2HZAA

Nickel-bound full-length escherichia coli nikr
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NikR-operator complex structure and the mechanism of repressor activation by metal ions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Nickel-responsive regulator
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2hzaA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2hzaA02
3GXQA 2BNWA 3BKTA 4ME7E 2CADA 2BSQE 3VEAA 1EA4A 3VEBA 1MNTA 2BNZA 3FMTA 2H1OE 2JXIA 2AY0A 2RBFA 2NZCA 3PHTA 2JXHA 1IRQA 2CAXA 1MYLA 1ARQA 2CA9A 1B28A 2GPEA 1BDVA 1Q5YA 3BKUA 3VW4A 3BKFA 2K5JA 3QSIA 2WVBA 1ARRA 3QOQA 2BJ9A 1P94A 1NLAA 2FGCA 2JXGA 1X93A 3FT7A 2WVEA 3LGHA 2BA3A 2HZAA 2WVDA 2CAJA 2K9IA 4FXEA 4HV0A 3H87C 2WVFA 1U9PA 1QTGA 2HZVA 2WVCA 1BDTA 2BJ7A 2BJ3A 2K29A 2K1OA 2K6LA 2BJ1A 1MYKA 1PARA 1Q5VA 4D8JA 2Y3YA 2F1FA 2PC6A 3OD2A 1B01A 1BAZA 2CPGA 2BJ8A 2KELA
chains in the Genus database with same CATH superfamily
3TA2A 4U6PA 4DV3F 5HVFA 4DR3J 3M6WA 1TK0A 4KY3A 1BMQB 1TV6A 3KLHA 2W7PA 4DCJB 1SC4B 1YZ7A 2DNHA 4Y2KA 4EYHB 1FFSB 4C6AA 5FDLB 2PEHA 4PR6A 4X2BA 3ZTPA 2DRDA 2LXFA 3DGPB 1TL5A 4USTA 5J1NA 4EBEA 1QTNB 1C4AA 4LF9J 4E98A 1U6ZA 2VQFF 1AZSB 3UN3A 1REVB 4AL5A 1WOOA 1C0UA 2HVZA 1MU2A 4WP9A 3RAMA 4DPOA 3KLEB 4PUOA 4B3OA 3I0SA 1EHWA 3BBFA 1PSDA 3ZTRA 4F3MA 4DPYA 3EDQB 1JKHB 1YGYA 4EZ9A 3LAKA 4MTPA 4O3RA 3D3CJ 1JJHA 4JI5F 3VR1A 3UN5A 1SCJB 1XERA 4HT7A 3FEXB 3IG1A 4Q8EA 1F9FA 4RW9B 1VK8A 2HSEB 3VTIA 1F2HA 3EE3A 1HHQA 3W8GA 2XMVA 1N32J 4CM0A 1ZYQA 1FRIA 1Y11A 2KFNA 2MKKA 2QL7B 3W1YC 1ZS6A 3AQPA 2JFKA 1R0AB 2DR8A 3EXCX 3EPIA 2VONA 4DR4J 4ICLA 5EHHA 1OPIA 2F65A 2RQMA 3I9V9 4HVZA 3UCGA 5HANA 2IHR1 2HVEA 2XULA 4J9OA 2W9CB 1ACMB 4MT1A 3QJLA 3QZ8A 1U1LA 2H65B 2KL8A 4FXDA 1F6TA 1RISA 2HLUA 3MR3A 2VFRA 1RT7A 3N28A 1TKXB 1SUQB 4DL7A 3CMQA 3VF0B 5HI7A 1BUXA 1ZAXA 2CQBA 1QAIA 2KYZA 1HWKA 3HHDA 4J37A 3NOGA 4J9UE 4CIOA 3CC2S 2GHWA 2QO3A 1RU2A 1ROFA 2WSCC 4GMKA 4J7CA 1QTMA 2HNDA 2VZ9A 2HS3A 4RW6A 2JOQA 3JQKA 4LIRA 2KVIA 3BM7A 4ZN1A 2CPEA 2UUWA 3MEGA 4ZP9A 5A76A 3CDBA 3KLEA 4IFYB 5HJYA 3W2WA 1IKXB 2VG7B 1O0PA 4DU8A 4FS2A 4B3RJ 1Y3KA 1DQ8A 3F73A 1N36J 4DV2J 2NUUG 4DV5J 2DNMA 1N36F 2YNFB 3U1NA 4PQUB 3RR7A 2FY8A 2C2OB 2KELA 3IGNA 4IOBA 3GFYA 3LO3A 5LJ5Y 3P4UB 1IKWA 6AT1B 3PW4A 2BOAA 1WWHA 2P6SA 1CJTB 5C42A 5HP1A 2NZCA 3JYTA 4KV8B 1AROP 3D0IE 3OXGA 2LDYA 3LW5C 2DIUA 3ZZUA 1HI1A 4ZK7M 2Y8WA 2MQOA 1R27B 2DNQA 4LF1A 4DFJA 3CCLS 1I94F 5KT3A 1BQXA 2BE7D 4KQZA 3IM8A 4Z7CA 4DR6J 2DH8A 4IFVA 1ZA1B 3A8EA 2HW3A 2P9GA 3BSAA 1Z4UA 2PO4A 3LA0A 2I9SA 3J7ZT 1RCOB 5L38A 2C2DA 2HHXA 4K2JA 4CH0S 4DQRA 1C1CB 1S1WB 2CDQA 4N47A 2LCWA 2QRRA 1SIWB 2QLFB 3TX8A 2UXBJ 2MZ1A 4ER8A 2MTLA 1WACA 3W62A 1V3SA 4ED7A 2DRBA 2KT5A 4KB7A 2BA9A 1S76D 3BF4A 1G1XA 2OD4A 2PSZA 1RHJB 2HNYA 3PXGa 2RU9A 3A1YG 5C24A 3JSRA 4Y0FA 1CJUB 3KK1B 3GPAA 1FDBA 1LWEA 4ED6A 1NPRA 3A12A 2IC3A 3EVOA 1UVLA 3TUIC 2W1BA 3C6UA 3PX4A 2VU5A 2DGSA 2F4FA 3AJ2A 1C1BA 2WONA 3W60A 3RB4A 4ID8A 2FJBB 2IYIA 4R0JA 1X9WA 3AY0A 3EGVA 4GC6A 5KFHA 4E0DA 3C14B 4ZDNA 5KFWA 1GMVA 2AF6A 3P8BB 2DHXA 3MEEA 5GMDA 3K7RA 3CT9A 3TAMA 1HW8A 3R6LB 3U02A 2E44A 1URRA 2GS8A 1QSSA 1UJ5A 4FBUA 3DU5A 1HA1A 1QSYA 2HBQB 3JSYA 1WHYA 1X4EA 4LVNP 3UN2A 1HNXF 2BE2B 1TUGB 1YJVA 4B3TJ 1VGYA 4LUBA 3X3UA 3PFOA 4HYKA 2HGMA 3PJWA 2ACYA 1IKYB 1R3NA 1TUVA 2YWHA 5ETLA 1FRHA 1S4EA 1TKTA 2ZKTA 2QFJA 4DR1F 1RCXB 5CZVA 2KVQE 4UW2A 5L8RC 1O6XA 2W2NP 2ZOGA 4ZPAA 1PGZA 4FS1A 3JS9A 3OPKA 2K1RA 2R7OA 4A8OA 5D8HB 2GQCA 1TQLA 2RD5C 2CIMA 2M88A 3I82A 4F3OA 2EFOA 4DPUA 3HSDA 4USWA 4U8VA 5J2NB 4DR2F 2VPZB 2AZ1A 5LOQA 5KFPA 3HSGA 4FYXB 3VZHA 4PXCA 5HVGA 3Q23A 1TUWA 5EUHA 3C2PA 4DL5A 1M5VC 1SJFA 3TAMB 1NHVA 1SVDA 2Q1LA 1ZM2A 2ZDPA 3A8IA 3UVJB 2ABYA 2YWWA 4DPXA 4K4WA 1ZM9A 3IR7A 3NNEA 4Y2CA 4NXMF 1IWGA 4LF2A 5CCLA 4NLRA 1FRKA 1N34J 3NNAA 2W2QP 7FDRA 4LF7F 2YH1A 1FWKA 4BLGA 5LMNJ 2F40A 2JVOA 2RB7A 4OI3A 5DS7A 3HVRA 4C8YA 2EI5A 3AH6A 2NSBA 5L1LA 1LWCB 4JI7J 2J7KA 1NDLA 4E2FB 2YXLA 4LF8F 1Y5LB 2K3KA 2PIIA 3C46A 2XLKA 2OAUA 3POTA 3T6JA 4DV6F 2GIRA 4DX7A 5BXIA 2VBZA 3R1LA 1N5QA 2E1MC 3KLFA 3FBEA 4I2PB 2XWXA 2V4QA 4DSFA 2WSEC 3N5FA 4KPYA 4EK2A 4JI2F 4YR2A 2IJFA 4OIXA 2W9BB 2COLA 2H4WB 3LP0B 1QD1A 4DSJA 2FJXA 2WBRA 3SI8A 1E6YB 3I4HX 3PHTA 1MMDA 2B56A 3CE8A 5D3GA 1U1PA 3DHXA 1RI7A 4RU9A 4QIWD 1WF2A 1RT2B 4PXBA 1RTIA 4R5PB 2CPDA 2EPIA 2ZBRA 1S1TB 3CJ3A 3WZ0A 4DUZJ 1PJ5A 2MMYA 3QYYA 1J5OA 3N6LA 1BQNA 4C3MA 1FKPB 1NRKA 3WDOA 4B9NA 4YB5A 2D9OA 3RJMB 1X93A 4DR5J 1VOMA 2XMMA 1VIXA 4LRCA 3IWLA 2VQEF 2CYYA 3GE9A 3DU6A 3I6PA 1U2CA 3QJJA 1K73T 4NXNF 1MWYA 4YP3A 2EK1A 1Q53A 4LBIA 2VC1A 4DR1J 3A3PB 1BGXT 3K57A 4D8JA 2UUTA 4I7FA 2J9DE 1UEUA 2QYGA 1RTHB 2CJXB 3M8YA 2XC9A 1VQ4S 2AYGA 2OPQB 3R6GB 4C4WA 1SH2A 1KKHA 3CUNA 1X0PA 3R97A 1K0VA 1WI6A 1FKOB 1PIEA 2B8PA 1OSDA 2DJWA 2G1DA 2UV8A 4I64A 3EDRB 3HLUA 4NPOA 2HRUA 3PIOQ 4IH6A 2ZM6F 2R8JA 2G4BA 4MYUA 1RWOB 3CULA 2EK6A 1PBUA 4M5LA 2GVZB 1FXDA 3BB5A 3NCQA 5KG4A 1VC5A 3J80Y 1PO6A 4QW9A 1X9MA 2M8DB 3Q8YA 4OFZA 1IVZA 5BJRA 4NRUA 2KKHA 3GSDA 5CYQA 2QC3A 2HAFA 3OR1B 5A2QY 4CCHA 5L46A 1WNEA 2F7VA 2M5YA 3SDEB 1JNRB 2DNYA 4WTOB 2DNZA 4AUKA 3RB0A 1DURA 3E8OA 2EKNA 2V63A 3DRXA 3PYEA 4LRFA 5CZXA 5E3PA 2KZMA 1N5YB 4OI1A 1B01A 4XTTA 2CPGA 2RAQA 4A8KA 4JI7F 2YKQA 3DRRA 4ICLB 1LFWA 2NXUA 2CADA 4LF8J 5IC6B 5JMNA 1CEZA 4QWBA 5HSPA 2C22A 4C8OA 3PYDA 4YUDA 3H4BA 4LRDA 2JXHA 3FBFA 4GC7A 2VJVA 4BHQA 1NK6A 2HHSA 4P10A 4KTQA 3W9HA 5ETMA 2BDPA 2IM1A 4EFAC 1REGX 1S72S 4OYXA 4DS4A 3IRWP 2M0GB 3QBCA 5L1KA 2E5LF 2RQCA 3R7SB 5CD4H 1KN6A 1YG0A 2E7WA 2JHEA 5HROB 5D78A 4X84A 4ANDA 1PYOB 2RF2B 3I5CA 3MOJB 3HI9A 2V8VA 1HBMB 4DFKA 5LM7E 5KT5A 2L41A 1JLCB 2MQNA 1XNRF 1IJEB 1C2PA 1MW7A 2RUGA 1NJIT 3B78A 4AFFA 3VAGA 3RBZA 2AGPA 2OPPA 5GAHU 2VL1A 3QGGA 2H1OE 3NS7B 2V2KA 3FZBA 3I9ZA 2P2CB 3RW7A 3D2WA 1VQLS 2YNHB 4NLSA 1P9YA 4NEZA 1I51B 2MDAA 4PG4A 1HARA 1KHVA 3K5LA 2ZBCA 2QYCA 3DOKA 3SIPB 4EBCA 1I5OB 2NXNA 3G4SS 1FE0A 4KH0B 1UETA 5E3QA 3NAIA 4JI8J 4QYZJ 1TFYA 3SV3A 2HIQA 1HNIB 3R7BB 1HFEL 1VHIA 4ZP6A 4RO0A 4DR7F 2MB0B 5EWFA 2KJVA 1AT1B 4N7TA 4HLBA 5D15A 2F3JA 3KLHB 2R7VA 3CWJA 4BWJA 3NNHA 2RHQB 3MAAB 3KJVB 1H0HB 3BEGB 1XR5A 4Z37A 3H4DA 2ZDOA 5GMKa 1HMVB 1HL6A 2R7WA 1IXKA 1RSCA 3Q22A 2HK3A 5D3GB 4WKRA 1IUJA 4OHYA 3ZZYA 4AYBD 1NK0A 1F5BA 4A8FA 4F3QA 5M2RA 5CYJA 4ID5A 3IFEA 2FC9A 4I2PA 2Z58B 3QGIA 4O44A 4NI2A 4QIFA 1SI9A 1N8RT 3FSXA 3TVZA 4O44B 3BBBA 4O4RA 2K9IA 1LFPA 3OTBA 3QAUA 1IN0A 2LQ8A 2XWYA 1NB2A 2UP1A 3CJ5A 3A3OB 3LAMA 3CCMS 4IQXA 3BSNA 4JV1A 4LSNB 5IS2A 2JZ5A 2PMWA 1RB0A 2OKQA 2F1FA 3K8WA 4J9RA 4DUTA 1M5SA 3T5HA 5H9FK 1KFSA 1FD8A 1EETA 4NOHA 1D09B 3OW2R 1FD2A 2CJ9A 1DARA 2VBXA 1VLYA 4FKYA 3OR2A 5U47A 5BR8J 3CCQS 1KVIA 5KG7A 1T05A 3IWNC 3G2XA 2KG0A 2H3AA 4LF4J 2K7KA 1S9EA 3M1VA 1U6BA 1GT8A 2CA9A 2ZZTA 4ZLPA 1KEKA 4NLOA 2F8MA 2K5JA 4WWSA 4KGZB 2RT3A 1S6QA 4DV0J 2WHOA 2GJ2A 3QIPA 4XDCA 4NMLA 4FKXA 3TZWA 1VRTA 3LF0A 3AA8A 3PIPQ 2DNKA 3LWLA 4DF4A 4NLGA 2X3DA 4Q5VA 2MHEA 2IRUA 3LTOA 4ZLNA 2XNQA 1SJ4P 3GR0A 2BRLA 3MMAB 5IWAJ 5CD4A 1VRUB 4H4MB 2CNLB 4CP5A 4X4NA 2VPXB 3NY0A 3NCPA 2UVUA 3DYAB 1W2IA 3FSYA 4C8MA 4C11A 4DS5A 1CC7A 1LOUA 1OYDA 3VHQA 4E8UA 2BX6A 2MPUA 5H9EK 2UXDF 2NS1B 2MJUA 5C2CA 4C7QA 4EYIB 4HDHA 2ZJRQ 2DTJA 3GFXA 3KUGA 1NH8A 4ZJQA 2IRYA 2MQMA 1SPBP 3G87A 3MEEB 4IDKA 4OJ3A 1A0OB 4P75A 4YN3B 4A8XA 2X1BA 5C2GA 2VICA 4ECTA 2R7XA 5IV3A 1HNWF 4X4PA 2IVYA 1RWKB 2HWTA 1OQ6A 4YY3F 3GWCA 4I69A 3PW5A 1EIYB 4DR4F 2RF2A 5LJ3Y 2DEIA 3CC7S 2UVRA 2MKIA 2BACA 2RILA 5KFIA 1SKUB 2XYPB 4IRKA 2V8DA 2CQDA 2G2ZA 3H5SA 4A46A 3A8JA 2HZCA 2EC0A 3B8HA 5KFLA 3NOCA 2C3UA 1F1BB 1RTJA 1U0HB 4Y34A 1U02A 1XJWB 3H98A 3J81j 2VASA 1SQFA 3CCTA 2C2MB 2ADLA 1U49A 1GTEA 4NE9C 1RK8A 5GAHI 3AOCA 2J0XA 2NLWA 2A10A 3MPVA 3SDEA 2XO7A 3THVA 4X4OA 3T9NA 2ZH5A 1X7VA 3TAPA 1QVFR 1SIWA 1HWIA 2AEJA 2NPIA 1JLBA 2R7UA 3G71S 1U4BA 1M5PC 2KH9A 3HO1A 3K2YA 3UE2A 3WHIA 3BREA 2X1AA 2Q6BA 3Q89A 4B9SA 3R5BA 2QLBB 1NJWA 4GVBB 5B0DA 1FKAF 3PW7A 3QRPA 4NLTA 4USVA 2YNGB 2IVFB 5KOXA 2KM8C 4LFCF 2QLXA 3IBCB 2GC8A 2RRBA 4OLPA 5F8IA 4OHZA 3CPWR 1JNZB 1U24A 3WX4A 1HIYA 3Q2SC 3P3DA 4LR7A 4ECUA 3ZTOA 1UPPA 4YR0A 5HP1B 1UMJA 3D6MB 2GMHA 4IH5A 3KXDA 2BNZA 2AX0A 1NLKL 2B7CB 2B4OA 4I2QA 4M5JA 4UZCA 1IR2A 3BO2A 5CQGA 1NK9A 3TOQA 1FEEA 1RHMB 3QATA 1M1GA 4JB8B 5KG3A 2DIVA 4I7FB 4Q44A 2AJFE 1P1TA 1F9EB 4A8WA 2XY7A 2DVIA 4UTGA 3N6NA 4KHMA 1IKXA 2VG7A 2XYHB 1LW2B 1OMSA 3ETMA 3DXSX 1RTIB 4DJBA 1SJRA 4ZPTR 2OHDA 4R5PA 1OY6A 5AXMA 3GQCA 2D74B 3WC2A 1K8AT 4F26A 4RW6B 1E6YA 2UUBF 2XMTA 2NCKL 3EZUA 3H2UB 2C3PA 3KUEA 4WPAA 2HQDA 4NASA 4QWAA 4A8SA 3OQ2A 4CLWA 3TA0A 1BWEA 2W25A 3ILLA 4P52A 4HHHA 4RNMA 1CBKA 2K3IA 5LSOA 3FSIA 3L95X 4FXVA 3JSMA 2H5IB 2LXUA 4IUFA 2HFOA 3I96A 1I6JA 3I4PA 2IPOB 2IM0A 3TVKA 1RT6A 5FLXU 1R8PA 3G6YA 5KG2A 4Q45A 2N4CA 4ECYA 2BRKA 1BHNA 4PYDA 1LXJA 3UW1A 2ZHBA 2OSQA 2OEJA 3M6VA 2QG9B 1NB7A 4EZ6A 2HHVA 2J0WA 4DQPA 2EFPA 2QA4S 3V4IA 2ZEJA 5JJBA 3HJVA 4ITSA 5A6PA 3LJPA 3S6EA 4IG3B 1PAUB 3NWRA 1IKVA 2BUNA 4TYAA 3D0HE 4WXWA 4XPEA 4UQGA 1NO8A 2VPWB 2BJ3A 2O01C 4F4XA 2C2RA 3MEDA 1VQ8S 4B3MJ 3MEKA 3IAM9 2Y3YA 4J91A 2DXFA 5ETVA 2VG6B 2MGZA 3HSJA 4FPIA 4ZHRA 4QU7A 2BJDA 1T9VA 2JSXA 3QWPA 3V6DB 4JI1J 1F9HA 1EP4B 1U25A 4JI1F 3IR7B 3VQTA 1LV5A 1AFJA 4LR8A 1PJ6A 1WC5A 3HVAA 4UUWA 4C48A 4CDIA 4U95A 4MMOA 3HFVA 3BR8A 4HH1A 5HBMB 4DV2F 4ELTA 3TR5A 4KT0C 4F0MA 1FRXA 1JKHA 1RLDA 2VFVA 3GLJA 3IA0A 1UP1A 5KT7A 1FERA 2B5JA 1W25A 3X1LB 1X8DA 1Y9OA 1SQGA 3M2UB 1X4FA 1MU2B 2JC1A 1YDLA 1KC8T 1J27A 3MWBA 3SCLE 2HKEA 1T9UA 1FF2A 2CUYA 2K8GA 4J9VA 2DCUB 1S1XB 4USHA 2I38A 3ZC4A 5HLFB 1FJCA 3HT0A 2VOOA 2IBKA 2CFXA 1RXOB 3N01A 1D9DA 4P6QA 1UWAA 2FHMA 1RBLA 2IFXA 1GTHA 1Q8LA 2ZH8A 2VA2A 2PMZD 4DR2J 1TKTB 3K89A 1NBEB 5J2QB 2DK2A 3MMCB 3E51A 4ZJOA 2EC2A 4JV5F 3QAEA 2DHAA 2DGUA 4TU9A 2MQPA 2BW7A 1RWNB 5DJBA 3FNNA 3D5MA 1VR6A 3HFZB 2E29A 2ZUAA 3M1VB 2WBMA 1T0TV 1ZBTA 3BDEA 3D28A 3EICA 1YJ7A 2LQ9A 2MKJA 2XMKA 5J1EA 4DQQA 3Q0AA 2VG6A 5C25B 2UUCJ 2BQUA 5K8PA 3FC9A 3J81Y 1QJHA 2QX0A 4DWIA 4KKOB 3H25A 3PZPA 1IKVB 2CZ4A 3HHLD 2B9YA 2YBVA 4QWCA 1QY7A 2HZVA 3QZ7A 1CJVB 3M9NB 2H4YB 1BQMA 1NHKL 1V5VA 3BN4A 1R0CB 4NI2B 1WEZA 2DBBA 4K5SA 3TQ1A 1FJEB 1MYKA 2YKOA 4USKA 1X5OA 3R5JB 2YWEA 4W4MA 4UOHA 1CJUA 3FKBA 3VZIA 4WU3A 5LSLA 2OPSB 5GADI 4DSIA 3JQJA 4MKBA 4JBCA 3CDAA 3OSNA 4EMDA 