2HZAA

Nickel-bound full-length escherichia coli nikr
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
b'MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nickel-responsive regulator
publication title NikR-operator complex structure and the mechanism of repressor activation by metal ions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2hzaA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2hzaA02
2BJ8A 3QSIA 1U9PA 1BDVA 2CA9A 1Q5VA 2JXGA 2K5JA 2FGCA 3GXQA 1X93A 2BSQE 2HZVA 1MYLA 1BDTA 2BJ9A 1MYKA 2Y3YA 1B01A 2H1OE 2NZCA 3LGHA 2HZAA 3PHTA 2KELA 1Q5YA 2WVEA 1QTGA 2WVCA 2BJ7A 4FXEA 2WVBA 3OD2A 2K1OA 3H87C 1EA4A 2CADA 2BNWA 1P94A 1PARA 4ME7E 2GPEA 2JXIA 2BJ3A 2WVFA 2PC6A 2JXHA 2AY0A 3VW4A 3QOQA 3BKUA 1NLAA 2CAXA 2BA3A 2RBFA 2CAJA 2K29A 2F1FA 3FT7A 3FMTA 3VEAA 1B28A 3BKFA 1BAZA 2K9IA 1ARRA 1ARQA 2WVDA 2K6LA 4HV0A 2BJ1A 2BNZA 4D8JA 3BKTA 1MNTA 2CPGA 3VEBA 1IRQA
chains in the Genus database with same CATH superfamily
3CCTA 1BGXT 2XS2A 2POKA 1IBLF 5KAKA 4QQBA 1JLFB 2MQ8A 1KRPA 3OHAA 3VQSA 4OZNA 3S8SA 2Z2ZA 1H98A 4OYPA 2HHHJ 1PILA 4I7FA 1U48A 1UWAA 1UVIA 4DPWA 2COLA 4F0HA 4LF5J 2WRMA 1KHWA 3PX4A 4DHVA 1H0HB 2ABYA 5EDWA 2HMIB 4V1Ak 4OV6A 2IRYA 4WWSA 2XMKA 1WEXA 3DU5A 4K4WA 3QNWB 2W4CA 2M3DA 3HHLD 3VGSA 1RAFB 1F9HA 2C22A 4DUZJ 4R0EA 4J37A 2H3EB 2IA6A 2Z30B 2DNGA 1FRXA 3GCWP 1KVKA 3GIMA 1OQ3A 2KFZA 1WI8A 1WACA 3S7RA 3QGHA 4RW8B 5GAEI 1VISA 3LF0A 2GIRA 2EG2A 1NJIT 2BMBA 2XWXA 1F0XA 1OO0B 3QPIA 3TQ1A 2R7UA 4I6YA 4OI2A 2PT0A 3FJ2A 4ZN1A 2DK2A 4IQMA 3EZUA 3L95X 4OHXA 2YWGA 4ANCA 1VBYA 3DYAA 2XMUA 2M5YA 1YBUA 3M2RA 2F8EX 3J7YU 1OIAA 3AD9C 1R27B 3GB0A 4OYXA 2EFGA 4NLPA 2QYGA 5AXKA 4FYXB 1HWUA 3TWZA 4DG1B 1ZYQA 4DV2F 5KG7A 3Q24A 3AH6A 4FNIA 2RQMA 1BQNA 3LP1A 2H5IB 4DR3J 4DZDA 3RU0A 1FEEA 2E5LJ 2VJVA 5E3QA 1UPMB 5HROB 2DR9A 1HNIA 4JV5F 2DNZA 2HLTA 4PEOA 3QAEA 2R8HA 3PRVA 4DSKA 5CA5A 1ZTTA 3W3SA 1U6FA 4HLBA 5E33A 2VA3A 4Q43A 4B9VA 4TY8B 3N9UC 2MKKA 1O8BA 2NXEA 4YDXA 1RT4A 1NJWA 1RA7A 4RW6A 2GJIA 2J0QD 1FERA 1WG4A 4ELTA 2DHGA 3MOJB 2QLXA 4NLYA 3KG1A 4OLPA 1DZ5A 2VFVA 3V81B 1OG7A 