH7 A;  2VG5 B;  1HBU B;  3SQG B;  1R0A A;  1UKU A;  2EXU A;  1I3O B;  5THW A;  5U47 A;  4C0B A;  1YIT S;  4PWD B;  4A47 A;  1FFW B;  4RUA A;  2ZZN A;  3EZO A;  2VPY B;  5BR8 F;  2B43 A;  4J9S A;  2MLX A;  3Q83 A;  1EX8 A;  1SQE A;  2MKS A;  4NXN J;  1VQM S;  3DU5 A;  4MK7 A;  1FFS B;  3OVS A;  2BBE A;  3P8B B;  1C2P A;  3VAG A;  2M0G B;  2VG5 A;  2MLY A;  3V4I B;  1N34 F;  1F1B B;  2B6A A;  3TW0 A;  1UZD A;  3DXB A;  1TR0 A;  4K0K J;  2E5H A;  4PKD B;  2V9K A;  3GYG A;  3WIU A;  5L1L A;  2CAX A;  2B3T B;  1FK9 A;  2Q66 A;  4DQS A;  5C24 A;  1JLB A;  1F3F A;  2V2Q A;  4NYP A;  2GIQ A;  1VOM A;  4I2P A;  4X66 F;  1HBM B;  4MK8 A;  3CC7 S;  5A8W A;  2VPZ B;  3TWZ A;  2XMM A;  2QIF A;  4AXJ A;  5HVH A;  5IFM A;  2YNG B;  2WVF A;  4JV2 A;  3HD1 A;  4ED5 A;  3CC4 S;  1G1X A;  2EI5 A;  1HNX F;  4OIX A;  2RU3 A;  3EPI A;  2GFF A;  1OPZ A;  4ZCM A;  5DJB A;  4WFY A;  1H6K X;  2M4M A;  1QAX A;  4IH7 A;  3QT6 A;  3BQ1 A;  2ATL A;  1JLG A;  4JB8 B;  4QR0 A;  5KG6 A;  1RAO A;  5IQQ A;  2YNI B;  4M95 A;  2OO4 A;  2RIJ A;  4Y6I A;  5H9E K;  2B4U A;  5B7W A;  3M6W A;  4C8L A;  3HSG A;  3GIL A;  3ZZY A;  2FVQ A;  2BW2 A;  4NZ0 A;  1T03 A;  1KBR A;  1E6V B;  3DKD A;  3W66 A;  1N5Y B;  4DSL A;  2Q2K A;  2AV5 A;  1RWV B;  2HS4 A;  2K3K A;  2RU9 A;  2YKN B;  4LF1 A;  4WFX A;  4UZB A;  4YR2 A;  1Q7Y T;  5IT9 Y;  2V4Q A;  2LVW A;  5JUM A;  4P52 A;  5IOL A;  4FNI A;  4Y2I A;  1LWE B;  4ITS A;  1IWG A;  3DOL A;  3MM5 B;  4JUZ A;  1I94 F;  3MEE B;  2ASD A;  2DXE A;  2HQG A;  2J9D A;  1CJT B;  4LUB A;  3R7N B;  1YBA A;  5KOW A;  1VQ7 S;  1KSP A;  1R8P A;  2GVZ B;  3GP9 A;  3JS9 A;  3M9O B;  2JEI A;  2Q3P A;  1SKR A;  4O4G B;  4DR6 J;  3FGV A;  1N32 F;  3FBC A;  4Z7Y A;  5LM7 E;  1BY9 A;  1ZOT A;  2CZ9 A;  5KFK A;  2JHE A;  3HHL C;  3VR1 A;  4YHH J;  2J6U A;  1WSR A;  4BDP A;  1RT3 A;  1SQF A;  2I5J A;  1WG4 A;  2PN6 A;  1Y0H A;  1LW0 B;  2DR6 A;  1O6X A;  2QC3 A;  4FYY B;  4NA2 A;  4CQ1 A;  4CYU B;  2HYI B;  2GGP A;  2YX7 A;  3NWR A;  5LMN F;  3CCE S;  2V4J A;  2GAH C;  5KT5 A;  3TZY A;  2DHH A;  3QOQ A;  4C48 A;  4IG3 A;  2CDR B;  2MQL A;  2W4P A;  4QBU A;  3LPE A;  1DZ5 A;  3G6Y A;  3O5T B;  4UOG A;  2QX0 A;  4CLZ A;  3LWL A;  1NRK A;  4AL7 A;  4QPT A;  2CKW A;  5DQH A;  5RUB A;  1IQT A;  2B9E A;  1IKV B;  3MM8 A;  4WZQ A;  2IA0 A;  4IUF A;  