2VIHA 3DNCA 3WQPA 1U2FA 2RRNA 4HHJA 5DQHA 2UU9F 4B17A 3HHLC 2B4VA 3MPYA 4D3HA 4MFBA 4DL0C 4J5OA 1QM9A 2B6AA 4LRBA 2W9AA 3CJ2A 2FQQB 3OUYB 3V6KA 4DX5A 1FWPA 2BMBA 1R6VA 4DV6J 2HFUA 4G65A 2J6SA 3FQKA 2DGXA 3MXHP 5GAEU 1JJ4A 4Q8FA 2R2TA 2MSSA 4OYPA 3PJXA 1S6UA 4P72A 4DL2A 2VQEJ 1FCAA 3F0NA 3T19A 1VDHA 2YQ0A 5DG8A 2BJ7A 4YFUA 3JYTB 3PW2A 3PX6A 3W66A 2B4UA 2N7YA 3U1MA 1DFDA 2R8HA 3OLAA 4URQU 1UKUA 4CNYA 4FVCA 1F5AA 5KFYA 3QSYB 3L3CA 1LXNA 3Q8VA 5BYRA 4NLDA 3NRBA 1M5OC 3LH2S 2DYAA 4M5NA 3V2UC 5KFBA 2XEXA 4ZPWR 2FLPA 3D54A 1RYRA 1GAOA 3IXQA 1ULRA 1L5UA 1CJTA 2ASYA 3UDVA 2MZJA 1FTCA 1C0TA 4NA2A 5KFEA 1VQ5S 2ZBPA 4I2QB 1K44A 1KLMB 3S8SA 2M7SA 4ZVTB 4TY9A 1Q81T 1HNVB 5IM0A 3PYFA 2ZM6J 2HVIA 1JLCA 4GRSA 1NMEB 5IQQA 2XYGB 4MKYA 3OL9A 2N4DA 3KG0A 2UXCJ 4DU7A 4OHVA 2M70A 1NJZA 4WFAQ 2DXEA 2GO8A 4DOZA 5GAEI 2WTFA 1J5EJ 3W2WB 2DPIA 2VDIA 3FJ2A 1J5EF 1TL4A 5JXSA 5ITHA 3WBZA 1I1GA 3CDUA 5LMNF 1RKIA 2JBVA 4ELUA 1TKXA 2FJDB 2CPHA 2KDOA 1H3DA 2E7XA 1DAXA 1VC6A 4Y28C 5KTQA 1WC3A 2H1YA 3Q86A 3ZZ0A 3VAJA 4WIIA 4ZOSA 2RH3A 2L3MA 2CPFA 1QUPA 3KDOA 4QR0A 1S12A 1VFJA 1B7YB 2CQIA 4B9UA 2D7SA 3MM7A 3S1TA 4X62F 3PO4A 1G2EA 5AT1B 1B0VA 1RT1A 4RW4B 4ZP8A 4C0BA 4F0HA 1TMMA 2ZH4A 1NZAA 3DHWC 3M2VB 2V2QA 2Z2LA 3LP1B 4HR2A 2VDHA 4DZ6A 1OY9A 5F9LA 1OQ3A 4W98A 3FUYA 2JLFA 4PG7A 5KFOA 3VVUA 1U1OA 1VQOS 2E5LJ 4OYOA 2WSFC 3QT8A 1R31A 1SH3A 1EJ7L 5EX3A 1U1QA 3BJYA 1Y5NB 2N3LA 3BGUA 4FVMA 2HAIA 4I6YA 3KG1A 5F3TA 3WC0A 1DTTB 3DMJB 1N5SA 1ZTWA 2WOMA 4NA1A 4YEAA 2BJ1A 2OSRA 5F0UA 5RUBA 5KFSA 5HL7Q 2ZVIA 2DXDA 1S6OA 2A6MA 2GFFA 2R2RA 1FKOA 5K9FA 4ME7E 1D8YA 1UVNA 1JLFA 1VHFA 3EZ5A 1HBOA 3T6BA 1UAWA 1NK7A 3SSRA 2D9PA 2JVRA 2WW8A 3PY8A 1WDDA 4JI4F 4JI4J 4PUOB 4DPTA 2H3EB 5IT9Y 2QN6B 1HI0P 1MYLA 2Q79A 1B99A 1HQ2A 4YB7A 3N0VA 3S01A 5F8MA 5JVGQ 1FFWB 2KFYA 2CVEA 3CDEA 5LXYA 2XZWA 1SKSA 2DO0A 1BXNA 1OPZA 3EM1A 2P6TA 4KYZA 5ETPA 3ZZTA 4B9MA 2OPQA 4OZ3A 3Q24A 2HQ3A 4DXLA 3IR5B 4ZPDA 1SC3B 3VGUA 4B3OB 3D6TB 3QT7A 5D4LA 2DGOA 3TZXA 1NKEA 2OMOA 1YJWS 2KT2A 2R9LA 2HRYA 4USIA 4M94A 3ISZA 1EAYC 1RT3B 2MZQA 3FFIB 5E41A 1YRUA 4ALZA 1JJ2R 1JX4A 1DJ0A 3LWMA 4NZ0A 1N0VC 2FYXA 4CLPA 3RU0A 1BQNB 3H5YA 2LFVA 2Q3PA 4M5MA 4OYMA 4D3GA 2AD9A 1T05B 3TUJC 3KMQA 3OR2B 1AW0A 2B6AB 3DFEA 4B9VA 2JDJA 3KJFB 3MD3A 3W65A 5I3QA 3KLFB 2ZWPA 3P6YC 2FZKB 2AYEA 5DG9A 1RWPB 1CQMA 2MKCA 4RBTA 4Y6IA 4FDFA 4CT8A 2M8HA 1LQ9A 3LP0A 3CJ4A 2O5DA 3HHKA 5G0RB 3NP5A 5LSRA 2DNNA 2V8HA 2O3DA 1TU0B 1IM6A 4RZRA 1NPKA 4KRWA 1XR6A 2OEMA 2CQ1A 2ZJPQ 4CH7A 4ZVFA 2Q43A 2Y8YA 1KWMA 4DV1F 1F2GA 3AOAA 1JLAA 1B4SA 2LVWA 3OFHA 4U8YA 3VCDA 1T7PA 2VPYB 1VQNS 1TAUA 4P74A 3CCSS 5LMUJ 5KT6A 2OFGX 2I5JA 1UJ6A 1W26A 1WTBA 4QPTA 4K7QA 3NO7A 2L9DA 2OO4A 3HMJG 3PG9A 2ZNYA 4K4TA 4Q0BA 5DO2A 4NLUA 4QIVA 3G8SA 1XK8A 2AU0A 3MURP 1Q86T 3DI6A 4KHPJ 5AE3A 5J1EB 3KMSA 1H74A 2LP4A 5DGAA 1S97A 3CD6S 1HMVA 1RT5B 5DDRC 1V9OA 1FK9A 1M90T 3BO4A 4I68A 4V1Ak 4NYPA 4JYAF 1U09A 2BKPA 4RWXA 4DLGA 1L3TA 4L3NA 2AV5A 1HHSA 3F41A 3ITHA 4X65J 3MR6A 3AXMA 5FD1A 3HDSA 3BQ1A 1WDTA 1K9MT 3QRQA 1Q16B 3KK3A 3ISNC 3DM2A 3TYTA 3Q8QB 2L9WA 3DLLQ 4DV3J 2EFQA 4ZJLA 4DR3F 4F8RA 4LF4F 1CS4A 4G1PA 3VGSA 3OHAA 2Z2MA 4H4KA 1WKJA 2CQCA 2BNWA 4LR9A 2E5GA 4R0EA 4F04B 3IP0A 4AL6A 2W4DA 1U8WA 5I3UA 4F36A 4B3SF 1YQHA 4Q2MA 4DPWA 5IV4A 3GYXB 4WU2A 1LKZA 3G8QA 3PFEA 4HH0A 1GMUA 2EBEA 2W01A 3NGKA 5D0EA 1H38A 1VQMS 2OPRB 4XK8C 3AD9C 3SBMA 1HPZA 3SSSA 5DDPC 2FD2A 4WFXA 4WFBQ 2HFNA 3KK3B 2QLJB 4A4JA 4KSEB 4IRCA 4HACB 2V68A 1WF1A 2WCXA 4ZN3A 2PMHA 3FRZA 4ES1A 5IZHA 5AE1A 5LL6d 2PE8A 2K1OA 4ZIVA 4YHHJ 1Z1ZA 3HD2A 3O1LA 3W5XA 3CJTA 2D3OR 1RAOA 1Y10A 3OVSA 2MY7A 3AJDA 5AJ3J 3PHEA 4KBIA 4RBUA 4O23A 3W64A 1N32F 2XI3A 1TELA 4JP8A 1U47A 3AXKA 4Q0BB 2V0NA 5KT2A 3W5ZA 1VK3A 2XMWA 1U1MA 3J7A1 3RG6A 5FJ4A 2AMCB 2HMIA 4K4ZA 3IO1A 4U67Q 1D0EA 5T7LB 4MK8A 5LMUF 1S7HA 1MROB 4ZVGA 4UZBA 3W5YA 3MECB 4HT5A 1KBRA 2QJ3A 4WE1A 5DLFA 1L3SA 2I6WA 4OQJA 3M05A 1RT6B 1H7XA 3KJNB 4FYVB 2F8HA 1VC0A 2LU2A 1FXRA 1WD6A 2B8QA 2HGNA 4UOCA 2GVZA 4ILRA 3TJ9A 4DDFA 2LECA 3HVWA 4MKAA 4JYAJ 2XCPA 4NCGA 4YS2A 1NK8A 2FLNA 1KQKA 1GX6A 4KFBA 4LF6F 1B7FA 5T41A 3DRSB 3ZNJ1 4CNZA 3KLVA 3FMTA 3T5JA 1L3VA 4WYWA 2RRAA 1KSPA 1AA1B 2RDIA 1VBKA 2AT1B 3KNAA 4DG1B 2YNFA 4PQUA 2OLWA 1XWLA 3UFCX 4N5SA 3EXYA 3K17A 1IM4A 5GADU 3K5MA 2VB6A 2BW2A 3EVMA 2XM3A 2B0GA 2H5JB 1NSQA 2HIYA 1FNXH 2HG4A 2ZITA 5T14A 1WG5A 3GYGA 3MI7X 3MM8B 3K58A 5KFUA 1QTGA 4FZVA 4DG1A 1RP5A 4DV5F 3PDNA 3J7AN 5F8GA 1FTRA 3ZZZA 2W8LA 1FKPA 4P7VA 3K5NA 1OYEA 1ZZFA 2EXUA 5E7OB 5A6WA 3JAMY 4L3KA 4DL4A 2FJEB 2GHVC 4BWMA 4JI5J 5J2MA 2VG5B 5EWEA 2XB2D 3NGUA 2NQPA 2R4FA 3IAS9 3MPWA 1UCNA 1I94J 4TVAB 3KLGA 3MFHA 1T3OA 2FVCA 1WI8A 1HHTP 2CPIA 5D0HA 1DTTA 2MLZA 2KRBA 2Z4PA 3DMJA 2PGCA 2PN6A 2ZBIA 4WE1B 1P8GA 1QAXA 3AOBA 4CLZA 2NZ4A 1KONA 3F44A 2XS2A 5KFTA 1WHVA 2HBRB 3IGVA 5DZ6A 3PVXA 4X64J 2HK2A 2FHJD 2BANA 2K29A 2Z8QA 2HFZA 2W9CA 4FF2A 3O44A 4OV1A 3UD4P 4IYQA 5K5MA 4X4UA 3KOAA 2J7UA 2X7IA 4CLYA 3HD1A 3GP9A 1JXVA 4NX9A 2DY9A 4ZLLA 1S0OA 5IT0A 3JSBA 4KGXB 2IMWP 2JXIA 2YKAA 3TWZA 4B02A 4BDPA 4NEYA 3TJAA 4ED3A 4MKVA 2E5JA 3UVJA 3EYZA 4UT4A 2JC0A 2NUHA 3DLEB 4JUZA 4DSLA 3Q2TC 3MOZA 1WSRA 1XNQJ 3TEGA 3M4XA 1AXQA 2WB4A 3H40A 3TARA 2YX7A 1YWXA 4IR9A 2J9EA 3M30B 3C3LA 3RBEA 1M5KC 1SH0A 1SB6A 4HI2A 4KAIA 4B08A 4ETZA 2U1AA 5M2PA 4A8YA 1U1NA 3CSKA 5E0OA 2WVCA 4FPRA 1GMWA 2YPZA 3G6XA 2HVHA 5E3AA 2RKIB 2J5AA 3GG1A 3QQCD 3SQOP 3N9UC 3HHLA 3QGHA 4IRDA 3NMRA 1LW0A 1REVA 2QA2A 5A8RA 1PYTA 1HNXJ 1QAJA 1Q8KA 1NH7A 1N56A 1XTZA 1H98A 4K4XA 1UWBA 1T03A 2V50A 1XMBA 1NSPA 3NWGA 3R5CA 2JH3A 3L7UA 5H9FJ 5I3UB 1YJUA 3R2DJ 3FCHA 4U9RA 2KYXA 3M9OB 2CNKB 5H9EJ 3EZOA 3HF5A 3NBPA 2VFTA 4O3OA 2OH2A 1IBCB 2CG4A 3E01B 5GAGU 2IDEA 3HHEA 1SQEA 4ECWA 1P94A 2BJ9A 2HURA 1N48A 3L9ZA 1CSJA 3AD7C 2B7BB 1S0VA 1FA0A 1TAQA 2WVDA 5DDQC 3KHHA 3DRYA 1R0BG 1S99A 3TW0A 2AJQA 4HTJA 3OXLA 5A8WB 5CXTA 5HQLA 5CCMA 1YITS 2DHSA 2P9EA 3OUYA 1TL1B 1X4BA 2KT3A 3K8VA 4X4TA 2NYHA 4NYOA 5D6GA 5C24B 2HHPA 2AIRB 4V19J 1S57A 3BKTA 3HULA 1XBWA 5ETTA 2CQ2A 2YWGA 2N3OA 4C8KA 1JLAB 2DKOB 1P9QC 3RAXA 2UV8G 4C3KA 4CLUA 3JTOA 4MIAA 1WSVA 3CIMA 2RDDA 2C2EA 5L9NA 2JLEA 4EWTA 1G6BA 2VH7A 5G0RA 4CM2A 3K59A 3OBIA 2CPXA 4U7UK 2OTJS 2AJ1A 2G13A 5A8KA 2PI4A 2L48A 3W3SA 3SCKE 1N33J 3C16B 2DR5A 2GGPA 4DL3A 4X4SA 4DQSA 1WEYA 1PILA 1L3UA 2NXCA 4DQIA 2YKNA 2YY3A 2RQKA 3OTEA 3PM9A 3W2VB 3CIZA 2JLGA 1FJGF 3BGLA 3QT6A 2QLWA 1FDDA 3KUHA 1S0MA 2V4JA 2VF3A 3MAAA 4P71A 3GCWP 5DRKA 3KJVA 3CTRA 1T03B 2QMXA 4KV8A 2QTWA 3B6BA 1Q8IA 3QWUA 1TK8A 1XMQF 5C42B 4OL8A 4L74A 4DUZF 1IKWB 3NXZA 3DOMB 4XIUA 1G3OA 3ONQA 1HNIA 2GVDA 5AXNA 1WKKA 2AEMA 4DLEA 2ZHOA 1UPMB 1BC6A 1UWBB 3IRXB 4K0KF 2CNNB 1UTAA 2HEKA 1BDTA 3RZAA 2ROGA 3B4MA 4O4GB 4OHXA 3PR5B 4J9SA 3HX9A 1LEOA 1OJ4A 3L09A 1EKSA 1PKUA 2CJBA 3MCSA 4I56A 4DUYF 1U1KA 3MEGB 5B0FA 2V6AA 4C98A 3D68A 4TXSA 1R7IA 2E66A 3GB0A 3IBFB 3SV4A 2UUCF 1X4HA 2A2CA 3CEDA 3CVKA 1CULB 3CF5Q 1UFKA 1G4CA 1X4GA 2BKOA 4R25A 4FYYB 4LFBJ 1PARA 1T9WA 1NSKL 2E5IA 3FZ2A 3R5AA 1SV5B 3M30A 4DZDA 2RIJA 4J9MA 3VWSA 3PW0A 1S9FA 3HM9A 1MMNA 1E6VB 4K50A 3T1AA 4KHRA 1HBOB 2FLLA 5EN1A 4DL6A 1NHUA 1IQZA 5DGBA 5HAOA 3D0GE 3BN7A 1UL3A 3M2RA 1WEXA 3SCIE 4NXMJ 3ILOA 1N88A 1LWFB 3KLIB 3SQGA 4IG0A 3QPIA 1N34F 2YQ1A 3H8YA 4IO9Q 2D41A 1RT1B 2LDIA 4RW4A 4TNOA 3CO9A 3CCRS 1WOSA 1WORA 3DLBA 1YI2S 5G4DA 1KVKA 4ELVA 3EGWB 2DNLA 4RR5A 1VISA 3HSZA 4UQTA 3ICLA 2ZH9A 3HHNB 1RAEB 5BYQA 3CJRA 3KLIA 4P9SA 4DBQA 1OWXA 3M2RB 4L6V3 1QLNA 4LQ9A 1T8EA 2JEIA 5J2MB 3P5BP 5MLCV 2QMWA 2VC0A 2GW8A 3FEYB 3LPYA 4YR3A 3MPDA 1VBYA 4FF1A 1RLCL 5ETRA 4LREA 4QQBA 4J9PA 1RHKB 2GIFA 5I42A 1HD1A 3SFUA 1Y7PA 2ZNZA 4KPCA 3UO0A 3OR1A 1WC0A 3GFHA 1FX4A 5DQIA 2CQ0A 5K14A 5EGYA 2ILZA 3GIMA 1FJGJ 3NMAA 2MEWA 2L9NA 5HQMA 4PPZA 4UOFA 2JXGA 3DRPA 4RUBA 3Q8SB 1RU1A 1Z2LA 2YNIB 1XMQJ 4RLEA 2C42A 1TMJA 1CLFA 3DGVA 1XN9A 4MK7A 2ATCB 3I31A 2AZ3A 3QO9A 4NWBA 1NJYA 1ITPA 2XGQA 3CGIA 2G2YA 3JXOA 1GXLA 1ELOA 3DGPA 4AT1B 2DISA 3V81A 2CVIA 5B0BA 3LGMA 4CLKA 5H1SV 2ZE2A 1YSJA 2DH9A 4TLQA 5FIIA 4OX8A 3R5GA 4PQAA 2KHDA 4WXOA 3ENVA 1S1TA 3QT5A 2H9ZA 4JI8F 3J81U 1Y4ZB 5HVHA 3OL6A 5DG7A 2V4RA 4QR2A 2OGUA 3IR6B 3Q83A 2R8GA 3GJSB 3MCMA 2E9ZA 3NGRA 2IDLA 1RKJA 2JRSA 3B54A 3TEHB 1X4DA 4KFBB 4NYZA 2A2DA 4CO1A 2GGPB 4DFPA 4NCGB 1IBMJ 3ZZPA 1KS2A 2D1CA 3H0PA 1S48A 1UFWA 1X5TA 4MFBB 4WKYA 5A8KB 1YJRA 5DLGA 4M5IA 2A2BA 1ZZNA 5KFXA 3C15A 5HN0A 2BZ2A 2XHCA 4WZMA 2K6LA 3VAHA 1S7IA 3R7NB 2ZKUA 3D1HA 1B3TA 3LP2B 3MZIA 1HNZF 2ZZNA 3K5PA 5K20B 2V94A 3BGFA 3FBBA 1RGVA 1SJ3P 4OZNA 1BWVA 1OS5A 2M4MA 3NEKA 3M8SA 4PWDA 3HKWA 4N56A 1MROA 2OP5A 3HCXA 3UDEA 3JAMU 1FJ7A 5LXRA 2J7WA 3KTQA 2BE9B 1RE1B 2XLJA 1HWJA 1OIAA 1BDVA 2DRAA 3BGOP 3C6TA 1Q7LB 2BR0A 1QAYA 5SZTA 2QA1A 3AFGA 1TVRA 2FB0A 5ETKA 3R3TA 5A8WA 2B9EA 1G7CB 3N4WA 1FRMA 4P2XA 2QIFA 2EG1A 3D66A 5J2NA 3OVBA 3I56S 4ZPBA 3OV7A 4CLTA 1H2UX 1JLGA 2YKPA 5F0WA 2MZRA 3AB4B 5B0EA 5C25A 2IAJB 5BR8F 3QLHA 3DDKA 3NBPB 3EGNA 4YDXA 4F4YA 4LF5F 3CCES 2FVQA 1T11A 1CVJA 2V9WA 4C11B 3MM5A 4DV0F 4OJHA 2GQQA 2C3OA 4PEOA 2F63A 2ZH7A 5DQGA 5D4PA 3RBDA 4LF9F 1S9GB 2RSQA 2X1GA 3CO0P 4M95A 2J9CA 3KKFA 4DI6A 4H4MA 6FDRA 3TA1A 4C9DA 5KFMA 4RPFA 1N6QA 4QZVB 2B5JB 2CJAA 2FGCA 4M5HA 2ZVSA 3VAMA 5IWAF 1TL7A 4JOUA 5KFVA 3UI3A 2X3GA 5C5JA 4N8NA 4DV7J 4ETXA 2ZOFA 5HBMA 3AA9A 4DV7F 2G0CA 3PEHA 4OI4A 3W61A 2HQFA 5K8MA 1Q16A 4Y3CA 2IJNA 4WFYA 3M2UA 3FDSA 2LMIA 2LXIA 1S9EB 1LK5A 4ZVPB 4YHHF 3JTPA 1N52B 3ITHB 4LIWA 2RUSA 4KJIA 4GKKJ 3NL0A 3VEBA 5CHCB 3PYGA 3W7BA 4O3NA 2G0IA 2IAJA 4KC5A 4LFAF 1H72C 4L73A 3OHBA 1WC6A 3C14A 5HMXA 2ZH1A 1DLOA 2MKYA 2WK4A 4B9LA 1EP4A 1LWXA 1RT5A 1VYAA 2A6OA 3PCOB 1XR7A 3BKUA 2BXJA 1U6FA 1H6KX 4PPDA 2MQQA 1KP6A 3KHRA 3BGRA 1YJTA 3C6UB 4ZVQB 1H2TZ 1HWUA 2MGZB 4LSNA 1WC1A 4PG5A 3MR7A 4F4ZA 3NAHA 2M2BA 1T95A 2AJ0A 2BANB 1T9XA 4R8UA 3LP2A 4DX8H 2H48B 3I5AA 4IG3A 3CCUS 2CQGA 1QVGR 4LBHA 3NLCA 3MTJA 5KOWA 4QU6A 2KXHA 1RACB 1RHUB 4ZVUB 2U2FA 1I3OB 4PWDB 3PKYA 1R8BA 1RT4B 1UFLA 3FCVA 3HFKA 4JV2A 4FF3A 3QJPA 3TUPA 1HQEB 3C8YA 3SFGA 1U26A 5E5NA 3KLGB 2BJ8A 1EB0A 3BYRA 4CI0B 3P49B 2AJ2A 3ET6B 4CWBA 5ETNA 3NNCA 2XSJB 4P2MA 1D9AA 2VG5A 2N7CA 2VD3A 1Q4RA 4HTIA 3JSMB 3GIIA 1MG7A 3ZTQA 5B0CA 1B28A 1RHQB 3A4TA 3BR9A 2PFDA 4MH8A 4QYRA 2XHWA 4QBUA 2AX1A 3TZZA 3T5LA 3O2IA 3FMWA 5MAOA 1MNEA 3QMQA 3TVYA 4PCQA 4PXDA 3LGHA 2R7TA 