5M2PA 3W5ZA 5IWAF 3D5MA 4JI0F 2XWYA 1DQ9A 2IVMA 4UUXA 3GV5B 2BM1A 3G6XA 4KE5A 1JWWA 3BBCA 4F36A 2KHCA 1FFWB 3K17A 2FC9A 2RDDA 2EKYA 4X62J 4DI6A 4C8KA 4P7TA 2D9OA 3MZIA 2C3PA 3MM7B 4ELUA 1VJWA 3UR3C 1VQKS 2DGUA 3VALA 4F4ZA 1DQAA 4C0HA 4IQXA 4ZK7M 3NWGA 1IR2A 1U26A 4J9KA 1S1VA 1BAZA 5KFWA 4DR7F 3FBCA 4R5PB 5KOXA 1RBAA 2WVDA 5RUBA 3J80U 2BNZA 2ZM6J 1Z1ZA 3W64A 2P5VA 4ID8A 4KV8B 1AZSB 4J9NA 2HBQB 4RZRA 5FJ4A 2A3JA 4AT1B 3I0SA 3NGSA 5EX3A 2KXNB 2LECA 2CNKB 3LP2B 4U6PA 5AXLA 4M94A 1EKRA 2PDAA 4C6AA 2RMLA 3BGRA 4OX9J 3EGNA 2VJUA 3CCSS 3M8SA 4TU9A 5C5JA 1IKYA 3KUGA 4A8YA 5A6PA 3PYEA 1VQPS 3X3UA 1DY3A 2B56A 4QU7A 1DARA 4DPTA 1KHVA 4MK7A 4UQGA 1KC8T 3OUYA 2D69A 3VV2B 3KMQA 3OPKA 5IM0B 3CCLS 1S7HA 1R0AA 4ED5A 4KYZA 3HSGA 1TMMA 2XULA 2R7QA 4UUWA 1N5VA 2V68A 4NPOA 4C4WA 1UETA 3I0RB 3HDSA 2BKPA 1HNWJ 1PYSB 4WFZA 3DOKB 1MN9A 1CULA 3F73A 1HBOA 1GNKA 3C15B 3CJ3A 3DN9A 3HK2A 3PR5B 4TLQA 1C0TB 1V3SA 1U09A 1HHSA 1HWLA 3NGUA 4KPCA 1TKXA 1YJ7A 2DGWA 1JK9B 5HMZA 4K2XA 2HZAA 3QRPA 3DRRA 2ZOFA 4UQTA 4J90A 1PGZA 3HD1A 1CLFA 4IG0A 1NSAA 1YJWS 3KLVA 2MKIA 1ZOTA 5GMEA 1WG1A 2BNWA 4A8FA 4DQPA 4AXJA 3FSIA 5IV4A 1IXKA 5LT5A 3QAUA 1BY9A 2CQ0A 4DUYJ 2BQUA 4MYUA 1A6LA 4DZ6A 4NA1A 3K8VA 3DNCA 1VIXA 4QR2A 2M9KA 5HJYA 2UXCF 4KR0B 1XEZA 4EZ9A 3EZ5A 1C4CA 1HQUA 2YWKA 5KG0A 1FK9B 3TEGA 4QWDA 4X66J 1RISA 3EDQB 3OXGA 1Q86T 2NUUG 2QMUB 2CPJA 1XNQF 4ED7A 1MWYA 1FXDA 4G3IA 2E5IA 1URNA 1QTGA 2HSEB 5AXNA 1LWFA 3H5YA 3DI6B 1N88A 1K1QA 4X65F 2DH7A 1TUGB 3QIDA 2VFRA 4M5NA 1RT5A 1A9NB 2HURA 1WF2A 2QSWA 4ZCIA 4NLQA 1CJUB 4GVLA 1Y7PA 1FKAF 5KG2A 1VQ7S 1VQOS 2ZBIA 1FF2A 4B3TF 1K1SA 3D0GE 3E01A 4YHHJ 2OD4A 1FE0A 1TKDA 3D7SB 2DHSA 2FLOA 3RUBL 2KYXA 3FCHA 5IT9U 5K8MA 3G86A 4CLSA 3MR2A 1RP5A 2ZC3A 3P49B 2RHSB 5GAHI 1W2IA 1SV5B 1VBZA 2QGFB 1ICEB 2VDHA 2HGNA 1BHNA 1YK9A 4QWCA 3DLGA 5G0RB 1S7IA 4NLOA 3PZPA 4USMA 1U2RA 2E5JA 4PRFA 4C0BA 3BR9A 5IT9Y 5DDOC 2I6WA 4XK8C 3DDIA 2WVCA 5L9XA 1T95A 4WIIA 2JBVA 3RZAA 4P2FA 5H9FJ 2J6TA 1Y9OA 4CNZA 2UU9F 4N8NA 1RKIA 5IC4B 2K8GA 3MR6A 3W61A 1NO8A 4LRVA 3QOQA 2XLJA 3MMAA 2QA1A 3B54A 3OLAA 1H74A 2GMLA 