3EDQ B;  1RIS A;  1MNE A;  3HSJ A;  3FEX B;  4AD6 A;  3J7Y U;  3FMW A;  2J7K A;  1WHW A;  3SCK E;  3F73 A;  3T1Y F;  3VAI A;  3PJ9 A;  2A0F B;  2J9D E;  3W65 A;  2BQ3 A;  3GSI A;  2JFK A;  1MN9 A;  3BGF A;  1ZA2 B;  1F5C A;  5CAA A;  3CCW A;  3G6V A;  4JV1 A;  3PG9 A;  2NQP A;  2KT5 A;  4ZVO B;  2FZG B;  1BQN B;  4R25 A;  5LMN J;  2K1O A;  3I96 A;  6FDR A;  2P9C A;  4N56 A;  3C6T A;  3PR4 A;  3KK1 A;  3DHX A;  1Q7L B;  2FJE B;  4JI5 F;  4USM A;  4QPX A;  2G2Z A;  1UFW A;  3M2V B;  2YVS A;  5KOX A;  1YI2 S;  3H59 A;  3B4D A;  4UT4 A;  2GQC A;  1TTH B;  3CED A;  3CMQ A;  1RAJ A;  1JXE A;  1SIW A;  4ZVF A;  1SJR A;  4OYW A;  4C8M A;  3EZ5 A;  5GAE I;  1U9P A;  3PDN A;  1GTE A;  1A6L A;  5FJ4 A;  1FWP A;  5T14 A;  1ARO P;  2R9L A;  1HI8 A;  2F8E X;  1UFK A;  5KFI A;  2DR7 A;  2K6L A;  1X5T A;  4K2X A;  3DI6 A;  4HLB A;  4ZJO A;  4DSJ A;  3N5B A;  2LEP A;  3QAE A;  4DXL A;  2OD6 A;  2HHV A;  3W9I A;  2N7C A;  1FRL A;  3DOM B;  1Y9O A;  2Z2Y B;  2JDJ A;  3GZ7 A;  5L8R C;  2FJA B;  1Q95 G;  4DPX A;  4L73 A;  5T41 A;  1W2I A;  3K2Y A;  1TKX A;  2C2M B;  3PX0 A;  5IZH A;  3HVT A;  2G0J A;  4ICL A;  5AT1 B;  4RNM A;  2OJ3 A;  2NXU A;  2LQ8 A;  3LGM A;  3SSQ A;  2CPX A;  3F41 A;  4LF5 F;  4WP8 A;  2ZVS A;  3BH7 B;  3TRG A;  3R5J B;  2VFS A;  1R0B G;  3OLB A;  3HZE A;  3MOJ B;  1K1Q A;  1HPZ A;  2XHW A;  2V50 A;  2VA2 A;  1WEL A;  2H4Y B;  3CCQ S;  4KB7 A;  2AD9 A;  2LYV A;  2C2E A;  4U7U K;  2EBE A;  1FO1 A;  1VRT B;  4TU9 A;  4KHR A; 
#chains in the Genus database with same CATH homology
 2H1O E;  1NLA A;  1Q5Y A;  2WVF A;  2JXH A;  2Y3Y A;  2K6L A;  2BJ7 A;  3VW4 A;  1IRQ A;  2CAJ A;  1EA4 A;  2BA3 A;  1BDV A;  1X93 A;  2CAD A;  2AY0 A;  1BDT A;  2GPE A;  3VEA A;  1ARR A;  3QSI A;  2BJ9 A;  2BJ1 A;  2F1F A;  1MYK A;  2CA9 A;  2KEL A;  2JXG A;  1BAZ A;  2WVE A;  1B28 A;  2NZC A;  1QTG A;  4D8J A;  1ARQ A;  3FT7 A;  2K5J A;  3FMT A;  2K29 A;  2K9I A;  3BKU A;  3BKF A;  3LGH A;  2WVC A;  3QOQ A;  3GXQ A;  3BKT A;  2K1O A;  4HV0 A;  1MNT A;  2CAX A;  4FXE A;  2BNZ A;  2PC6 A;  1MYL A;  2BSQ E;  2HZV A;  1P94 A;  1Q5V A;  2WVB A;  2CPG A;  2HZA A;  2WVD A;  3OD2 A;  2FGC A;  2BJ8 A;  2BJ3 A;  2RBF A;  1B01 A;  1PAR A;  4ME7 E;  3H87 C;  2BNW A;  1U9P A;  3PHT A;  3VEB A;  2JXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...