5IQ6A 1R6YA 4ZVSB 2LA4A 3FFIA 2ASJA 3ZZOA 1U8SA 4F67A 2EG2A 3H7HB 1WF0A 4ZVEA 4WFNQ 4OI0A 3HVTA 3DOKB 4LSZB 1D9FA 2AEFA 1P1LA 5JVHQ 1RJJA 2IM3A 3GIRA 2FJWA 4C8ZA 4OZ1A 3BZQA 4ENOA 3GXQA 4I6WA 3DDNA 1H2VZ 5DM6Q 3CCWA 3VEAA 3V6HA 5JUMA 1UVJA 3WIVA 1TL3A 3Q8UA 1RAAB 4HHUA 4P7TA 4F4AA 2XCAA 5K14B 3CW2C 3U7JA 2DGQA 5AE2A 2AGOA 2IBOA 4PAAA 1N5TA 1ZAWA 1CC8A 3QGPA 4DR6F 2DNOA 4OZJA 3PR4A 4GKKF 5EWGA 4OZ0A 1S10A 1S1UA 2AYBA 4O3QA 2GV1A 5HMZA 3HK2A 3A3NB 5HROA 2J6UA 2CZ9A 4OI6A 1GFWB 2UUBJ 4V19X 3G82B 2XY6A 1KFDA 4URGA 5HK4A 3DOLB 1NDPA 1B0PA 2UXDJ 2AJ4A 3SZ2A 1RA6A 1KDNA 4YB1P 3MECA 1X4AA 2V5HG 2KB2A 3MDFA 4OX6A 1RT7B 2DHGA 3ENAA 1PYSB 3IBWA 2VHGA 1YTYA 4BS2A 2W7AA 1RTJB 1U0HA 3IMQJ 4PG6A 4YQWA 2KM8B 1NNDA 1FRLA 2I1RA 4PXEA 1R0AA 2I2YA 3K0JA 5EX0A 4JV0A 2VOPA 3H90A 5KG1A 1HYSB 4CO4A 1FRJA 4J9NA 4NLPA 1MMLA 3KDNA 1YHQS 3HZEA 1WG1A 2YWFA 3EGZA 4Q43A 4B3MF 3G6VA 1ARRA 4O3PA 4IO1A 3UDLA 2CWKA 1F5CA 1Y3JA 4RL1A 2Q2KA 3CCVS 3PKMA 1F3FA 4YOEA 4G1QA 5CYQB 2HBZB 4ZCLA 2KO1A 3AJ1A 2M9KA 3THPA 5E3RA 2WVFA 4H4OA 4PYAA 3WIUA 4EO6A 7AT1B 3OFEA 5J1PA 2ASDA 5GAGI 1FFGB 1E6VA 4M1KA 1CJKA 2XTJP 2JX2A 4NZ6A 4OI2A 4DCOB 2KG1A 2MHNA 5IM0B 1YKWA 3AB2B 4GO5X 2GCFA 1KLMA 4F50A 3L7OA 4IDKB 1VI7A 4DEZA 4B3RF 2OPRA 1V5IB 2DH7A 2ALZA 1AZSA 2FHJA 4F4KA 4O3SA 4KR0B 2HWIA 1HYSA 5I3PA 3I55S 1IBLF 2CJKA 2DHHA 2DT9A 3MMAA 4Y65A 4CO5A 3I0SB 1Q0NA 3TRGA 3GV7B 3LOUA 2FJVA 2CXEA 1C0UB 1YRTA 2D3UA 3N5BA 3RB3A 3ADAC 2VKZG 3VW4A 4J9LA 2OEKA 4J90A 3V4MA 3B82A 4L76A 2ZD1A 3RW6A 2IRXA 3ULHA 3DKDA 2RJZA 4CT9A 2C3YA 3FQLA 4H54A 3UD5A 2HZAA 2OUGA 3W63A 2QL5B 3BPSP 4F7VA 3DOMA 1PAEX 3TNVA 4OX7A 2LQJA 3O6QA 2RNEA 4LQ3A 1EZZB 2KN4A 1S79A 3BV8A 3GTYX 2C2KB 3BDPA 1RT2A 4AL7A 4WK3A 2PC6A 2FVSA 2R2SA 3GCXP 3W9JA 5HMWA 2GZOA 3M8ZA 5J2PA 4NRTA 1V3ZA 2FUG9 1X31C 2HQCA 4OV6A 2W9BA 1FWLA 2IA0A 2Y1RI 4ECXA 4ZP7A 1NPPA 4LF7J 4G3IA 2UXBF 1APSA 3IWXA 1M5HA 3ENWA 3U27A 3HT3A 2BQRA 4H4KC 2RHSB 5IXUA 3GFZA 3UCZP 5KFGA 1IR1A 4USUA 2WVBA 2A3JA 1P27B 2D3O1 1RTDB 5ETSA 3BSOA 5DETA 5KFNA 5IT4A 1R89A 3KK2A 3KK2B 2XBPA 1SC6A 5L1IA 3TQEA 2FC8A 2RMLA 5BYSA 2KOEA 1BQMB 4NLVA 5HMYA 4WYLA 2GNKA 1XC9A 2NREA 4W92B 1Q78A 1VIOA 2OFHX 3GJTB 2VUGA 1MWQA 4KKOA 4ID5B 1GK8A 3D4JA 3RGIA 5KG6A 3ELHA 2CQHA 4ED0A 9ATCB 1IRQA 1ZM4A 4L75A 3UWTA 2CAXA 1Q5YA 3DLKB 1RWVB 2V69A 1IWAA 3MM9A 4Z7YA 4X4QA 2RS8A 1N5VA 4DR5F 1NAQA 3HZGA 4J9KA 5B09A 1VBZA 2R7QA 2I0XA 2ZD1B 2I8EA 3E01A 2K1RB 3I5BA 5B0AA 3KHGA 1ZTTA 1R8CA 4GO7X 1LW0B 2EWHA 1TL7B 4ECSA 3CMES 2R7RA 4Y00A 4JI3F 2W4CA 2B4PA 3QIDA 2RKIA 4PWWA 2BYCA 3UNGC 3I0RA 4QYZK 1IKYA 1S1VA 2Z56B 5A8RB 2OTLS 1ZA2B 2QMUB 2YQ3A 4ZVOB 4A47A 2XS7A 3MM6A 5C7PA 3ISND 5F8JA 3D1QA 4ED8A 4I1TA 4KH1B 3SCJE 2E7VA 3OTDA 3D6FB 3EJMA 3GU0A 4F4WA 8AT1B 1F3VA 1JLFB 1W7WA 2GAHC 3DLJA 3DLEA 3EVWA 4TN2A 1VQ7S 2LLZA 1KRPA 1UVKA 4FNIA 3AHPA 3MF5A 1A7GE 5K8NA 1KR4A 2R2UA 2Y9HA 2V67A 3G86A 3MR5A 5B08A 3UDCA 1C4CA 4TU7A 1D1UA 2QL9B 4LT6A 3MR2A 4IOAQ 4X66J 1RAGB 2J8AA 2YPYA 2BJEA 5HATA 4W90B 4X66F 1OG7A 3WX8A 5B7WA 4EEYA 1VRQC 1SJQA 2P5VA 3CD7A 4OMFG 3C6TB 2ZH6A 4MK9A 1J2VA 2YKMA 3LP1A 3CJ0A 5D4NA 5IFMA 3KK1A 2EEYA 2RU3A 4ED5A 2ZHAA 1UZDA 3DRRB 5L1JA 4AQYF 4X62J 3C66A 3IS9A 3V4IB 2BKNA 3ZXWA 5KG0A 3H20A 1WOPA 1S49A 3OTOJ 4TU8A 2J9DA 4ZKAA 2ACMA 2GMLA 1AYEA 1A6LA 4ES2A 1LK7A 2WAQD 3PEJA 1EQMA 3MAHA 4JI2J 2HNZA 4URSA 3AAWB 4U96A 4F2RA 1NSAA 3NS5A 5CYMA 1NJXA 4QIEA 3FK4A 1NLAA 3N6MA 4IOCQ 2GX8A 3OTCA 2POKA 2WVEA 2ADCA 4B9TA 4WZQA 2M52A 2CAJA 2B43A 1HBUA 3DOLA 1VS3A 3MUTP 2ATLA 2LKZA 3M8QA 1Y5IB 2C1EB 4KO0A 1N6QB 4F02A 1AFIA 2QE5A 2XZDB 5A0YA 3R2CJ 4UUXA 1KVJA 1Q5VA 1NM2A 1JK9B 1FVSA 3J7YI 3DDIA 1M0SA 3ILJA 1VQKS 2D3ZA 1HNVA 1YK9A 2CJQA 3I32A 2DEJA 2G1HA 3BYPA 4ED1A 1RHRB 4IR1A 1L3KA 4DF8A 2J0QD 1MLAA 2CPYA 3NGDA 2J6TA 3HVTB 4ED4A 5A2QU 1TL3B 4UY85 1SKWA 5F8HA 3PTWA 2MJNA 3GONA 2EFGA 4NA3A 5D0GA 3MCNA 3MM8A 4CO2A 1NKBA 3BKFA 3RR8A 1RTHA 3VQSA 3NG8A 4NLXA 3OFFA 3DRSA 4DR7J 1NUEA 4IFYA 4GVBA 4RWWA 4NCBA 2YNIA 3M7VA 3VGVA 2Z2YB 4WFZA 5KFJA 4I6AA 3UR3C 2F8EX 4EI2A 4C2MA 1M1HA 1DTQA 1TR0A 3HKZD 2YNGA 3RBXA 4WP3A 1HR0J 2F4VJ 3M8QB 2GJFA 1RBAA 1GXUA 1RAHB 2W2MP 3JQMA 1K47A 4M5DB 3VALA 1HR0F 2F4VF 2IJRA 3PACA 1DBDA 2EVZA 3PRBA 5CYMB 5DM7Q 4K4UA 1YBAA 1YJ9S 4CO3A 2AY0A 2XSJA 2DGVA 4LRVA 3T41A 5T7LA 3LANA 1EQ0A 1FESA 3DLGB 1TP7A 3D9BA 5AXKA 1HI8A 4K4YA 1UVMA 3G9CA 1RUSA 2FGOA 2BOPA 2F5GA 4Y2IA 2KU7A 1FE4A 1NDCA 3H42A 3UNYA 4TLRA 4MJKA 2B9XA 2J8SA 1XIQA 2XMAA 1CJVA 2QZ8A 1NXIA 4DV1J 1YJNS 4OX9J 4Z2XA 3ZNUA 2IVMA 2DR7A 2JWNA 4CLLA 2RE1A 1DLOB 4QW8A 2RS2A 2E1CA 2ROPA 5EDWA 1VLOA 1UVIA 1B0TA 4PKDB 4TQRA 3BGRB 4RX6A 1XNRJ 2HPUA 4EUVA 2FVPA 4AAIA 1GMWD 1TKZA 1Y00A 2CWXA 5HQ8A 1XEZA 2IY5B 2SXLA 1SV5A 3D3BJ 1HLWA 2OI2A 2VFSA 3G8TA 2XLIA 2BQ3A 1K0TA 3KG4A 1S1VB 2CJYB 2V2ZA 2Z0GA 5J2QA 2KXNB 1NEEA 2ZJQQ 2YWKA 3A13A 1CG2A 1RAFB 5D4OA 2QEXS 1SL2A 4X65F 1OHNA 1T02A 2YVSA 5E3CA 1HW9A 2V34A 4X4VA 2ZUGA 2Y0SD 4CO0A 2PDAA 3DN9A 3RRHA 2G0JA 4O4GA 1SJ1A 3CB4A 1IJFB 3EMTA 1TFWA 1YVFA 2ALYB 2KI2A 1B70B 3M6XA 5HO4A 2DPJA 4Q2LA 4RW8A 1ZH5A 4KGVB 1DRZA 1YRXA 4YB6A 2LEAA 2CQPA 4WK1A 5KFKA 1O8BA 4OYIA 1VCTA 2OJ3A 1FNOA 1F0XA 2CPZA 4FF4A 1CS4B 2VBWA 2PD1A 1U45A 1TV6B 4J9QA 1MNTA 1S6QB 2BE2A 4TKTA 1WC4A 4MIWA 2XMUA 2MYFA 3AT1B 2O1PA 4WTYA 3MFIA 3MM9B 3ENQA 1KTQA 2QSFA 3G5OA 1RQ0A 3DLKA 3SEOA 1AUDA 2YKNB 3O5TB 2MZSA 1FVQA 4ZHRB 2MKHA 4RU2A 1S0NA 4NCAA 1SL1A 1JMTA 1TVRB 1VBXA 3MUVP 3NKYA 3BBCA 4KGKA 3CCJS 3MGJA 1CPZA 2MQ8A 1T9TA 1EETB 1LWEB 3PNIA 1AB8A 2QT7A 4FXEA 4O0NA 3ZFVA 2C28A 2ZOMA 4AXJA 5CH7B 4HDGA 4CH1A 4PWUA 1ZM3A 2FHOB 3DI6B 3R1HA 1KQSR 2UVWA 3DLHA 4ILLA 1WJ9A 2MLYA 4RUAA 4K59A 2DD8S 4L72B 1HNZJ 2Z57B 1X5SA 2CRLA 2I5JB 3P96A 4RNOA 3T5KA 3M8PB 1RTDA 2DNRA 2B9WA 4M63A 2HYIB 3H5UA 3T1YF 1C1CA 3CJQA 4RBVA 4WP8A 1GEHA 3LGNA 4K8RA 2DY1A 1BY9A 4F0KA 4LBPA 2HS0A 2ILYA 2W7OA 4M5DA 2UUAJ 1HQUB 5J2PB 1SL0A 2MSTA 1VJWA 3AODA 2UUAF 2DITA 1JLEB 4WBFA 2XMJA 2BA3A 4HV0A 1DQAA 2VV5A 1RWMB 2DNPA 2F9DA 2CDRB 3CJKB 3FEZA 1LW2A 3PX0A 1MN7A 3R5DA 7FD1A 1R43A 3GJQB 2JNJA 1W2BR 1PG5B 2JJ4D 5KFZA 1JXEA 2AP6A 4GVLA 2DGWA 3PJ9A 3ZO7A 1RDRA 4GKJJ 1SIZA 2YTCA 1RABB 1RT3A 1FXLA 4MJWA 1OSCA 3UD3P 3W9IA 4WJBA 2PI5A 3UCUP 1JWWA 2PA3A 4G1IA 1X4CA 2K7JA 2AKWB 4P2FA 1PCAA 3GSIA 2XQCA 1WKLA 1K1QA 2ERRA 4OYAA 3CC4S 1YBTA 1GQEA 2OPPB 2HNDB 3E3XA 1U0SA 1NK5A 3QO9B 2JL9A 3H59A 4KO0B 2VJUA 2KJWA 2FJAB 1IBKJ 5CABA 1S6PB 4YY3J 2WOMB 3L7PA 3M8RA 1CJKB 3LUYA 1IBKF 1KNZA 1WELA 1HBMA 1HNWJ 3MMBB 1ZETA 2Z2ZA 2MQLA 2W2PP 2AGQA 2AN7A 2JEFA 4DSKA 4BC9A 4MAKA 2LQ5A 2HNZB 3VAIA 4G1QB 3TZYA 3BQ0A 4N8OA 2C2NA 3D67A 1YZ6A 5CA5A 5F8LA 5I42B 3M2VA 4NMXA 4ZVRB 4DHVA 1XMOJ 3O8WA 4TY8A 1WHXA 3QRRA 1XMOF 2HHUA 5KFAA 3ILIA 2GQ2A 2IA6A 3W8PA 1VMBA 2DGTA 2APOA 3NGSA 4ZCKA 2P9CA 4ZCMA 5KFDA 3HXMA 1JJCB 1O5JA 1TZ0A 2KXFA 3QFWA 2HS4A 4NZ7A 1TTHB 4ANEA 2LEBA 3CNQP 1LWFA 3ETOA 2EFVA 3SQGB 3ZTSA 2L08A 1RBOB 2CPJA 3PRVA 3MM7B 2WZ1A 2A0FB 4S0MA 3BQ2A 4PG8A 2AQ4A 4Y2AA 1ICEB 2R8IA 5KFFA 3RB6A 4RUCA 2BVZA 2KTQA 4X4RA 4IG0B 1ZAVA 1TK5A 2J76E 4P73A 4LFCJ 2EFNA 3UQSA 2HFSA 4XDDA 1PC4A 3UR0A 2HRTA 3JB9k 2P8IA 1NKCA 2UZAA 4EGLA 1XQIA 3IG1B 2RBFA 2B3TB 1MN9A 1S6PA 1IBLJ 3OLBA 2MLXA 2X51A 1YIJS 4KE5A 2KRRA 3VV2B 4ZMMA 4I4BA 3VVTA 3OJSA 3VGTA 4ATNA 1OO0B 4QOTA 8ATCB 1M1KT 2XSFA 2C2ZB 3FT7A 3QSIA 2V8GA 5IC4B 1V3RA 2BEFA 4AE5A 1SC1B 4UOGA 2CKWA 1GXTA 1U9PA 2JEJA 3MD1A 3C19A 1ZPVA 1EX8A 2NPFA 4MYTA 1C0TB 3KNGA 4BC7A 3TUZC 4LMZA 1UZHA 3QIPB 1FNMA 2FDNA 3IRXA 3NCRA 1VJQA 1DY3A 2G2OA 3BO3A 4ILMA 4JV5J 4IH7A 2PFFB 1KTVA 1KLNA 3DC2A 3LQVA 4QWDA 1UA0A 3GJRB 1VQ9S 2BM0A 3FMBA 3W2VA 4UF4A 5AXLA 3RRKA 5DZ7A 2FIUA 5D0RA 3HPOA 2FHKA 1Q79A 1P6TA 4LSLB 5THWA 3CCZA 1OY8A 1Q1KA 3CMAS 2E1RA 2LU1A 3CJKA 2BABA 2E1AA 3CD0A 5LT5A 3SYZA 2ZWOA 1ARQA 2AHOB 4C97A 1RT4A 2LEPA 4IKAA 4O0IA 2OELA 3LALA 1YLXA 4PRFA 4NLYA 3ET6A 1HQUA 2HBYB 2IM2A 3US5A 4ERDA 4RW7A 1VQPS 1RYSA 4R8UB 4OLOA 4DN9A 3D6HB 3KFWX 2HLTA 2W4PA 4C0HA 6FD1A 3KJQB 4RNFA 3Q8PB 2E9TA 1NCLA 4I67A 4HEA9 4WCEQ 3IN5A 2VA3A 3POTB 1IR0A 1WHWA 1KOHA 3GMGA 4ZS6A 4X64F 3FGVA 1NZ8A 1U2RA 2OPSA 4PABA 3PO5A 3J7Z5 2FVRA 4ZCIA 4K4SA 1RAIB 1JLQA 1UJ4A 1T9YA 1YBUA 2QSWA 3JTNA 2UU9J 3HJFA 3O3LA 2GMJA 3T9ZA 1EA4A 4EO8A 4USMA 3TANA 2BM1A 1CQNA 2M3DA 3RUBL 1Q82T 4K4VA 3MCOA 3GZ7A 1HBNB 2HHWA 2OD6A 4RNNA 4NLQA 3UPFA 1Q7YT 1K1SA 2ADBA 1N33F 2RVJA 1VQ6S 4RJVA 2R8KA 4ECZA 2DCLA 4DMZA 4M8LA 4B3TF 1XNQF 1JQGA 4HACA 4ZPCA 4N76A 4Q7AA 2Q6CA 3K5OA 1N4LA 3I87A 4JI3J 4OYWA 3DXBA 3BH6B 2Y0BB 3M32B 3THTA 3TJ8A 4EBDA 2CQ3A 2IYGA 3MMCA 3OXFA 4K2XA 1SKRA 1JXLA 2C3MA 1X5PA 3HHLB 5ADZA 2NXEA 2KKEA 2GA7A 2YNHA 3IC1A 1FDAA 3OSPA 4HKQA 4WIQA 3KWMA 1RWWB 3GR1A 2HFVA 2FY1A 1LNQA 4RW8B 2AWZA 3J80U 1SXLA 1RWUA 1S1XA 1S9GA 2QV6A 4XAKA 1V6HA 3QLHB 4ZA1A 5HLFA 2UXCF 2GPEA 3DM2B 1FI4A 3SMZA 3T3FA 4CYUA 4DUYJ 2DB1A 1TKZB 2H5EA 1KOOA 3R8YA 4BCAA 9RUBA 2FLOA 2H54B 1DHMA 4H4OB 4IQMA 4CZCA 1WUUA 2GAGC 3EWGA 1JLGB 1D8ZA 3MEDB 4OZLA 3OVAA 4LFBF 1PC5A 5KFCA 1T3NA 2JEGA 2EKYA 1UW4A 5E2QA 2QA4G 3V6DA 3QFHA 1GX5A 1C1BB 2WONB 3MPUB 5D77A 5DDOC 1X9SA 1S77D 3FRYA 3ZZRA 4ZIWA 1MSWD 3OJUA 2IC3B 4FXWA 2F9JA 2GO9A 2MY8A 3B4DA 3CJSA 1ZOTA 4DN0A 1QUVA 3OTOF 4FBTA 3J7YU 3MMJA 5B0GA 2EBGA 2R3VA 3DLGA 2KHCA 3M8WA 3N79A 2W8KA 5K8OA 1UA1A 2HNYB 2W2OP 1RA7A 1MWZA 2LYVA 3OFGA 3P45B 2RDJA 1N5YA 2A1BA 3OT9A 2K2PA 3AD8C 2V2VA 3S7RA 4BBYA 3QOQA 2W24A 2Y1JA 2E9RX 2KZZA 2ZH3A 2WRMA 4JI0F 1A9NB 2EW9A 5SUHA 4RW7B 4JI0J 4OZ2A 2WB1D 3G82A 4LVOP 4ECVA 1VQSA 5F8NA 1S1WA 1S59A 3LPEA 1DTQB 3FVYA 3Q8RB 3C15B 3H5XA 3P5TL 1S1UB 3R9LA 2DR6A 5KFQA 4OYBA 5ETQA 4QWEA 4UY8T 4OZ5A 5KFRA 4IFVB 4OYZA 3G96A 3RRGA 5F3ZA 2BBEA 4ECRA 1FHTA 1FEHA 4NXNJ 2BSQE 1NDKA 4ANCA 2QFIA 4WF9Q 2ZC3A 2IMOA 2HGLA 2OIHA 2CG8A 2FPHX 5CAAA 3GG0A 4QCLA 2BV3A 1WTFA 5ETOA 1RAJA 4OHWA 2ASLA 3VAFA 2Y1IA 2YH0A 2ZE2B 4C3LA 2R7SA 4ECQA 3M6UA 1UEVA 1ZPWX 2ZH2A 1SBRA 3V81B 4K0KJ 4C8NA 3AQOA 4N77A 4HL9A 4F25A 3GV5B 3QNWB 1S4FA 1EKRA 4OJ1A 3TP2A 3V5RA 8RUCA 5L9XA 1QDUB 4ED2A 1Z2ZA 3TX0A 2VODA 3D1OA 1QSLA 1HBUB 2XZTB 3NS6A 4ES3A 2AW0A 2LA6A 2V9KA 3DRPB 2ROEA 2FZGB 4FYDA 1GH8A 1RTZA 2CQ4A 3G6ES 2PA8D 2HHQA 5GMEA 3OL8A 5A0YB 2JFDA 1SUQA 1RADB 3TI0A 1TKDA 2VBYA 3GIKA 4CLFA 1X60A 2ZC4A 4FYWB 4ZITA 2DR9A 2PT0A 5L39A 4AQYJ 1N54B 1HQEA 2G9OA 1RWXB 1BLUA 3V6JA 3MTKA 1Y0HA 1H73A 1JLBB 2VFUA 4RKUC 4FN5A 2N82B 3H2LA 4PZVA 4FNHA 2HQGA 3BPDA 1YX2A 2PEBA 3BS9A 3OL7A 5E33A 1NK4A 2HMIB 1IQTA 4KIAA 1DZ5A 1LWCA 2YKMB 4JI6F 4DSEA 2HHHF 1JB0C 1X0FA 1FO1A 3IM9A 3R27A 3TO8A 2YX1A 1UW9A 1U48A 3IS9B 2QGFB 2IIHA 3GILA 1GNKA 4TY8B 1RZMA 3BH7B 1F60B 4KHPF 4G6VB 4Y2MA 4USJC 3RYLA 4CRJA 1KQFB 1O51A 5FLXY 3KHLA 1UEKA 4EU0A 1AUSL 2MKSA 5GVQA 4XO0A 3HP6A 2ZFHA 4ZVHA 5KG5A 1CULA 2OMLA 5IOLA 2VKRA 3F56A 4ZPVR 4I0WA 4OX9F 1U1RA 1HKAA 3MMBA 4RW9A 4C0OC 4DCPB 1J5OB 4U7UD 4CYUB 4P2SA 2Q66A 2MZTA 2XS5A 3H2VE 3PRDA 3MM6B 1HPZB 4N41A 3FBCA 4HI1A 4ZLJA 2XGPA 3EX7B 1KD1T 3MUMP 1B64A 3TAQA 2WW4A 3CJ8A 2XNRA 2X1FA 2HHTA 3I0RB 5F41A 4LF5J 1Q8BA 2YX4A 2XI2A 3GV8B 3MHYA 2XO6A 1H7WA 5FDLA 4K5RA 1WG4A 4QPXA 2GVDB 3U1LA 4RUHA 3VAKA 2B51A 3BSCA 3EPGA 3D7SB 1BAZA 3DYAA 4QR1A 1VRTB 4AXIA 2E5HA 4DX6A 5KT4A 1JIHA 2VQFJ 4A48A 1PJ7A 4TQSA 1KHWA 1EARA 2CZVC 1N0UA 3FCWA 1S5ZA 1VRUA 1BE4A 1R8HA 2V4JB 3M32A 3MM5B 1T94A 1VQYA 3A8KA 4OJGA 4DFMA 3T1YJ 4LRAA 2DNGA 4B3SJ 1QE1A 4YDDB 2NYIA 2O66A 3PV8A 4QJVA 1HWLA 2J0SD 4RNHA 4TYBA 4C8LA 2K06A 2Y1LB 3SSQA 4AD6A 3NGTA 4CQ1A 5KAKA 5M2UA 3EUNA 3RTVA 1Q95G 4NLWA 4F2SA 2DO4A 2Z30B 5F9NA 4XPCA 5HJXA 1JLEA 2XG8A 1BD6A 2FTRA 2GJIA 2HVDA 4LFAJ 3RAQA 3L4BC 1IBMF 2RQ4A 5AJ3F 2E1PA 3M9MB 3KYLA 3T1HF 3CXCR 3C16A 3T1HJ 1FK9B 2LQBA 4NL5A 4DV4J 3OD2A 2XY5A 1HBNA 1NU4A 3DCAA 4A8MP 4DV4F 2A18A 4CTAB 2NR0A 4M5KA 5IT9U 1PBAA 1DQ9A 1KQGB 2AYMA 2O67A 4FP9A 4CTAA 1D3WA 2H51B 3M8PA 2HHHJ 4JI6J 2GHPA 2R42A 4U7CA 2UVVA 3E2EA 1JLQB 1U7LA 2CNOB 2V8PA 1TL1A 2HWHA 4CLSA 2MXYA 4YMEA 4M5GA 1R8AA 2D69A 3CD5A 2GIQA 2ZBQA 1FT8A 4LJMA 1FX2A 4KGMA 2NXJA 3MAQA 3GYNA 3H87C 4QIGA 3GIJA 2FZCB 4A8QA 2KFZA 1FDNA 1HD0A 4MIBA 4LF6J 4LSLA 2HQIA 5I4MA 3SXLA 2ZZMA 1QE1B 3CDWA 1URNA 2NSCA 4GKJF
chains in the Genus database with same CATH topology
3GXQA 2BNWA 3BKTA 4ME7E 2CADA 2BSQE 3VEAA 1EA4A 3VEBA 1MNTA 2BNZA 3FMTA 2H1OE 2JXIA 2AY0A 2RBFA 2NZCA 3PHTA 2JXHA 1IRQA 2CAXA 1MYLA 1ARQA 2CA9A 1B28A 2GPEA 1BDVA 1Q5YA 3BKUA 3VW4A 3BKFA 2K5JA 3QSIA 2WVBA 1ARRA 3QOQA 2BJ9A 1P94A 1NLAA 2FGCA 2JXGA 1X93A 3FT7A 2WVEA 3LGHA 2BA3A 2HZAA 2WVDA 2CAJA 2K9IA 4FXEA 4HV0A 3H87C 2WVFA 1U9PA 1QTGA 2HZVA 2WVCA 1BDTA 2BJ7A 2BJ3A 2K29A 2K1OA 2K6LA 2BJ1A 1MYKA 1PARA 1Q5VA 4D8JA 2Y3YA 2F1FA 2PC6A 3OD2A 1B01A 1BAZA 2CPGA 2BJ8A 2KELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GXQ A;  2BNW A;  3BKT A;  4ME7 E;  2CAD A;  2BSQ E;  3VEA A;  1EA4 A;  3VEB A;  1MNT A;  2BNZ A;  3FMT A;  2H1O E;  2JXI A;  2AY0 A;  2RBF A;  2NZC A;  3PHT A;  2JXH A;  1IRQ A;  2CAX A;  1MYL A;  1ARQ A;  2CA9 A;  1B28 A;  2GPE A;  1BDV A;  1Q5Y A;  3BKU A;  3VW4 A;  3BKF A;  2K5J A;  3QSI A;  2WVB A;  1ARR A;  3QOQ A;  2BJ9 A;  1P94 A;  1NLA A;  2FGC A;  2JXG A;  1X93 A;  3FT7 A;  2WVE A;  3LGH A;  2BA3 A;  2HZA A;  2WVD A;  2CAJ A;  2K9I A;  4FXE A;  4HV0 A;  3H87 C;  2WVF A;  1U9P A;  1QTG A;  2HZV A;  2WVC A;  1BDT A;  2BJ7 A;  2BJ3 A;  2K29 A;  2K1O A;  2K6L A;  2BJ1 A;  1MYK A;  1PAR A;  1Q5V A;  4D8J A;  2Y3Y A;  2F1F A;  2PC6 A;  3OD2 A;  1B01 A;  1BAZ A;  2CPG A;  2BJ8 A;  2KEL A; 
#chains in the Genus database with same CATH topology
 3TA2 A;  4U6P A;  4DV3 F;  5HVF A;  4DR3 J;  3M6W A;  1TK0 A;  4KY3 A;  1BMQ B;  1TV6 A;  3KLH A;  2W7P A;  4DCJ B;  1SC4 B;  1YZ7 A;  2DNH A;  4Y2K A;  4EYH B;  1FFS B;  4C6A A;  5FDL B;  2PEH A;  4PR6 A;  4X2B A;  3ZTP A;  2DRD A;  2LXF A;  3DGP B;  1TL5 A;  4UST A;  5J1N A;  4EBE A;  1QTN B;  1C4A A;  4LF9 J;  4E98 A;  1U6Z A;  2VQF F;  1AZS B;  3UN3 A;  1REV B;  4AL5 A;  1WOO A;  1C0U A;  2HVZ A;  1MU2 A;  4WP9 A;  3RAM A;  4DPO A;  3KLE B;  4PUO A;  4B3O A;  3I0S A;  1EHW A;  3BBF A;  1PSD A;  3ZTR A;  4F3M A;  4DPY A;  3EDQ B;  1JKH B;  1YGY A;  4EZ9 A;  3LAK A;  4MTP A;  4O3R A;  3D3C J;  1JJH A;  4JI5 F;  3VR1 A;  3UN5 A;  1SCJ B;  1XER A;  4HT7 A;  3FEX B;  3IG1 A;  4Q8E A;  1F9F A;  4RW9 B;  1VK8 A;  2HSE B;  3VTI A;  1F2H A;  3EE3 A;  1HHQ A;  3W8G A;  2XMV A;  1N32 J;  4CM0 A;  1ZYQ A;  1FRI A;  1Y11 A;  2KFN A;  2MKK A;  2QL7 B;  3W1Y C;  1ZS6 A;  3AQP A;  2JFK A;  1R0A B;  2DR8 A;  3EXC X;  3EPI A;  2VON A;  4DR4 J;  4ICL A;  5EHH A;  1OPI A;  2F65 A;  2RQM A;  3I9V 9;  4HVZ A;  3UCG A;  5HAN A;  2IHR 1;  2HVE A;  2XUL A;  4J9O A;  2W9C B;  1ACM B;  4MT1 A;  3QJL A;  3QZ8 A;  1U1L A;  2H65 B;  2KL8 A;  4FXD A;  1F6T A;  1RIS A;  2HLU A;  3MR3 A;  2VFR A;  1RT7 A;  3N28 A;  1TKX B;  1SUQ B;  4DL7 A;  3CMQ A;  3VF0 B;  5HI7 A;  1BUX A;  1ZAX A;  2CQB A;  1QAI A;  2KYZ A;  1HWK A;  3HHD A;  4J37 A;  3NOG A;  4J9U E;  4CIO A;  3CC2 S;  2GHW A;  2QO3 A;  1RU2 A;  1ROF A;  2WSC C;  4GMK A;  4J7C A;  1QTM A;  2HND A;  2VZ9 A;  2HS3 A;  4RW6 A;  2JOQ A;  3JQK A;  4LIR A;  2KVI A;  3BM7 A;  4ZN1 A;  2CPE A;  2UUW A;  3MEG A;  4ZP9 A;  5A76 A;  3CDB A;  3KLE A;  4IFY B;  5HJY A;  3W2W A;  1IKX B;  2VG7 B;  1O0P A;  4DU8 A;  4FS2 A;  4B3R J;  1Y3K A;  1DQ8 A;  3F73 A;  1N36 J;  4DV2 J;  2NUU G;  4DV5 J;  2DNM A;  1N36 F;  2YNF B;  3U1N A;  4PQU B;  3RR7 A;  2FY8 A;  2C2O B;  2KEL A;  3IGN A;  4IOB A;  3GFY A;  3LO3 A;  5LJ5 Y;  3P4U B;  1IKW A;  6AT1 B;  3PW4 A;  2BOA A;  1WWH A;  2P6S A;  1CJT B;  5C42 A;  5HP1 A;  2NZC A;  3JYT A;  4KV8 B;  1ARO P;  3D0I E;  3OXG A;  2LDY A;  3LW5 C;  2DIU A;  3ZZU A;  1HI1 A;  4ZK7 M;  2Y8W A;  2MQO A;  1R27 B;  2DNQ A;  4LF1 A;  4DFJ A;  3CCL S;  1I94 F;  5KT3 A;  1BQX A;  2BE7 D;  4KQZ A;  3IM8 A;  4Z7C A;  4DR6 J;  2DH8 A;  4IFV A;  1ZA1 B;  3A8E A;  2HW3 A;  2P9G A;  3BSA A;  1Z4U A;  2PO4 A;  3LA0 A;  2I9S A;  3J7Z T;  1RCO B;  5L38 A;  2C2D A;  2HHX A;  4K2J A;  4CH0 S;  4DQR A;  1C1C B;  1S1W B;  2CDQ A;  4N47 A;  2LCW A;  2QRR A;  1SIW B;  2QLF B;  3TX8 A;  2UXB J;  2MZ1 A;  4ER8 A;  2MTL A;  1WAC A;  3W62 A;  1V3S A;  4ED7 A;  2DRB A;  2KT5 A;  4KB7 A;  2BA9 A;  1S76 D;  3BF4 A;  1G1X A;  2OD4 A;  2PSZ A;  1RHJ B;  2HNY A;  3PXG a;  2RU9 A;  3A1Y G;  5C24 A;  3JSR A;  4Y0F A;  1CJU B;  3KK1 B;  3GPA A;  1FDB A;  1LWE A;  4ED6 A;  1NPR A;  3A12 A;  2IC3 A;  3EVO A;  1UVL A;  3TUI C;  2W1B A;  3C6U A;  3PX4 A;  2VU5 A;  2DGS A;  2F4F A;  3AJ2 A;  1C1B A;  2WON A;  3W60 A;  3RB4 A;  4ID8 A;  2FJB B;  2IYI A;  4R0J A;  1X9W A;  3AY0 A;  3EGV A;  4GC6 A;  5KFH A;  4E0D A;  3C14 B;  4ZDN A;  5KFW A;  1GMV A;  2AF6 A;  3P8B B;  2DHX A;  3MEE A;  5GMD A;  3K7R A;  3CT9 A;  3TAM A;  1HW8 A;  3R6L B;  3U02 A;  2E44 A;  1URR A;  2GS8 A;  1QSS A;  1UJ5 A;  4FBU A;  3DU5 A;  1HA1 A;  1QSY A;  2HBQ B;  3JSY A;  1WHY A;  1X4E A;  4LVN P;  3UN2 A;  1HNX F;  2BE2 B;  1TUG B;  1YJV A;  4B3T J;  1VGY A;  4LUB A;  3X3U A;  3PFO A;  4HYK A;  2HGM A;  3PJW A;  2ACY A;  1IKY B;  1R3N A;  1TUV A;  2YWH A;  5ETL A;  1FRH A;  1S4E A;  1TKT A;  2ZKT A;  2QFJ A;  4DR1 F;  1RCX B;  5CZV A;  2KVQ E;  4UW2 A;  5L8R C;  1O6X A;  2W2N P;  2ZOG A;  4ZPA A;  1PGZ A;  4FS1 A;  3JS9 A;  3OPK A;  2K1R A;  2R7O A;  4A8O A;  5D8H B;  2GQC A;  1TQL A;  2RD5 C;  2CIM A;  2M88 A;  3I82 A;  4F3O A;  2EFO A;  4DPU A;  3HSD A;  4USW A;  4U8V A;  5J2N B;  4DR2 F;  2VPZ B;  2AZ1 A;  5LOQ A;  5KFP A;  3HSG A;  4FYX B;  3VZH A;  4PXC A;  5HVG A;  3Q23 A;  1TUW A;  5EUH A;  3C2P A;  4DL5 A;  1M5V C;  1SJF A;  3TAM B;  1NHV A;  1SVD A;  2Q1L A;  1ZM2 A;  2ZDP A;  3A8I A;  3UVJ B;  2ABY A;  2YWW A;  4DPX A;  4K4W A;  1ZM9 A;  3IR7 A;  3NNE A;  4Y2C A;  4NXM F;  1IWG A;  4LF2 A;  5CCL A;  4NLR A;  1FRK A;  1N34 J;  3NNA A;  2W2Q P;  7FDR A;  4LF7 F;  2YH1 A;  1FWK A;  4BLG A;  5LMN J;  2F40 A;  2JVO A;  2RB7 A;  4OI3 A;  5DS7 A;  3HVR A;  4C8Y A;  2EI5 A;  3AH6 A;  2NSB A;  5L1L A;  1LWC B;  4JI7 J;  2J7K A;  1NDL A;  4E2F B;  2YXL A;  4LF8 F;  1Y5L B;  2K3K A;  2PII A;  3C46 A;  2XLK A;  2OAU A;  3POT A;  3T6J A;  4DV6 F;  2GIR A;  4DX7 A;  5BXI A;  2VBZ A;  3R1L A;  1N5Q A;  2E1M C;  3KLF A;  3FBE A;  4I2P B;  2XWX A;  2V4Q A;  4DSF A;  2WSE C;  3N5F A;  4KPY A;  4EK2 A;  4JI2 F;  4YR2 A;  2IJF A;  4OIX A;  2W9B B;  2COL A;  2H4W B;  3LP0 B;  1QD1 A;  4DSJ A;  2FJX A;  2WBR A;  3SI8 A;  1E6Y B;  3I4H X;  3PHT A;  1MMD A;  2B56 A;  3CE8 A;  5D3G A;  1U1P A;  3DHX A;  1RI7 A;  4RU9 A;  4QIW D;  1WF2 A;  1RT2 B;  4PXB A;  1RTI A;  4R5P B;  2CPD A;  2EPI A;  2ZBR A;  1S1T B;  3CJ3 A;  3WZ0 A;  4DUZ J;  1PJ5 A;  2MMY A;  3QYY A;  1J5O A;  3N6L A;  1BQN A;  4C3M A;  1FKP B;  1NRK A;  3WDO A;  4B9N A;  4YB5 A;  2D9O A;  3RJM B;  1X93 A;  4DR5 J;  1VOM A;  2XMM A;  1VIX A;  4LRC A;  3IWL A;  2VQE F;  2CYY A;  3GE9 A;  3DU6 A;  3I6P A;  1U2C A;  3QJJ A;  1K73 T;  4NXN F;  1MWY A;  4YP3 A;  2EK1 A;  1Q53 A;  4LBI A;  2VC1 A;  4DR1 J;  3A3P B;  1BGX T;  3K57 A;  4D8J A;  2UUT A;  4I7F A;  2J9D E;  1UEU A;  2QYG A;  1RTH B;  2CJX B;  3M8Y A;  2XC9 A;  1VQ4 S;  2AYG A;  2OPQ B;  3R6G B;  4C4W A;  1SH2 A;  1KKH A;  3CUN A;  1X0P A;  3R97 A;  1K0V A;  1WI6 A;  1FKO B;  1PIE A;  2B8P A;  1OSD A;  2DJW A;  2G1D A;  2UV8 A;  4I64 A;  3EDR B;  3HLU A;  4NPO A;  2HRU A;  3PIO Q;  4IH6 A;  2ZM6 F;  2R8J A;  2G4B A;  4MYU A;  1RWO B;  3CUL A;  2EK6 A;  1PBU A;  4M5L A;  2GVZ B;  1FXD A;  3BB5 A;  3NCQ A;  5KG4 A;  1VC5 A;  3J80 Y;  1PO6 A;  4QW9 A;  1X9M A;  2M8D B;  3Q8Y A;  4OFZ A;  1IVZ A;  5BJR A;  4NRU A;  2KKH A;  3GSD A;  5CYQ A;  2QC3 A;  2HAF A;  3OR1 B;  5A2Q Y;  4CCH A;  5L46 A;  1WNE A;  2F7V A;  2M5Y A;  3SDE B;  1JNR B;  2DNY A;  4WTO B;  2DNZ A;  4AUK A;  3RB0 A;  1DUR A;  3E8O A;  2EKN A;  2V63 A;  3DRX A;  3PYE A;  4LRF A;  5CZX A;  5E3P A;  2KZM A;  1N5Y B;  4OI1 A;  1B01 A;  4XTT A;  2CPG A;  2RAQ A;  4A8K A;  4JI7 F;  2YKQ A;  3DRR A;  4ICL B;  1LFW A;  2NXU A;  2CAD A;  4LF8 J;  5IC6 B;  5JMN A;  1CEZ A;  4QWB A;  5HSP A;  2C22 A;  4C8O A;  3PYD A;  4YUD A;  3H4B A;  4LRD A;  2JXH A;  3FBF A;  4GC7 A;  2VJV A;  4BHQ A;  1NK6 A;  2HHS A;  4P10 A;  4KTQ A;  3W9H A;  5ETM A;  2BDP A;  2IM1 A;  4EFA C;  1REG X;  1S72 S;  4OYX A;  4DS4 A;  3IRW P;  2M0G B;  3QBC A;  5L1K A;  2E5L F;  2RQC A;  3R7S B;  5CD4 H;  1KN6 A;  1YG0 A;  2E7W A;  2JHE A;  5HRO B;  5D78 A;  4X84 A;  4AND A;  1PYO B;  2RF2 B;  3I5C A;  3MOJ B;  3HI9 A;  2V8V A;  1HBM B;  4DFK A;  5LM7 E;  5KT5 A;  2L41 A;  1JLC B;  2MQN A;  1XNR F;  1IJE B;  1C2P A;  1MW7 A;  2RUG A;  1NJI T;  3B78 A;  4AFF A;  3VAG A;  3RBZ A;  2AGP A;  2OPP A;  5GAH U;  2VL1 A;  3QGG A;  2H1O E;  3NS7 B;  2V2K A;  3FZB A;  3I9Z A;  2P2C B;  3RW7 A;  3D2W A;  1VQL S;  2YNH B;  4NLS A;  1P9Y A;  4NEZ A;  1I51 B;  2MDA A;  4PG4 A;  1HAR A;  1KHV A;  3K5L A;  2ZBC A;  2QYC A;  3DOK A;  3SIP B;  4EBC A;  1I5O B;  2NXN A;  3G4S S;  1FE0 A;  4KH0 B;  1UET A;  5E3Q A;  3NAI A;  4JI8 J;  4QYZ J;  1TFY A;  3SV3 A;  2HIQ A;  1HNI B;  3R7B B;  1HFE L;  1VHI A;  4ZP6 A;  4RO0 A;  4DR7 F;  2MB0 B;  5EWF A;  2KJV A;  1AT1 B;  4N7T A;  4HLB A;  5D15 A;  2F3J A;  3KLH B;  2R7V A;  3CWJ A;  4BWJ A;  3NNH A;  2RHQ B;  3MAA B;  3KJV B;  1H0H B;  3BEG B;  1XR5 A;  4Z37 A;  3H4D A;  2ZDO A;  5GMK a;  1HMV B;  1HL6 A;  2R7W A;  1IXK A;  1RSC A;  3Q22 A;  2HK3 A;  5D3G B;  4WKR A;  1IUJ A;  4OHY A;  3ZZY A;  4AYB D;  1NK0 A;  1F5B A;  4A8F A;  4F3Q A;  5M2R A;  5CYJ A;  4ID5 A;  3IFE A;  2FC9 A;  4I2P A;  2Z58 B;  3QGI A;  4O44 A;  4NI2 A;  4QIF A;  1SI9 A;  1N8R T;  3FSX A;  3TVZ A;  4O44 B;  3BBB A;  4O4R A;  2K9I A;  1LFP A;  3OTB A;  3QAU A;  1IN0 A;  2LQ8 A;  2XWY A;  1NB2 A;  2UP1 A;  3CJ5 A;  3A3O B;  3LAM A;  3CCM S;  4IQX A;  3BSN A;  4JV1 A;  4LSN B;  5IS2 A;  2JZ5 A;  2PMW A;  1RB0 A;  2OKQ A;  2F1F A;  3K8W A;  4J9R A;  4DUT A;  1M5S A;  3T5H A;  5H9F K;  1KFS A;  1FD8 A;  1EET A;  4NOH A;  1D09 B;  3OW2 R;  1FD2 A;  2CJ9 A;  1DAR A;  2VBX A;  1VLY A;  4FKY A;  3OR2 A;  5U47 A;  5BR8 J;  3CCQ S;  1KVI A;  5KG7 A;  1T05 A;  3IWN C;  3G2X A;  2KG0 A;  2H3A A;  4LF4 J;  2K7K A;  1S9E A;  3M1V A;  1U6B A;  1GT8 A;  2CA9 A;  2ZZT A;  4ZLP A;  1KEK A;  4NLO A;  2F8M A;  2K5J A;  4WWS A;  4KGZ B;  2RT3 A;  1S6Q A;  4DV0 J;  2WHO A;  2GJ2 A;  3QIP A;  4XDC A;  4NML A;  4FKX A;  3TZW A;  1VRT A;  3LF0 A;  3AA8 A;  3PIP Q;  2DNK A;  3LWL A;  4DF4 A;  4NLG A;  2X3D A;  4Q5V A;  2MHE A;  2IRU A;  3LTO A;  4ZLN A;  2XNQ A;  1SJ4 P;  3GR0 A;  2BRL A;  3MMA B;  5IWA J;  5CD4 A;  1VRU B;  4H4M B;  2CNL B;  4CP5 A;  4X4N A;  2VPX B;  3NY0 A;  3NCP A;  2UVU A;  3DYA B;  1W2I A;  3FSY A;  4C8M A;  4C11 A;  4DS5 A;  1CC7 A;  1LOU A;  1OYD A;  3VHQ A;  4E8U A;  2BX6 A;  2MPU A;  5H9E K;  2UXD F;  2NS1 B;  2MJU A;  5C2C A;  4C7Q A;  4EYI B;  4HDH A;  2ZJR Q;  2DTJ A;  3GFX A;  3KUG A;  1NH8 A;  4ZJQ A;  2IRY A;  2MQM A;  1SPB P;  3G87 A;  3MEE B;  4IDK A;  4OJ3 A;  1A0O B;  4P75 A;  4YN3 B;  4A8X A;  2X1B A;  5C2G A;  2VIC A;  4ECT A;  2R7X A;  5IV3 A;  1HNW F;  4X4P A;  2IVY A;  1RWK B;  2HWT A;  1OQ6 A;  4YY3 F;  3GWC A;  4I69 A;  3PW5 A;  1EIY B;  4DR4 F;  2RF2 A;  5LJ3 Y;  2DEI A;  3CC7 S;  2UVR A;  2MKI A;  2BAC A;  2RIL A;  5KFI A;  1SKU B;  2XYP B;  4IRK A;  2V8D A;  2CQD A;  2G2Z A;  3H5S A;  4A46 A;  3A8J A;  2HZC A;  2EC0 A;  3B8H A;  5KFL A;  3NOC A;  2C3U A;  1F1B B;  1RTJ A;  1U0H B;  4Y34 A;  1U02 A;  1XJW B;  3H98 A;  3J81 j;  2VAS A;  1SQF A;  3CCT A;  2C2M B;  2ADL A;  1U49 A;  1GTE A;  4NE9 C;  1RK8 A;  5GAH I;  3AOC A;  2J0X A;  2NLW A;  2A10 A;  3MPV A;  3SDE A;  2XO7 A;  3THV A;  4X4O A;  3T9N A;  2ZH5 A;  1X7V A;  3TAP A;  1QVF R;  1SIW A;  1HWI A;  2AEJ A;  2NPI A;  1JLB A;  2R7U A;  3G71 S;  1U4B A;  1M5P C;  2KH9 A;  3HO1 A;  3K2Y A;  3UE2 A;  3WHI A;  3BRE A;  2X1A A;  2Q6B A;  3Q89 A;  4B9S A;  3R5B A;  2QLB B;  1NJW A;  4GVB B;  5B0D A;  1FKA F;  3PW7 A;  3QRP A;  4NLT A;  4USV A;  2YNG B;  2IVF B;  5KOX A;  2KM8 C;  4LFC F;  2QLX A;  3IBC B;  2GC8 A;  2RRB A;  4OLP A;  5F8I A;  4OHZ A;  3CPW R;  1JNZ B;  1U24 A;  3WX4 A;  1HIY A;  3Q2S C;  3P3D A;  4LR7 A;  4ECU A;  3ZTO A;  1UPP A;  4YR0 A;  5HP1 B;  1UMJ A;  3D6M B;  2GMH A;  4IH5 A;  3KXD A;  2BNZ A;  2AX0 A;  1NLK L;  2B7C B;  2B4O A;  4I2Q A;  4M5J A;  4UZC A;  1IR2 A;  3BO2 A;  5CQG A;  1NK9 A;  3TOQ A;  1FEE A;  1RHM B;  3QAT A;  1M1G A;  4JB8 B;  5KG3 A;  2DIV A;  4I7F B;  4Q44 A;  2AJF E;  1P1T A;  1F9E B;  4A8W A;  2XY7 A;  2DVI A;  4UTG A;  3N6N A;  4KHM A;  1IKX A;  2VG7 A;  2XYH B;  1LW2 B;  1OMS A;  3ETM A;  3DXS X;  1RTI B;  4DJB A;  1SJR A;  4ZPT R;  2OHD A;  4R5P A;  1OY6 A;  5AXM A;  3GQC A;  2D74 B;  3WC2 A;  1K8A T;  4F26 A;  4RW6 B;  1E6Y A;  2UUB F;  2XMT A;  2NCK L;  3EZU A;  3H2U B;  2C3P A;  3KUE A;  4WPA A;  2HQD A;  4NAS A;  4QWA A;  4A8S A;  3OQ2 A;  4CLW A;  3TA0 A;  1BWE A;  2W25 A;  3ILL A;  4P52 A;  4HHH A;  4RNM A;  1CBK A;  2K3I A;  5LSO A;  3FSI A;  3L95 X;  4FXV A;  3JSM A;  2H5I B;  2LXU A;  4IUF A;  2HFO A;  3I96 A;  1I6J A;  3I4P A;  2IPO B;  2IM0 A;  3TVK A;  1RT6 A;  5FLX U;  1R8P A;  3G6Y A;  5KG2 A;  4Q45 A;  2N4C A;  4ECY A;  2BRK A;  1BHN A;  4PYD A;  1LXJ A;  3UW1 A;  2ZHB A;  2OSQ A;  2OEJ A;  3M6V A;  2QG9 B;  1NB7 A;  4EZ6 A;  2HHV A;  2J0W A;  4DQP A;  2EFP A;  2QA4 S;  3V4I A;  2ZEJ A;  5JJB A;  3HJV A;  4ITS A;  5A6P A;  3LJP A;  3S6E A;  4IG3 B;  1PAU B;  3NWR A;  1IKV A;  2BUN A;  4TYA A;  3D0H E;  4WXW A;  4XPE A;  4UQG A;  1NO8 A;  2VPW B;  2BJ3 A;  2O01 C;  4F4X A;  2C2R A;  3MED A;  1VQ8 S;  4B3M J;  3MEK A;  3IAM 9;  2Y3Y A;  4J91 A;  2DXF A;  5ETV A;  2VG6 B;  2MGZ A;  3HSJ A;  4FPI A;  4ZHR A;  4QU7 A;  2BJD A;  1T9V A;  2JSX A;  3QWP A;  3V6D B;  4JI1 J;  1F9H A;  1EP4 B;  1U25 A;  4JI1 F;  3IR7 B;  3VQT A;  1LV5 A;  1AFJ A;  4LR8 A;  1PJ6 A;  1WC5 A;  3HVA A;  4UUW A;  4C48 A;  4CDI A;  4U95 A;  4MMO A;  3HFV A;  3BR8 A;  4HH1 A;  5HBM B;  4DV2 F;  4ELT A;  3TR5 A;  4KT0 C;  4F0M A;  1FRX A;  1JKH A;  1RLD A;  2VFV A;  3GLJ A;  3IA0 A;  1UP1 A;  5KT7 A;  1FER A;  2B5J A;  1W25 A;  3X1L B;  1X8D A;  1Y9O A;  1SQG A;  3M2U B;  1X4F A;  1MU2 B;  2JC1 A;  1YDL A;  1KC8 T;  1J27 A;  3MWB A;  3SCL E;  2HKE A;  1T9U A;  1FF2 A;  2CUY A;  2K8G A;  4J9V A;  2DCU B;  1S1X B;  4USH A;  2I38 A;  3ZC4 A;  5HLF B;  1FJC A;  3HT0 A;  2VOO A;  2IBK A;  2CFX A;  1RXO B;  3N01 A;  1D9D A;  4P6Q A;  1UWA A;  2FHM A;  1RBL A;  2IFX A;  1GTH A;  1Q8L A;  2ZH8 A;  2VA2 A;  2PMZ D;  4DR2 J;  1TKT B;  3K89 A;  1NBE B;  5J2Q B;  2DK2 A;  3MMC B;  3E51 A;  4ZJO A;  2EC2 A;  4JV5 F;  3QAE A;  2DHA A;  2DGU A;  4TU9 A;  2MQP A;  2BW7 A;  1RWN B;  5DJB A;  3FNN A;  3D5M A;  1VR6 A;  3HFZ B;  2E29 A;  2ZUA A;  3M1V B;  2WBM A;  1T0T V;  1ZBT A;  3BDE A;  3D28 A;  3EIC A;  1YJ7 A;  2LQ9 A;  2MKJ A;  2XMK A;  5J1E A;  4DQQ A;  3Q0A A;  2VG6 A;  5C25 B;  2UUC J;  2BQU A;  5K8P A;  3FC9 A;  3J81 Y;  1QJH A;  2QX0 A;  4DWI A;  4KKO B;  3H25 A;  3PZP A;  1IKV B;  2CZ4 A;  3HHL D;  2B9Y A;  2YBV A;  4QWC A;  1QY7 A;  2HZV A;  3QZ7 A;  1CJV B;  3M9N B;  2H4Y B;  1BQM A;  1NHK L;  1V5V A;  3BN4 A;  1R0C B;  4NI2 B;  1WEZ A;  2DBB A;  4K5S A;  3TQ1 A;  1FJE B;  1MYK A;  2YKO A;  4USK A;  1X5O A;  3R5J B;  2YWE A;  4W4M A;  4UOH A;  1CJU A;  3FKB A;  3VZI A;  4WU3 A;  5LSL A;  2OPS B;  5GAD I;  4DSI A;  3JQJ A;  4MKB A;  4JBC A;  3CDA A;  3OSN A;  4EMD A;  2VIH A;  3DNC A;  3WQP A;  1U2F A;  2RRN A;  4HHJ A;  5DQH A;  2UU9 F;  4B17 A;  3HHL C;  2B4V A;  3MPY A;  4D3H A;  4MFB A;  4DL0 C;  4J5O A;  1QM9 A;  2B6A A;  4LRB A;  2W9A A;  3CJ2 A;  2FQQ B;  3OUY B;  3V6K A;  4DX5 A;  1FWP A;  2BMB A;  1R6V A;  4DV6 J;  2HFU A;  4G65 A;  2J6S A;  3FQK A;  2DGX A;  3MXH P;  5GAE U;  1JJ4 A;  4Q8F A;  2R2T A;  2MSS A;  4OYP A;  3PJX A;  1S6U A;  4P72 A;  4DL2 A;  2VQE J;  1FCA A;  3F0N A;  3T19 A;  1VDH A;  2YQ0 A;  5DG8 A;  2BJ7 A;  4YFU A;  3JYT B;  3PW2 A;  3PX6 A;  3W66 A;  2B4U A;  2N7Y A;  3U1M A;  1DFD A;  2R8H A;  3OLA A;  4URQ U;  1UKU A;  4CNY A;  4FVC A;  1F5A A;  5KFY A;  3QSY B;  3L3C A;  1LXN A;  3Q8V A;  5BYR A;  4NLD A;  3NRB A;  1M5O C;  3LH2 S;  2DYA A;  4M5N A;  3V2U C;  5KFB A;  2XEX A;  4ZPW R;  2FLP A;  3D54 A;  1RYR A;  1GAO A;  3IXQ A;  1ULR A;  1L5U A;  1CJT A;  2ASY A;  3UDV A;  2MZJ A;  1FTC A;  1C0T A;  4NA2 A;  5KFE A;  1VQ5 S;  2ZBP A;  4I2Q B;  1K44 A;  1KLM B;  3S8S A;  2M7S A;  4ZVT B;  4TY9 A;  1Q81 T;  1HNV B;  5IM0 A;  3PYF A;  2ZM6 J;  2HVI A;  1JLC A;  4GRS A;  1NME B;  5IQQ A;  2XYG B;  4MKY A;  3OL9 A;  2N4D A;  3KG0 A;  2UXC J;  4DU7 A;  4OHV A;  2M70 A;  1NJZ A;  4WFA Q;  2DXE A;  2GO8 A;  4DOZ A;  5GAE I;  2WTF A;  1J5E J;  3W2W B;  2DPI A;  2VDI A;  3FJ2 A;  1J5E F;  1TL4 A;  5JXS A;  5ITH A;  3WBZ A;  1I1G A;  3CDU A;  5LMN F;  1RKI A;  2JBV A;  4ELU A;  1TKX A;  2FJD B;  2CPH A;  2KDO A;  1H3D A;  2E7X A;  1DAX A;  1VC6 A;  4Y28 C;  5KTQ A;  1WC3 A;  2H1Y A;  3Q86 A;  3ZZ0 A;  3VAJ A;  4WII A;  4ZOS A;  2RH3 A;  2L3M A;  2CPF A;  1QUP A;  3KDO A;  4QR0 A;  1S12 A;  1VFJ A;  1B7Y B;  2CQI A;  4B9U A;  2D7S A;  3MM7 A;  3S1T A;  4X62 F;  3PO4 A;  1G2E A;  5AT1 B;  1B0V A;  1RT1 A;  4RW4 B;  4ZP8 A;  4C0B A;  4F0H A;  1TMM A;  2ZH4 A;  1NZA A;  3DHW C;  3M2V B;  2V2Q A;  2Z2L A;  3LP1 B;  4HR2 A;  2VDH A;  4DZ6 A;  1OY9 A;  5F9L A;  1OQ3 A;  4W98 A;  3FUY A;  2JLF A;  4PG7 A;  5KFO A;  3VVU A;  1U1O A;  1VQO S;  2E5L J;  4OYO A;  2WSF C;  3QT8 A;  1R31 A;  1SH3 A;  1EJ7 L;  5EX3 A;  1U1Q A;  3BJY A;  1Y5N B;  2N3L A;  3BGU A;  4FVM A;  2HAI A;  4I6Y A;  3KG1 A;  5F3T A;  3WC0 A;  1DTT B;  3DMJ B;  1N5S A;  1ZTW A;  2WOM A;  4NA1 A;  4YEA A;  2BJ1 A;  2OSR A;  5F0U A;  5RUB A;  5KFS A;  5HL7 Q;  2ZVI A;  2DXD A;  1S6O A;  2A6M A;  2GFF A;  2R2R A;  1FKO A;  5K9F A;  4ME7 E;  1D8Y A;  1UVN A;  1JLF A;  1VHF A;  3EZ5 A;  1HBO A;  3T6B A;  1UAW A;  1NK7 A;  3SSR A;  2D9P A;  2JVR A;  2WW8 A;  3PY8 A;  1WDD A;  4JI4 F;  4JI4 J;  4PUO B;  4DPT A;  2H3E B;  5IT9 Y;  2QN6 B;  1HI0 P;  1MYL A;  2Q79 A;  1B99 A;  1HQ2 A;  4YB7 A;  3N0V A;  3S01 A;  5F8M A;  5JVG Q;  1FFW B;  2KFY A;  2CVE A;  3CDE A;  5LXY A;  2XZW A;  1SKS A;  2DO0 A;  1BXN A;  1OPZ A;  3EM1 A;  2P6T A;  4KYZ A;  5ETP A;  3ZZT A;  4B9M A;  2OPQ A;  4OZ3 A;  3Q24 A;  2HQ3 A;  4DXL A;  3IR5 B;  4ZPD A;  1SC3 B;  3VGU A;  4B3O B;  3D6T B;  3QT7 A;  5D4L A;  2DGO A;  3TZX A;  1NKE A;  2OMO A;  1YJW S;  2KT2 A;  2R9L A;  2HRY A;  4USI A;  4M94 A;  3ISZ A;  1EAY C;  1RT3 B;  2MZQ A;  3FFI B;  5E41 A;  1YRU A;  4ALZ A;  1JJ2 R;  1JX4 A;  1DJ0 A;  3LWM A;  4NZ0 A;  1N0V C;  2FYX A;  4CLP A;  3RU0 A;  1BQN B;  3H5Y A;  2LFV A;  2Q3P A;  4M5M A;  4OYM A;  4D3G A;  2AD9 A;  1T05 B;  3TUJ C;  3KMQ A;  3OR2 B;  1AW0 A;  2B6A B;  3DFE A;  4B9V A;  2JDJ A;  3KJF B;  3MD3 A;  3W65 A;  5I3Q A;  3KLF B;  2ZWP A;  3P6Y C;  2FZK B;  2AYE A;  5DG9 A;  1RWP B;  1CQM A;  2MKC A;  4RBT A;  4Y6I A;  4FDF A;  4CT8 A;  2M8H A;  1LQ9 A;  3LP0 A;  3CJ4 A;  2O5D A;  3HHK A;  5G0R B;  3NP5 A;  5LSR A;  2DNN A;  2V8H A;  2O3D A;  1TU0 B;  1IM6 A;  4RZR A;  1NPK A;  4KRW A;  1XR6 A;  2OEM A;  2CQ1 A;  2ZJP Q;  4CH7 A;  4ZVF A;  2Q43 A;  2Y8Y A;  1KWM A;  4DV1 F;  1F2G A;  3AOA A;  1JLA A;  1B4S A;  2LVW A;  3OFH A;  4U8Y A;  3VCD A;  1T7P A;  2VPY B;  1VQN S;  1TAU A;  4P74 A;  3CCS S;  5LMU J;  5KT6 A;  2OFG X;  2I5J A;  1UJ6 A;  1W26 A;  1WTB A;  4QPT A;  4K7Q A;  3NO7 A;  2L9D A;  2OO4 A;  3HMJ G;  3PG9 A;  2ZNY A;  4K4T A;  4Q0B A;  5DO2 A;  4NLU A;  4QIV A;  3G8S A;  1XK8 A;  2AU0 A;  3MUR P;  1Q86 T;  3DI6 A;  4KHP J;  5AE3 A;  5J1E B;  3KMS A;  1H74 A;  2LP4 A;  5DGA A;  1S97 A;  3CD6 S;  1HMV A;  1RT5 B;  5DDR C;  1V9O A;  1FK9 A;  1M90 T;  3BO4 A;  4I68 A;  4V1A k;  4NYP A;  4JYA F;  1U09 A;  2BKP A;  4RWX A;  4DLG A;  1L3T A;  4L3N A;  2AV5 A;  1HHS A;  3F41 A;  3ITH A;  4X65 J;  3MR6 A;  3AXM A;  5FD1 A;  3HDS A;  3BQ1 A;  1WDT A;  1K9M T;  3QRQ A;  1Q16 B;  3KK3 A;  3ISN C;  3DM2 A;  3TYT A;  3Q8Q B;  2L9W A;  3DLL Q;  4DV3 J;  2EFQ A;  4ZJL A;  4DR3 F;  4F8R A;  4LF4 F;  1CS4 A;  4G1P A;  3VGS A;  3OHA A;  2Z2M A;  4H4K A;  1WKJ A;  2CQC A;  2BNW A;  4LR9 A;  2E5G A;  4R0E A;  4F04 B;  3IP0 A;  4AL6 A;  2W4D A;  1U8W A;  5I3U A;  4F36 A;  4B3S F;  1YQH A;  4Q2M A;  4DPW A;  5IV4 A;  3GYX B;  4WU2 A;  1LKZ A;  3G8Q A;  3PFE A;  4HH0 A;  1GMU A;  2EBE A;  2W01 A;  3NGK A;  5D0E A;  1H38 A;  1VQM S;  2OPR B;  4XK8 C;  3AD9 C;  3SBM A;  1HPZ A;  3SSS A;  5DDP C;  2FD2 A;  4WFX A;  4WFB Q;  2HFN A;  3KK3 B;  2QLJ B;  4A4J A;  4KSE B;  4IRC A;  4HAC B;  2V68 A;  1WF1 A;  2WCX A;  4ZN3 A;  2PMH A;  3FRZ A;  4ES1 A;  5IZH A;  5AE1 A;  5LL6 d;  2PE8 A;  2K1O A;  4ZIV A;  4YHH J;  1Z1Z A;  3HD2 A;  3O1L A;  3W5X A;  3CJT A;  2D3O R;  1RAO A;  1Y10 A;  3OVS A;  2MY7 A;  3AJD A;  5AJ3 J;  3PHE A;  4KBI A;  4RBU A;  4O23 A;  3W64 A;  1N32 F;  2XI3 A;  1TEL A;  4JP8 A;  1U47 A;  3AXK A;  4Q0B B;  2V0N A;  5KT2 A;  3W5Z A;  1VK3 A;  2XMW A;  1U1M A;  3J7A 1;  3RG6 A;  5FJ4 A;  2AMC B;  2HMI A;  4K4Z A;  3IO1 A;  4U67 Q;  1D0E A;  5T7L B;  4MK8 A;  5LMU F;  1S7H A;  1MRO B;  4ZVG A;  4UZB A;  3W5Y A;  3MEC B;  4HT5 A;  1KBR A;  2QJ3 A;  4WE1 A;  5DLF A;  1L3S A;  2I6W A;  4OQJ A;  3M05 A;  1RT6 B;  1H7X A;  3KJN B;  4FYV B;  2F8H A;  1VC0 A;  2LU2 A;  1FXR A;  1WD6 A;  2B8Q A;  2HGN A;  4UOC A;  2GVZ A;  4ILR A;  3TJ9 A;  4DDF A;  2LEC A;  3HVW A;  4MKA A;  4JYA J;  2XCP A;  4NCG A;  4YS2 A;  1NK8 A;  2FLN A;  1KQK A;  1GX6 A;  4KFB A;  4LF6 F;  1B7F A;  5T41 A;  3DRS B;  3ZNJ 1;  4CNZ A;  3KLV A;  3FMT A;  3T5J A;  1L3V A;  4WYW A;  2RRA A;  1KSP A;  1AA1 B;  2RDI A;  1VBK A;  2AT1 B;  3KNA A;  4DG1 B;  2YNF A;  4PQU A;  2OLW A;  1XWL A;  3UFC X;  4N5S A;  3EXY A;  3K17 A;  1IM4 A;  5GAD U;  3K5M A;  2VB6 A;  2BW2 A;  3EVM A;  2XM3 A;  2B0G A;  2H5J B;  1NSQ A;  2HIY A;  1FNX H;  2HG4 A;  2ZIT A;  5T14 A;  1WG5 A;  3GYG A;  3MI7 X;  3MM8 B;  3K58 A;  5KFU A;  1QTG A;  4FZV A;  4DG1 A;  1RP5 A;  4DV5 F;  3PDN A;  3J7A N;  5F8G A;  1FTR A;  3ZZZ A;  2W8L A;  1FKP A;  4P7V A;  3K5N A;  1OYE A;  1ZZF A;  2EXU A;  5E7O B;  5A6W A;  3JAM Y;  4L3K A;  4DL4 A;  2FJE B;  2GHV C;  4BWM A;  4JI5 J;  5J2M A;  2VG5 B;  5EWE A;  2XB2 D;  3NGU A;  2NQP A;  2R4F A;  3IAS 9;  3MPW A;  1UCN A;  1I94 J;  4TVA B;  3KLG A;  3MFH A;  1T3O A;  2FVC A;  1WI8 A;  1HHT P;  2CPI A;  5D0H A;  1DTT A;  2MLZ A;  2KRB A;  2Z4P A;  3DMJ A;  2PGC A;  2PN6 A;  2ZBI A;  4WE1 B;  1P8G A;  1QAX A;  3AOB A;  4CLZ A;  2NZ4 A;  1KON A;  3F44 A;  2XS2 A;  5KFT A;  1WHV A;  2HBR B;  3IGV A;  5DZ6 A;  3PVX A;  4X64 J;  2HK2 A;  2FHJ D;  2BAN A;  2K29 A;  2Z8Q A;  2HFZ A;  2W9C A;  4FF2 A;  3O44 A;  4OV1 A;  3UD4 P;  4IYQ A;  5K5M A;  4X4U A;  3KOA A;  2J7U A;  2X7I A;  4CLY A;  3HD1 A;  3GP9 A;  1JXV A;  4NX9 A;  2DY9 A;  4ZLL A;  1S0O A;  5IT0 A;  3JSB A;  4KGX B;  2IMW P;  2JXI A;  2YKA A;  3TWZ A;  4B02 A;  4BDP A;  4NEY A;  3TJA A;  4ED3 A;  4MKV A;  2E5J A;  3UVJ A;  3EYZ A;  4UT4 A;  2JC0 A;  2NUH A;  3DLE B;  4JUZ A;  4DSL A;  3Q2T C;  3MOZ A;  1WSR A;  1XNQ J;  3TEG A;  3M4X A;  1AXQ A;  2WB4 A;  3H40 A;  3TAR A;  2YX7 A;  1YWX A;  4IR9 A;  2J9E A;  3M30 B;  3C3L A;  3RBE A;  1M5K C;  1SH0 A;  1SB6 A;  4HI2 A;  4KAI A;  4B08 A;  4ETZ A;  2U1A A;  5M2P A;  4A8Y A;  1U1N A;  3CSK A;  5E0O A;  2WVC A;  4FPR A;  1GMW A;  2YPZ A;  3G6X A;  2HVH A;  5E3A A;  2RKI B;  2J5A A;  3GG1 A;  3QQC D;  3SQO P;  3N9U C;  3HHL A;  3QGH A;  4IRD A;  3NMR A;  1LW0 A;  1REV A;  2QA2 A;  5A8R A;  1PYT A;  1HNX J;  1QAJ A;  1Q8K A;  1NH7 A;  1N56 A;  1XTZ A;  1H98 A;  4K4X A;  1UWB A;  1T03 A;  2V50 A;  1XMB A;  1NSP A;  3NWG A;  3R5C A;  2JH3 A;  3L7U A;  5H9F J;  5I3U B;  1YJU A;  3R2D J;  3FCH A;  4U9R A;  2KYX A;  3M9O B;  2CNK B;  5H9E J;  3EZO A;  3HF5 A;  3NBP A;  2VFT A;  4O3O A;  2OH2 A;  1IBC B;  2CG4 A;  3E01 B;  5GAG U;  2IDE A;  3HHE A;  1SQE A;  4ECW A;  1P94 A;  2BJ9 A;  2HUR A;  1N48 A;  3L9Z A;  1CSJ A;  3AD7 C;  2B7B B;  1S0V A;  1FA0 A;  1TAQ A;  2WVD A;  5DDQ C;  3KHH A;  3DRY A;  1R0B G;  1S99 A;  3TW0 A;  2AJQ A;  4HTJ A;  3OXL A;  5A8W B;  5CXT A;  5HQL A;  5CCM A;  1YIT S;  2DHS A;  2P9E A;  3OUY A;  1TL1 B;  1X4B A;  2KT3 A;  3K8V A;  4X4T A;  2NYH A;  4NYO A;  5D6G A;  5C24 B;  2HHP A;  2AIR B;  4V19 J;  1S57 A;  3BKT A;  3HUL A;  1XBW A;  5ETT A;  2CQ2 A;  2YWG A;  2N3O A;  4C8K A;  1JLA B;  2DKO B;  1P9Q C;  3RAX A;  2UV8 G;  4C3K A;  4CLU A;  3JTO A;  4MIA A;  1WSV A;  3CIM A;  2RDD A;  2C2E A;  5L9N A;  2JLE A;  4EWT A;  1G6B A;  2VH7 A;  5G0R A;  4CM2 A;  3K59 A;  3OBI A;  2CPX A;  4U7U K;  2OTJ S;  2AJ1 A;  2G13 A;  5A8K A;  2PI4 A;  2L48 A;  3W3S A;  3SCK E;  1N33 J;  3C16 B;  2DR5 A;  2GGP A;  4DL3 A;  4X4S A;  4DQS A;  1WEY A;  1PIL A;  1L3U A;  2NXC A;  4DQI A;  2YKN A;  2YY3 A;  2RQK A;  3OTE A;  3PM9 A;  3W2V B;  3CIZ A;  2JLG A;  1FJG F;  3BGL A;  3QT6 A;  2QLW A;  1FDD A;  3KUH A;  1S0M A;  2V4J A;  2VF3 A;  3MAA A;  4P71 A;  3GCW P;  5DRK A;  3KJV A;  3CTR A;  1T03 B;  2QMX A;  4KV8 A;  2QTW A;  3B6B A;  1Q8I A;  3QWU A;  1TK8 A;  1XMQ F;  5C42 B;  4OL8 A;  4L74 A;  4DUZ F;  1IKW B;  3NXZ A;  3DOM B;  4XIU A;  1G3O A;  3ONQ A;  1HNI A;  2GVD A;  5AXN A;  1WKK A;  2AEM A;  4DLE A;  2ZHO A;  1UPM B;  1BC6 A;  1UWB B;  3IRX B;  4K0K F;  2CNN B;  1UTA A;  2HEK A;  1BDT A;  3RZA A;  2ROG A;  3B4M A;  4O4G B;  4OHX A;  3PR5 B;  4J9S A;  3HX9 A;  1LEO A;  1OJ4 A;  3L09 A;  1EKS A;  1PKU A;  2CJB A;  3MCS A;  4I56 A;  4DUY F;  1U1K A;  3MEG B;  5B0F A;  2V6A A;  4C98 A;  3D68 A;  4TXS A;  1R7I A;  2E66 A;  3GB0 A;  3IBF B;  3SV4 A;  2UUC F;  1X4H A;  2A2C A;  3CED A;  3CVK A;  1CUL B;  3CF5 Q;  1UFK A;  1G4C A;  1X4G A;  2BKO A;  4R25 A;  4FYY B;  4LFB J;  1PAR A;  1T9W A;  1NSK L;  2E5I A;  3FZ2 A;  3R5A A;  1SV5 B;  3M30 A;  4DZD A;  2RIJ A;  4J9M A;  3VWS A;  3PW0 A;  1S9F A;  3HM9 A;  1MMN A;  1E6V B;  4K50 A;  3T1A A;  4KHR A;  1HBO B;  2FLL A;  5EN1 A;  4DL6 A;  1NHU A;  1IQZ A;  5DGB A;  5HAO A;  3D0G E;  3BN7 A;  1UL3 A;  3M2R A;  1WEX A;  3SCI E;  4NXM J;  3ILO A;  1N88 A;  1LWF B;  3KLI B;  3SQG A;  4IG0 A;  3QPI A;  1N34 F;  2YQ1 A;  3H8Y A;  4IO9 Q;  2D41 A;  1RT1 B;  2LDI A;  4RW4 A;  4TNO A;  3CO9 A;  3CCR S;  1WOS A;  1WOR A;  3DLB A;  1YI2 S;  5G4D A;  1KVK A;  4ELV A;  3EGW B;  2DNL A;  4RR5 A;  1VIS A;  3HSZ A;  4UQT A;  3ICL A;  2ZH9 A;  3HHN B;  1RAE B;  5BYQ A;  3CJR A;  3KLI A;  4P9S A;  4DBQ A;  1OWX A;  3M2R B;  4L6V 3;  1QLN A;  4LQ9 A;  1T8E A;  2JEI A;  5J2M B;  3P5B P;  5MLC V;  2QMW A;  2VC0 A;  2GW8 A;  3FEY B;  3LPY A;  4YR3 A;  3MPD A;  1VBY A;  4FF1 A;  1RLC L;  5ETR A;  4LRE A;  4QQB A;  4J9P A;  1RHK B;  2GIF A;  5I42 A;  1HD1 A;  3SFU A;  1Y7P A;  2ZNZ A;  4KPC A;  3UO0 A;  3OR1 A;  1WC0 A;  3GFH A;  1FX4 A;  5DQI A;  2CQ0 A;  5K14 A;  5EGY A;  2ILZ A;  3GIM A;  1FJG J;  3NMA A;  2MEW A;  2L9N A;  5HQM A;  4PPZ A;  4UOF A;  2JXG A;  3DRP A;  4RUB A;  3Q8S B;  1RU1 A;  1Z2L A;  2YNI B;  1XMQ J;  4RLE A;  2C42 A;  1TMJ A;  1CLF A;  3DGV A;  1XN9 A;  4MK7 A;  2ATC B;  3I31 A;  2AZ3 A;  3QO9 A;  4NWB A;  1NJY A;  1ITP A;  2XGQ A;  3CGI A;  2G2Y A;  3JXO A;  1GXL A;  1ELO A;  3DGP A;  4AT1 B;  2DIS A;  3V81 A;  2CVI A;  5B0B A;  3LGM A;  4CLK A;  5H1S V;  2ZE2 A;  1YSJ A;  2DH9 A;  4TLQ A;  5FII A;  4OX8 A;  3R5G A;  4PQA A;  2KHD A;  4WXO A;  3ENV A;  1S1T A;  3QT5 A;  2H9Z A;  4JI8 F;  3J81 U;  1Y4Z B;  5HVH A;  3OL6 A;  5DG7 A;  2V4R A;  4QR2 A;  2OGU A;  3IR6 B;  3Q83 A;  2R8G A;  3GJS B;  3MCM A;  2E9Z A;  3NGR A;  2IDL A;  1RKJ A;  2JRS A;  3B54 A;  3TEH B;  1X4D A;  4KFB B;  4NYZ A;  2A2D A;  4CO1 A;  2GGP B;  4DFP A;  4NCG B;  1IBM J;  3ZZP A;  1KS2 A;  2D1C A;  3H0P A;  1S48 A;  1UFW A;  1X5T A;  4MFB B;  4WKY A;  5A8K B;  1YJR A;  5DLG A;  4M5I A;  2A2B A;  1ZZN A;  5KFX A;  3C15 A;  5HN0 A;  2BZ2 A;  2XHC A;  4WZM A;  2K6L A;  3VAH A;  1S7I A;  3R7N B;  2ZKU A;  3D1H A;  1B3T A;  3LP2 B;  3MZI A;  1HNZ F;  2ZZN A;  3K5P A;  5K20 B;  2V94 A;  3BGF A;  3FBB A;  1RGV A;  1SJ3 P;  4OZN A;  1BWV A;  1OS5 A;  2M4M A;  3NEK A;  3M8S A;  4PWD A;  3HKW A;  4N56 A;  1MRO A;  2OP5 A;  3HCX A;  3UDE A;  3JAM U;  1FJ7 A;  5LXR A;  2J7W A;  3KTQ A;  2BE9 B;  1RE1 B;  2XLJ A;  1HWJ A;  1OIA A;  1BDV A;  2DRA A;  3BGO P;  3C6T A;  1Q7L B;  2BR0 A;  1QAY A;  5SZT A;  2QA1 A;  3AFG A;  1TVR A;  2FB0 A;  5ETK A;  3R3T A;  5A8W A;  2B9E A;  1G7C B;  3N4W A;  1FRM A;  4P2X A;  2QIF A;  2EG1 A;  3D66 A;  5J2N A;  3OVB A;  3I56 S;  4ZPB A;  3OV7 A;  4CLT A;  1H2U X;  1JLG A;  2YKP A;  5F0W A;  2MZR A;  3AB4 B;  5B0E A;  5C25 A;  2IAJ B;  5BR8 F;  3QLH A;  3DDK A;  3NBP B;  3EGN A;  4YDX A;  4F4Y A;  4LF5 F;  3CCE S;  2FVQ A;  1T11 A;  1CVJ A;  2V9W A;  4C11 B;  3MM5 A;  4DV0 F;  4OJH A;  2GQQ A;  2C3O A;  4PEO A;  2F63 A;  2ZH7 A;  5DQG A;  5D4P A;  3RBD A;  4LF9 F;  1S9G B;  2RSQ A;  2X1G A;  3CO0 P;  4M95 A;  2J9C A;  3KKF A;  4DI6 A;  4H4M A;  6FDR A;  3TA1 A;  4C9D A;  5KFM A;  4RPF A;  1N6Q A;  4QZV B;  2B5J B;  2CJA A;  2FGC A;  4M5H A;  2ZVS A;  3VAM A;  5IWA F;  1TL7 A;  4JOU A;  5KFV A;  3UI3 A;  2X3G A;  5C5J A;  4N8N A;  4DV7 J;  4ETX A;  2ZOF A;  5HBM A;  3AA9 A;  4DV7 F;  2G0C A;  3PEH A;  4OI4 A;  3W61 A;  2HQF A;  5K8M A;  1Q16 A;  4Y3C A;  2IJN A;  4WFY A;  3M2U A;  3FDS A;  2LMI A;  2LXI A;  1S9E B;  1LK5 A;  4ZVP B;  4YHH F;  3JTP A;  1N52 B;  3ITH B;  4LIW A;  2RUS A;  4KJI A;  4GKK J;  3NL0 A;  3VEB A;  5CHC B;  3PYG A;  3W7B A;  4O3N A;  2G0I A;  2IAJ A;  4KC5 A;  4LFA F;  1H72 C;  4L73 A;  3OHB A;  1WC6 A;  3C14 A;  5HMX A;  2ZH1 A;  1DLO A;  2MKY A;  2WK4 A;  4B9L A;  1EP4 A;  1LWX A;  1RT5 A;  1VYA A;  2A6O A;  3PCO B;  1XR7 A;  3BKU A;  2BXJ A;  1U6F A;  1H6K X;  4PPD A;  2MQQ A;  1KP6 A;  3KHR A;  3BGR A;  1YJT A;  3C6U B;  4ZVQ B;  1H2T Z;  1HWU A;  2MGZ B;  4LSN A;  1WC1 A;  4PG5 A;  3MR7 A;  4F4Z A;  3NAH A;  2M2B A;  1T95 A;  2AJ0 A;  2BAN B;  1T9X A;  4R8U A;  3LP2 A;  4DX8 H;  2H48 B;  3I5A A;  4IG3 A;  3CCU S;  2CQG A;  1QVG R;  4LBH A;  3NLC A;  3MTJ A;  5KOW A;  4QU6 A;  2KXH A;  1RAC B;  1RHU B;  4ZVU B;  2U2F A;  1I3O B;  4PWD B;  3PKY A;  1R8B A;  1RT4 B;  1UFL A;  3FCV A;  3HFK A;  4JV2 A;  4FF3 A;  3QJP A;  3TUP A;  1HQE B;  3C8Y A;  3SFG A;  1U26 A;  5E5N A;  3KLG B;  2BJ8 A;  1EB0 A;  3BYR A;  4CI0 B;  3P49 B;  2AJ2 A;  3ET6 B;  4CWB A;  5ETN A;  3NNC A;  2XSJ B;  4P2M A;  1D9A A;  2VG5 A;  2N7C A;  2VD3 A;  1Q4R A;  4HTI A;  3JSM B;  3GII A;  1MG7 A;  3ZTQ A;  5B0C A;  1B28 A;  1RHQ B;  3A4T A;  3BR9 A;  2PFD A;  4MH8 A;  4QYR A;  2XHW A;  4QBU A;  2AX1 A;  3TZZ A;  3T5L A;  3O2I A;  3FMW A;  5MAO A;  1MNE A;  3QMQ A;  3TVY A;  4PCQ A;  4PXD A;  3LGH A;  2R7T A;  5IQ6 A;  1R6Y A;  4ZVS B;  2LA4 A;  3FFI A;  2ASJ A;  3ZZO A;  1U8S A;  4F67 A;  2EG2 A;  3H7H B;  1WF0 A;  4ZVE A;  4WFN Q;  4OI0 A;  3HVT A;  3DOK B;  4LSZ B;  1D9F A;  2AEF A;  1P1L A;  5JVH Q;  1RJJ A;  2IM3 A;  3GIR A;  2FJW A;  4C8Z A;  4OZ1 A;  3BZQ A;  4ENO A;  3GXQ A;  4I6W A;  3DDN A;  1H2V Z;  5DM6 Q;  3CCW A;  3VEA A;  3V6H A;  5JUM A;  1UVJ A;  3WIV A;  1TL3 A;  3Q8U A;  1RAA B;  4HHU A;  4P7T A;  4F4A A;  2XCA A;  5K14 B;  3CW2 C;  3U7J A;  2DGQ A;  5AE2 A;  2AGO A;  2IBO A;  4PAA A;  1N5T A;  1ZAW A;  1CC8 A;  3QGP A;  4DR6 F;  2DNO A;  4OZJ A;  3PR4 A;  4GKK F;  5EWG A;  4OZ0 A;  1S10 A;  1S1U A;  2AYB A;  4O3Q A;  2GV1 A;  5HMZ A;  3HK2 A;  3A3N B;  5HRO A;  2J6U A;  2CZ9 A;  4OI6 A;  1GFW B;  2UUB J;  4V19 X;  3G82 B;  2XY6 A;  1KFD A;  4URG A;  5HK4 A;  3DOL B;  1NDP A;  1B0P A;  2UXD J;  2AJ4 A;  3SZ2 A;  1RA6 A;  1KDN A;  4YB1 P;  3MEC A;  1X4A A;  2V5H G;  2KB2 A;  3MDF A;  4OX6 A;  1RT7 B;  2DHG A;  3ENA A;  1PYS B;  3IBW A;  2VHG A;  1YTY A;  4BS2 A;  2W7A A;  1RTJ B;  1U0H A;  3IMQ J;  4PG6 A;  4YQW A;  2KM8 B;  1NND A;  1FRL A;  2I1R A;  4PXE A;  1R0A A;  2I2Y A;  3K0J A;  5EX0 A;  4JV0 A;  2VOP A;  3H90 A;  5KG1 A;  1HYS B;  4CO4 A;  1FRJ A;  4J9N A;  4NLP A;  1MML A;  3KDN A;  1YHQ S;  3HZE A;  1WG1 A;  2YWF A;  3EGZ A;  4Q43 A;  4B3M F;  3G6V A;  1ARR A;  4O3P A;  4IO1 A;  3UDL A;  2CWK A;  1F5C A;  1Y3J A;  4RL1 A;  2Q2K A;  3CCV S;  3PKM A;  1F3F A;  4YOE A;  4G1Q A;  5CYQ B;  2HBZ B;  4ZCL A;  2KO1 A;  3AJ1 A;  2M9K A;  3THP A;  5E3R A;  2WVF A;  4H4O A;  4PYA A;  3WIU A;  4EO6 A;  7AT1 B;  3OFE A;  5J1P A;  2ASD A;  5GAG I;  1FFG B;  1E6V A;  4M1K A;  1CJK A;  2XTJ P;  2JX2 A;  4NZ6 A;  4OI2 A;  4DCO B;  2KG1 A;  2MHN A;  5IM0 B;  1YKW A;  3AB2 B;  4GO5 X;  2GCF A;  1KLM A;  4F50 A;  3L7O A;  4IDK B;  1VI7 A;  4DEZ A;  4B3R F;  2OPR A;  1V5I B;  2DH7 A;  2ALZ A;  1AZS A;  2FHJ A;  4F4K A;  4O3S A;  4KR0 B;  2HWI A;  1HYS A;  5I3P A;  3I55 S;  1IBL F;  2CJK A;  2DHH A;  2DT9 A;  3MMA A;  4Y65 A;  4CO5 A;  3I0S B;  1Q0N A;  3TRG A;  3GV7 B;  3LOU A;  2FJV A;  2CXE A;  1C0U B;  1YRT A;  2D3U A;  3N5B A;  3RB3 A;  3ADA C;  2VKZ G;  3VW4 A;  4J9L A;  2OEK A;  4J90 A;  3V4M A;  3B82 A;  4L76 A;  2ZD1 A;  3RW6 A;  2IRX A;  3ULH A;  3DKD A;  2RJZ A;  4CT9 A;  2C3Y A;  3FQL A;  4H54 A;  3UD5 A;  2HZA A;  2OUG A;  3W63 A;  2QL5 B;  3BPS P;  4F7V A;  3DOM A;  1PAE X;  3TNV A;  4OX7 A;  2LQJ A;  3O6Q A;  2RNE A;  4LQ3 A;  1EZZ B;  2KN4 A;  1S79 A;  3BV8 A;  3GTY X;  2C2K B;  3BDP A;  1RT2 A;  4AL7 A;  4WK3 A;  2PC6 A;  2FVS A;  2R2S A;  3GCX P;  3W9J A;  5HMW A;  2GZO A;  3M8Z A;  5J2P A;  4NRT A;  1V3Z A;  2FUG 9;  1X31 C;  2HQC A;  4OV6 A;  2W9B A;  1FWL A;  2IA0 A;  2Y1R I;  4ECX A;  4ZP7 A;  1NPP A;  4LF7 J;  4G3I A;  2UXB F;  1APS A;  3IWX A;  1M5H A;  3ENW A;  3U27 A;  3HT3 A;  2BQR A;  4H4K C;  2RHS B;  5IXU A;  3GFZ A;  3UCZ P;  5KFG A;  1IR1 A;  4USU A;  2WVB A;  2A3J A;  1P27 B;  2D3O 1;  1RTD B;  5ETS A;  3BSO A;  5DET A;  5KFN A;  5IT4 A;  1R89 A;  3KK2 A;  3KK2 B;  2XBP A;  1SC6 A;  5L1I A;  3TQE A;  2FC8 A;  2RML A;  5BYS A;  2KOE A;  1BQM B;  4NLV A;  5HMY A;  4WYL A;  2GNK A;  1XC9 A;  2NRE A;  4W92 B;  1Q78 A;  1VIO A;  2OFH X;  3GJT B;  2VUG A;  1MWQ A;  4KKO A;  4ID5 B;  1GK8 A;  3D4J A;  3RGI A;  5KG6 A;  3ELH A;  2CQH A;  4ED0 A;  9ATC B;  1IRQ A;  1ZM4 A;  4L75 A;  3UWT A;  2CAX A;  1Q5Y A;  3DLK B;  1RWV B;  2V69 A;  1IWA A;  3MM9 A;  4Z7Y A;  4X4Q A;  2RS8 A;  1N5V A;  4DR5 F;  1NAQ A;  3HZG A;  4J9K A;  5B09 A;  1VBZ A;  2R7Q A;  2I0X A;  2ZD1 B;  2I8E A;  3E01 A;  2K1R B;  3I5B A;  5B0A A;  3KHG A;  1ZTT A;  1R8C A;  4GO7 X;  1LW0 B;  2EWH A;  1TL7 B;  4ECS A;  3CME S;  2R7R A;  4Y00 A;  4JI3 F;  2W4C A;  2B4P A;  3QID A;  2RKI A;  4PWW A;  2BYC A;  3UNG C;  3I0R A;  4QYZ K;  1IKY A;  1S1V A;  2Z56 B;  5A8R B;  2OTL S;  1ZA2 B;  2QMU B;  2YQ3 A;  4ZVO B;  4A47 A;  2XS7 A;  3MM6 A;  5C7P A;  3ISN D;  5F8J A;  3D1Q A;  4ED8 A;  4I1T A;  4KH1 B;  3SCJ E;  2E7V A;  3OTD A;  3D6F B;  3EJM A;  3GU0 A;  4F4W A;  8AT1 B;  1F3V A;  1JLF B;  1W7W A;  2GAH C;  3DLJ A;  3DLE A;  3EVW A;  4TN2 A;  1VQ7 S;  2LLZ A;  1KRP A;  1UVK A;  4FNI A;  3AHP A;  3MF5 A;  1A7G E;  5K8N A;  1KR4 A;  2R2U A;  2Y9H A;  2V67 A;  3G86 A;  3MR5 A;  5B08 A;  3UDC A;  1C4C A;  4TU7 A;  1D1U A;  2QL9 B;  4LT6 A;  3MR2 A;  4IOA Q;  4X66 J;  1RAG B;  2J8A A;  2YPY A;  2BJE A;  5HAT A;  4W90 B;  4X66 F;  1OG7 A;  3WX8 A;  5B7W A;  4EEY A;  1VRQ C;  1SJQ A;  2P5V A;  3CD7 A;  4OMF G;  3C6T B;  2ZH6 A;  4MK9 A;  1J2V A;  2YKM A;  3LP1 A;  3CJ0 A;  5D4N A;  5IFM A;  3KK1 A;  2EEY A;  2RU3 A;  4ED5 A;  2ZHA A;  1UZD A;  3DRR B;  5L1J A;  4AQY F;  4X62 J;  3C66 A;  3IS9 A;  3V4I B;  2BKN A;  3ZXW A;  5KG0 A;  3H20 A;  1WOP A;  1S49 A;  3OTO J;  4TU8 A;  2J9D A;  4ZKA A;  2ACM A;  2GML A;  1AYE A;  1A6L A;  4ES2 A;  1LK7 A;  2WAQ D;  3PEJ A;  1EQM A;  3MAH A;  4JI2 J;  2HNZ A;  4URS A;  3AAW B;  4U96 A;  4F2R A;  1NSA A;  3NS5 A;  5CYM A;  1NJX A;  4QIE A;  3FK4 A;  1NLA A;  3N6M A;  4IOC Q;  2GX8 A;  3OTC A;  2POK A;  2WVE A;  2ADC A;  4B9T A;  4WZQ A;  2M52 A;  2CAJ A;  2B43 A;  1HBU A;  3DOL A;  1VS3 A;  3MUT P;  2ATL A;  2LKZ A;  3M8Q A;  1Y5I B;  2C1E B;  4KO0 A;  1N6Q B;  4F02 A;  1AFI A;  2QE5 A;  2XZD B;  5A0Y A;  3R2C J;  4UUX A;  1KVJ A;  1Q5V A;  1NM2 A;  1JK9 B;  1FVS A;  3J7Y I;  3DDI A;  1M0S A;  3ILJ A;  1VQK S;  2D3Z A;  1HNV A;  1YK9 A;  2CJQ A;  3I32 A;  2DEJ A;  2G1H A;  3BYP A;  4ED1 A;  1RHR B;  4IR1 A;  1L3K A;  4DF8 A;  2J0Q D;  1MLA A;  2CPY A;  3NGD A;  2J6T A;  3HVT B;  4ED4 A;  5A2Q U;  1TL3 B;  4UY8 5;  1SKW A;  5F8H A;  3PTW A;  2MJN A;  3GON A;  2EFG A;  4NA3 A;  5D0G A;  3MCN A;  3MM8 A;  4CO2 A;  1NKB A;  3BKF A;  3RR8 A;  1RTH A;  3VQS A;  3NG8 A;  4NLX A;  3OFF A;  3DRS A;  4DR7 J;  1NUE A;  4IFY A;  4GVB A;  4RWW A;  4NCB A;  2YNI A;  3M7V A;  3VGV A;  2Z2Y B;  4WFZ A;  5KFJ A;  4I6A A;  3UR3 C;  2F8E X;  4EI2 A;  4C2M A;  1M1H A;  1DTQ A;  1TR0 A;  3HKZ D;  2YNG A;  3RBX A;  4WP3 A;  1HR0 J;  2F4V J;  3M8Q B;  2GJF A;  1RBA A;  1GXU A;  1RAH B;  2W2M P;  3JQM A;  1K47 A;  4M5D B;  3VAL A;  1HR0 F;  2F4V F;  2IJR A;  3PAC A;  1DBD A;  2EVZ A;  3PRB A;  5CYM B;  5DM7 Q;  4K4U A;  1YBA A;  1YJ9 S;  4CO3 A;  2AY0 A;  2XSJ A;  2DGV A;  4LRV A;  3T41 A;  5T7L A;  3LAN A;  1EQ0 A;  1FES A;  3DLG B;  1TP7 A;  3D9B A;  5AXK A;  1HI8 A;  4K4Y A;  1UVM A;  3G9C A;  1RUS A;  2FGO A;  2BOP A;  2F5G A;  4Y2I A;  2KU7 A;  1FE4 A;  1NDC A;  3H42 A;  3UNY A;  4TLR A;  4MJK A;  2B9X A;  2J8S A;  1XIQ A;  2XMA A;  1CJV A;  2QZ8 A;  1NXI A;  4DV1 J;  1YJN S;  4OX9 J;  4Z2X A;  3ZNU A;  2IVM A;  2DR7 A;  2JWN A;  4CLL A;  2RE1 A;  1DLO B;  4QW8 A;  2RS2 A;  2E1C A;  2ROP A;  5EDW A;  1VLO A;  1UVI A;  1B0T A;  4PKD B;  4TQR A;  3BGR B;  4RX6 A;  1XNR J;  2HPU A;  4EUV A;  2FVP A;  4AAI A;  1GMW D;  1TKZ A;  1Y00 A;  2CWX A;  5HQ8 A;  1XEZ A;  2IY5 B;  2SXL A;  1SV5 A;  3D3B J;  1HLW A;  2OI2 A;  2VFS A;  3G8T A;  2XLI A;  2BQ3 A;  1K0T A;  3KG4 A;  1S1V B;  2CJY B;  2V2Z A;  2Z0G A;  5J2Q A;  2KXN B;  1NEE A;  2ZJQ Q;  2YWK A;  3A13 A;  1CG2 A;  1RAF B;  5D4O A;  2QEX S;  1SL2 A;  4X65 F;  1OHN A;  1T02 A;  2YVS A;  5E3C A;  1HW9 A;  2V34 A;  4X4V A;  2ZUG A;  2Y0S D;  4CO0 A;  2PDA A;  3DN9 A;  3RRH A;  2G0J A;  4O4G A;  1SJ1 A;  3CB4 A;  1IJF B;  3EMT A;  1TFW A;  1YVF A;  2ALY B;  2KI2 A;  1B70 B;  3M6X A;  5HO4 A;  2DPJ A;  4Q2L A;  4RW8 A;  1ZH5 A;  4KGV B;  1DRZ A;  1YRX A;  4YB6 A;  2LEA A;  2CQP A;  4WK1 A;  5KFK A;  1O8B A;  4OYI A;  1VCT A;  2OJ3 A;  1FNO A;  1F0X A;  2CPZ A;  4FF4 A;  1CS4 B;  2VBW A;  2PD1 A;  1U45 A;  1TV6 B;  4J9Q A;  1MNT A;  1S6Q B;  2BE2 A;  4TKT A;  1WC4 A;  4MIW A;  2XMU A;  2MYF A;  3AT1 B;  2O1P A;  4WTY A;  3MFI A;  3MM9 B;  3ENQ A;  1KTQ A;  2QSF A;  3G5O A;  1RQ0 A;  3DLK A;  3SEO A;  1AUD A;  2YKN B;  3O5T B;  2MZS A;  1FVQ A;  4ZHR B;  2MKH A;  4RU2 A;  1S0N A;  4NCA A;  1SL1 A;  1JMT A;  1TVR B;  1VBX A;  3MUV P;  3NKY A;  3BBC A;  4KGK A;  3CCJ S;  3MGJ A;  1CPZ A;  2MQ8 A;  1T9T A;  1EET B;  1LWE B;  3PNI A;  1AB8 A;  2QT7 A;  4FXE A;  4O0N A;  3ZFV A;  2C28 A;  2ZOM A;  4AXJ A;  5CH7 B;  4HDG A;  4CH1 A;  4PWU A;  1ZM3 A;  2FHO B;  3DI6 B;  3R1H A;  1KQS R;  2UVW A;  3DLH A;  4ILL A;  1WJ9 A;  2MLY A;  4RUA A;  4K59 A;  2DD8 S;  4L72 B;  1HNZ J;  2Z57 B;  1X5S A;  2CRL A;  2I5J B;  3P96 A;  4RNO A;  3T5K A;  3M8P B;  1RTD A;  2DNR A;  2B9W A;  4M63 A;  2HYI B;  3H5U A;  3T1Y F;  1C1C A;  3CJQ A;  4RBV A;  4WP8 A;  1GEH A;  3LGN A;  4K8R A;  2DY1 A;  1BY9 A;  4F0K A;  4LBP A;  2HS0 A;  2ILY A;  2W7O A;  4M5D A;  2UUA J;  1HQU B;  5J2P B;  1SL0 A;  2MST A;  1VJW A;  3AOD A;  2UUA F;  2DIT A;  1JLE B;  4WBF A;  2XMJ A;  2BA3 A;  4HV0 A;  1DQA A;  2VV5 A;  1RWM B;  2DNP A;  2F9D A;  2CDR B;  3CJK B;  3FEZ A;  1LW2 A;  3PX0 A;  1MN7 A;  3R5D A;  7FD1 A;  1R43 A;  3GJQ B;  2JNJ A;  1W2B R;  1PG5 B;  2JJ4 D;  5KFZ A;  1JXE A;  2AP6 A;  4GVL A;  2DGW A;  3PJ9 A;  3ZO7 A;  1RDR A;  4GKJ J;  1SIZ A;  2YTC A;  1RAB B;  1RT3 A;  1FXL A;  4MJW A;  1OSC A;  3UD3 P;  3W9I A;  4WJB A;  2PI5 A;  3UCU P;  1JWW A;  2PA3 A;  4G1I A;  1X4C A;  2K7J A;  2AKW B;  4P2F A;  1PCA A;  3GSI A;  2XQC A;  1WKL A;  1K1Q A;  2ERR A;  4OYA A;  3CC4 S;  1YBT A;  1GQE A;  2OPP B;  2HND B;  3E3X A;  1U0S A;  1NK5 A;  3QO9 B;  2JL9 A;  3H59 A;  4KO0 B;  2VJU A;  2KJW A;  2FJA B;  1IBK J;  5CAB A;  1S6P B;  4YY3 J;  2WOM B;  3L7P A;  3M8R A;  1CJK B;  3LUY A;  1IBK F;  1KNZ A;  1WEL A;  1HBM A;  1HNW J;  3MMB B;  1ZET A;  2Z2Z A;  2MQL A;  2W2P P;  2AGQ A;  2AN7 A;  2JEF A;  4DSK A;  4BC9 A;  4MAK A;  2LQ5 A;  2HNZ B;  3VAI A;  4G1Q B;  3TZY A;  3BQ0 A;  4N8O A;  2C2N A;  3D67 A;  1YZ6 A;  5CA5 A;  5F8L A;  5I42 B;  3M2V A;  4NMX A;  4ZVR B;  4DHV A;  1XMO J;  3O8W A;  4TY8 A;  1WHX A;  3QRR A;  1XMO F;  2HHU A;  5KFA A;  3ILI A;  2GQ2 A;  2IA6 A;  3W8P A;  1VMB A;  2DGT A;  2APO A;  3NGS A;  4ZCK A;  2P9C A;  4ZCM A;  5KFD A;  3HXM A;  1JJC B;  1O5J A;  1TZ0 A;  2KXF A;  3QFW A;  2HS4 A;  4NZ7 A;  1TTH B;  4ANE A;  2LEB A;  3CNQ P;  1LWF A;  3ETO A;  2EFV A;  3SQG B;  3ZTS A;  2L08 A;  1RBO B;  2CPJ A;  3PRV A;  3MM7 B;  2WZ1 A;  2A0F B;  4S0M A;  3BQ2 A;  4PG8 A;  2AQ4 A;  4Y2A A;  1ICE B;  2R8I A;  5KFF A;  3RB6 A;  4RUC A;  2BVZ A;  2KTQ A;  4X4R A;  4IG0 B;  1ZAV A;  1TK5 A;  2J76 E;  4P73 A;  4LFC J;  2EFN A;  3UQS A;  2HFS A;  4XDD A;  1PC4 A;  3UR0 A;  2HRT A;  3JB9 k;  2P8I A;  1NKC A;  2UZA A;  4EGL A;  1XQI A;  3IG1 B;  2RBF A;  2B3T B;  1MN9 A;  1S6P A;  1IBL J;  3OLB A;  2MLX A;  2X51 A;  1YIJ S;  4KE5 A;  2KRR A;  3VV2 B;  4ZMM A;  4I4B A;  3VVT A;  3OJS A;  3VGT A;  4ATN A;  1OO0 B;  4QOT A;  8ATC B;  1M1K T;  2XSF A;  2C2Z B;  3FT7 A;  3QSI A;  2V8G A;  5IC4 B;  1V3R A;  2BEF A;  4AE5 A;  1SC1 B;  4UOG A;  2CKW A;  1GXT A;  1U9P A;  2JEJ A;  3MD1 A;  3C19 A;  1ZPV A;  1EX8 A;  2NPF A;  4MYT A;  1C0T B;  3KNG A;  4BC7 A;  3TUZ C;  4LMZ A;  1UZH A;  3QIP B;  1FNM A;  2FDN A;  3IRX A;  3NCR A;  1VJQ A;  1DY3 A;  2G2O A;  3BO3 A;  4ILM A;  4JV5 J;  4IH7 A;  2PFF B;  1KTV A;  1KLN A;  3DC2 A;  3LQV A;  4QWD A;  1UA0 A;  3GJR B;  1VQ9 S;  2BM0 A;  3FMB A;  3W2V A;  4UF4 A;  5AXL A;  3RRK A;  5DZ7 A;  2FIU A;  5D0R A;  3HPO A;  2FHK A;  1Q79 A;  1P6T A;  4LSL B;  5THW A;  3CCZ A;  1OY8 A;  1Q1K A;  3CMA S;  2E1R A;  2LU1 A;  3CJK A;  2BAB A;  2E1A A;  3CD0 A;  5LT5 A;  3SYZ A;  2ZWO A;  1ARQ A;  2AHO B;  4C97 A;  1RT4 A;  2LEP A;  4IKA A;  4O0I A;  2OEL A;  3LAL A;  1YLX A;  4PRF A;  4NLY A;  3ET6 A;  1HQU A;  2HBY B;  2IM2 A;  3US5 A;  4ERD A;  4RW7 A;  1VQP S;  1RYS A;  4R8U B;  4OLO A;  4DN9 A;  3D6H B;  3KFW X;  2HLT A;  2W4P A;  4C0H A;  6FD1 A;  3KJQ B;  4RNF A;  3Q8P B;  2E9T A;  1NCL A;  4I67 A;  4HEA 9;  4WCE Q;  3IN5 A;  2VA3 A;  3POT B;  1IR0 A;  1WHW A;  1KOH A;  3GMG A;  4ZS6 A;  4X64 F;  3FGV A;  1NZ8 A;  1U2R A;  2OPS A;  4PAB A;  3PO5 A;  3J7Z 5;  2FVR A;  4ZCI A;  4K4S A;  1RAI B;  1JLQ A;  1UJ4 A;  1T9Y A;  1YBU A;  2QSW A;  3JTN A;  2UU9 J;  3HJF A;  3O3L A;  2GMJ A;  3T9Z A;  1EA4 A;  4EO8 A;  4USM A;  3TAN A;  2BM1 A;  1CQN A;  2M3D A;  3RUB L;  1Q82 T;  4K4V A;  3MCO A;  3GZ7 A;  1HBN B;  2HHW A;  2OD6 A;  4RNN A;  4NLQ A;  3UPF A;  1Q7Y T;  1K1S A;  2ADB A;  1N33 F;  2RVJ A;  1VQ6 S;  4RJV A;  2R8K A;  4ECZ A;  2DCL A;  4DMZ A;  4M8L A;  4B3T F;  1XNQ F;  1JQG A;  4HAC A;  4ZPC A;  4N76 A;  4Q7A A;  2Q6C A;  3K5O A;  1N4L A;  3I87 A;  4JI3 J;  4OYW A;  3DXB A;  3BH6 B;  2Y0B B;  3M32 B;  3THT A;  3TJ8 A;  4EBD A;  2CQ3 A;  2IYG A;  3MMC A;  3OXF A;  4K2X A;  1SKR A;  1JXL A;  2C3M A;  1X5P A;  3HHL B;  5ADZ A;  2NXE A;  2KKE A;  2GA7 A;  2YNH A;  3IC1 A;  1FDA A;  3OSP A;  4HKQ A;  4WIQ A;  3KWM A;  1RWW B;  3GR1 A;  2HFV A;  2FY1 A;  1LNQ A;  4RW8 B;  2AWZ A;  3J80 U;  1SXL A;  1RWU A;  1S1X A;  1S9G A;  2QV6 A;  4XAK A;  1V6H A;  3QLH B;  4ZA1 A;  5HLF A;  2UXC F;  2GPE A;  3DM2 B;  1FI4 A;  3SMZ A;  3T3F A;  4CYU A;  4DUY J;  2DB1 A;  1TKZ B;  2H5E A;  1KOO A;  3R8Y A;  4BCA A;  9RUB A;  2FLO A;  2H54 B;  1DHM A;  4H4O B;  4IQM A;  4CZC A;  1WUU A;  2GAG C;  3EWG A;  1JLG B;  1D8Z A;  3MED B;  4OZL A;  3OVA A;  4LFB F;  1PC5 A;  5KFC A;  1T3N A;  2JEG A;  2EKY A;  1UW4 A;  5E2Q A;  2QA4 G;  3V6D A;  3QFH A;  1GX5 A;  1C1B B;  2WON B;  3MPU B;  5D77 A;  5DDO C;  1X9S A;  1S77 D;  3FRY A;  3ZZR A;  4ZIW A;  1MSW D;  3OJU A;  2IC3 B;  4FXW A;  2F9J A;  2GO9 A;  2MY8 A;  3B4D A;  3CJS A;  1ZOT A;  4DN0 A;  1QUV A;  3OTO F;  4FBT A;  3J7Y U;  3MMJ A;  5B0G A;  2EBG A;  2R3V A;  3DLG A;  2KHC A;  3M8W A;  3N79 A;  2W8K A;  5K8O A;  1UA1 A;  2HNY B;  2W2O P;  1RA7 A;  1MWZ A;  2LYV A;  3OFG A;  3P45 B;  2RDJ A;  1N5Y A;  2A1B A;  3OT9 A;  2K2P A;  3AD8 C;  2V2V A;  3S7R A;  4BBY A;  3QOQ A;  2W24 A;  2Y1J A;  2E9R X;  2KZZ A;  2ZH3 A;  2WRM A;  4JI0 F;  1A9N B;  2EW9 A;  5SUH A;  4RW7 B;  4JI0 J;  4OZ2 A;  2WB1 D;  3G82 A;  4LVO P;  4ECV A;  1VQS A;  5F8N A;  1S1W A;  1S59 A;  3LPE A;  1DTQ B;  3FVY A;  3Q8R B;  3C15 B;  3H5X A;  3P5T L;  1S1U B;  3R9L A;  2DR6 A;  5KFQ A;  4OYB A;  5ETQ A;  4QWE A;  4UY8 T;  4OZ5 A;  5KFR A;  4IFV B;  4OYZ A;  3G96 A;  3RRG A;  5F3Z A;  2BBE A;  4ECR A;  1FHT A;  1FEH A;  4NXN J;  2BSQ E;  1NDK A;  4ANC A;  2QFI A;  4WF9 Q;  2ZC3 A;  2IMO A;  2HGL A;  2OIH A;  2CG8 A;  2FPH X;  5CAA A;  3GG0 A;  4QCL A;  2BV3 A;  1WTF A;  5ETO A;  1RAJ A;  4OHW A;  2ASL A;  3VAF A;  2Y1I A;  2YH0 A;  2ZE2 B;  4C3L A;  2R7S A;  4ECQ A;  3M6U A;  1UEV A;  1ZPW X;  2ZH2 A;  1SBR A;  3V81 B;  4K0K J;  4C8N A;  3AQO A;  4N77 A;  4HL9 A;  4F25 A;  3GV5 B;  3QNW B;  1S4F A;  1EKR A;  4OJ1 A;  3TP2 A;  3V5R A;  8RUC A;  5L9X A;  1QDU B;  4ED2 A;  1Z2Z A;  3TX0 A;  2VOD A;  3D1O A;  1QSL A;  1HBU B;  2XZT B;  3NS6 A;  4ES3 A;  2AW0 A;  2LA6 A;  2V9K A;  3DRP B;  2ROE A;  2FZG B;  4FYD A;  1GH8 A;  1RTZ A;  2CQ4 A;  3G6E S;  2PA8 D;  2HHQ A;  5GME A;  3OL8 A;  5A0Y B;  2JFD A;  1SUQ A;  1RAD B;  3TI0 A;  1TKD A;  2VBY A;  3GIK A;  4CLF A;  1X60 A;  2ZC4 A;  4FYW B;  4ZIT A;  2DR9 A;  2PT0 A;  5L39 A;  4AQY J;  1N54 B;  1HQE A;  2G9O A;  1RWX B;  1BLU A;  3V6J A;  3MTK A;  1Y0H A;  1H73 A;  1JLB B;  2VFU A;  4RKU C;  4FN5 A;  2N82 B;  3H2L A;  4PZV A;  4FNH A;  2HQG A;  3BPD A;  1YX2 A;  2PEB A;  3BS9 A;  3OL7 A;  5E33 A;  1NK4 A;  2HMI B;  1IQT A;  4KIA A;  1DZ5 A;  1LWC A;  2YKM B;  4JI6 F;  4DSE A;  2HHH F;  1JB0 C;  1X0F A;  1FO1 A;  3IM9 A;  3R27 A;  3TO8 A;  2YX1 A;  1UW9 A;  1U48 A;  3IS9 B;  2QGF B;  2IIH A;  3GIL A;  1GNK A;  4TY8 B;  1RZM A;  3BH7 B;  1F60 B;  4KHP F;  4G6V B;  4Y2M A;  4USJ C;  3RYL A;  4CRJ A;  1KQF B;  1O51 A;  5FLX Y;  3KHL A;  1UEK A;  4EU0 A;  1AUS L;  2MKS A;  5GVQ A;  4XO0 A;  3HP6 A;  2ZFH A;  4ZVH A;  5KG5 A;  1CUL A;  2OML A;  5IOL A;  2VKR A;  3F56 A;  4ZPV R;  4I0W A;  4OX9 F;  1U1R A;  1HKA A;  3MMB A;  4RW9 A;  4C0O C;  4DCP B;  1J5O B;  4U7U D;  4CYU B;  4P2S A;  2Q66 A;  2MZT A;  2XS5 A;  3H2V E;  3PRD A;  3MM6 B;  1HPZ B;  4N41 A;  3FBC A;  4HI1 A;  4ZLJ A;  2XGP A;  3EX7 B;  1KD1 T;  3MUM P;  1B64 A;  3TAQ A;  2WW4 A;  3CJ8 A;  2XNR A;  2X1F A;  2HHT A;  3I0R B;  5F41 A;  4LF5 J;  1Q8B A;  2YX4 A;  2XI2 A;  3GV8 B;  3MHY A;  2XO6 A;  1H7W A;  5FDL A;  4K5R A;  1WG4 A;  4QPX A;  2GVD B;  3U1L A;  4RUH A;  3VAK A;  2B51 A;  3BSC A;  3EPG A;  3D7S B;  1BAZ A;  3DYA A;  4QR1 A;  1VRT B;  4AXI A;  2E5H A;  4DX6 A;  5KT4 A;  1JIH A;  2VQF J;  4A48 A;  1PJ7 A;  4TQS A;  1KHW A;  1EAR A;  2CZV C;  1N0U A;  3FCW A;  1S5Z A;  1VRU A;  1BE4 A;  1R8H A;  2V4J B;  3M32 A;  3MM5 B;  1T94 A;  1VQY A;  3A8K A;  4OJG A;  4DFM A;  3T1Y J;  4LRA A;  2DNG A;  4B3S J;  1QE1 A;  4YDD B;  2NYI A;  2O66 A;  3PV8 A;  4QJV A;  1HWL A;  2J0S D;  4RNH A;  4TYB A;  4C8L A;  2K06 A;  2Y1L B;  3SSQ A;  4AD6 A;  3NGT A;  4CQ1 A;  5KAK A;  5M2U A;  3EUN A;  3RTV A;  1Q95 G;  4NLW A;  4F2S A;  2DO4 A;  2Z30 B;  5F9N A;  4XPC A;  5HJX A;  1JLE A;  2XG8 A;  1BD6 A;  2FTR A;  2GJI A;  2HVD A;  4LFA J;  3RAQ A;  3L4B C;  1IBM F;  2RQ4 A;  5AJ3 F;  2E1P A;  3M9M B;  3KYL A;  3T1H F;  3CXC R;  3C16 A;  3T1H J;  1FK9 B;  2LQB A;  4NL5 A;  4DV4 J;  3OD2 A;  2XY5 A;  1HBN A;  1NU4 A;  3DCA A;  4A8M P;  4DV4 F;  2A18 A;  4CTA B;  2NR0 A;  4M5K A;  5IT9 U;  1PBA A;  1DQ9 A;  1KQG B;  2AYM A;  2O67 A;  4FP9 A;  4CTA A;  1D3W A;  2H51 B;  3M8P A;  2HHH J;  4JI6 J;  2GHP A;  2R42 A;  4U7C A;  2UVV A;  3E2E A;  1JLQ B;  1U7L A;  2CNO B;  2V8P A;  1TL1 A;  2HWH A;  4CLS A;  2MXY A;  4YME A;  4M5G A;  1R8A A;  2D69 A;  3CD5 A;  2GIQ A;  2ZBQ A;  1FT8 A;  4LJM A;  1FX2 A;  4KGM A;  2NXJ A;  3MAQ A;  3GYN A;  3H87 C;  4QIG A;  3GIJ A;  2FZC B;  4A8Q A;  2KFZ A;  1FDN A;  1HD0 A;  4MIB A;  4LF6 J;  4LSL A;  2HQI A;  5I4M A;  3SXL A;  2ZZM A;  1QE1 B;  3CDW A;  1URN A;  2NSC A;  4GKJ F; 
#chains in the Genus database with same CATH homology
 3GXQ A;  2BNW A;  3BKT A;  4ME7 E;  2CAD A;  2BSQ E;  3VEA A;  1EA4 A;  3VEB A;  1MNT A;  2BNZ A;  3FMT A;  2H1O E;  2JXI A;  2AY0 A;  2RBF A;  2NZC A;  3PHT A;  2JXH A;  1IRQ A;  2CAX A;  1MYL A;  1ARQ A;  2CA9 A;  1B28 A;  2GPE A;  1BDV A;  1Q5Y A;  3BKU A;  3VW4 A;  3BKF A;  2K5J A;  3QSI A;  2WVB A;  1ARR A;  3QOQ A;  2BJ9 A;  1P94 A;  1NLA A;  2FGC A;  2JXG A;  1X93 A;  3FT7 A;  2WVE A;  3LGH A;  2BA3 A;  2HZA A;  2WVD A;  2CAJ A;  2K9I A;  4FXE A;  4HV0 A;  3H87 C;  2WVF A;  1U9P A;  1QTG A;  2HZV A;  2WVC A;  1BDT A;  2BJ7 A;  2BJ3 A;  2K29 A;  2K1O A;  2K6L A;  2BJ1 A;  1MYK A;  1PAR A;  1Q5V A;  4D8J A;  2Y3Y A;  2F1F A;  2PC6 A;  3OD2 A;  1B01 A;  1BAZ A;  2CPG A;  2BJ8 A;  2KEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...