1B28A 1I51B 4F3OA 4I1TA 3N4WA 4BLGA 4OYBA 2XS7A 3DLHA 2K3IA 2QL9B 1Q78A 1ZTWA 1MNTA 1V9OA 4WFBQ 1T02A 5B7WA 2ZKTA 3AB2B 2RSQA 2W2QP 3LALA 3ICLA 1HI8A 2K7JA 2MQMA 1I3OB 3KXDA 3VF0B 1RAGB 1Q0NA 3W9HA 5EX0A 3W60A 4NRUA 3NCPA 3SBMA 3OR2B 1PSDA 2L9NA 4L72B 1FFSB 4X64F 3FKBA 1EP4A 1Q7LB 3RRKA 1RHJB 3ZXWA 1S6PB 3E2EA 3IS9A 4QZVB 4ZKAA 4OI0A 3V6JA 1FJCA 2QL5B 2A10A 3BF4A 4JI5J 3WBZA 2CADA 3ZZRA 4MK8A 3O6QA 2IRXA 2LMIA 2GPEA 4NX9A 1T9VA 2D3O1 1HMVB 2VPYB 4I6AA 4JV1A 2CUYA 3EICA 5D0GA 1NLAA 4HVZA 1DFDA 4K4TA 2HFNA 2DGSA 4M5DA 1IKVA 1X0PA 3TW0A 4P2MA 5KT6A 3AOCA 1G6BA 1ZA1B 3BDEA 5HANA 4JI8J 5CYQB 4ECVA 2RQKA 2R7VA 2B43A 2HHPA 3FZ2A 4PG8A 2XMWA 3SZ2A 1KBRA 1AA1B 4FPRA 2N82B 1MYLA 3KUEA 5K5MA 1SXLA 5A8KB 1TUVA 3LGHA 2VICA 1PKUA 1REVA 1S48A 1NZAA 2AF6A 1IR0A 4F0MA 4I64A 2BBEA 3SFUA 1BWEA 3CD7A 2YPZA 2ASLA 4EBEA 2WB1D 2QIFA 3W63A 1MLAA 4ILRA 5E3AA 4M5JA 3QBCA 3JAMU 2K06A 2LU1A 1U1MA 2E9RX 2RRBA 2K1RA 5CZXA 5FDLB 1CS4A 2Y1LB 4OZ1A 1TV6B 1NKEA 2I38A 4KGZB 1UWBA 2CG8A 4EFAC 3LGMA 3T1HJ 3KTQA 4Q0BB 5HP1B 4LF4J 4IO9Q 4OFZA 5F3TA 3IR7A 2MKHA 2ATLA 3ITHA 2V8HA 4UW2A 4CZCA 4DL7A 5L8RC 4J9MA 2KM8B 4FS1A 4WXWA 2J9DE 2UUWA 1DTTA 3KK1A 2OI2A 2I8EA 1U1QA 5E2QA 2G9OA 2B7CB 4NXMF 4XDDA 2QA4G 1YLXA 4KC5A 4DLEA 3QJPA 3R7SB 4PG6A 2HVIA 2WVEA 3C8YA 2WONA 4ZPDA 1TK8A 1RWUA 1WD6A 1RACB 1D8ZA 3W66A 3A8JA 3HP6A 3BBBA 2ZBPA 2J6SA 1Q7YT 1RTHB 2JSXA 3M8YA 3UDCA 3V6DA 1ZA2B 4TU7A 4QWAA 4NE9C 3ZZTA 1CJKA 5ETVA 2O5DA 3VVUA 2HK2A 1AYEA 2BKOA 4WU2A 4BS2A 1ZS6A 2GMJA 1IKXA 5JVHQ 2GHPA 3D9BA 2HHXA 1FRIA 4P73A 4NLSA 1N5QA 2MY7A 5ETKA 4FYYB 5DS7A 4ECSA 3BSAA 1OYEA 1U1LA 1HFEL 1RAHB 3NP5A 5I3UB 2Z8QA 2W2NP 3GYNA 4B02A 3WQPA 3NLCA 3QGGA 3BSCA 4JI2J 2K2PA 3HZEA 3MMBA 1BUXA 4YB7A 3A8KA 2CFXA 3IWNC 2Q6CA 1URRA 4N5SA 1QY7A 1S1TA 3MGJA 2WW4A 3QT7A 3DC2A 3CMAS 1Y00A 2GVDB 3DLBA 4QYRA 2IMWP 4RWXA 3PJWA 5T7LA 2CWKA 1DTTB 4ZVEA 5D4NA 4P9SA 5JJBA 3IA0A 4X4OA 4L76A 4LFAF 3CB4A 2N7CA 5I3PA 4DQQA 2BKNA 3JB9k 2W1BA 2OEKA 4EI2A 2GW8A 2Z2MA 3HVRA 4X4RA 4EUVA 3MEGA 1S9GA 3VEAA 1VC0A 3OJUA 3RW6A 1H38A 5A8WB 1FWKA 3I82A 3R5DA 2XNQA 4NLGA 3MD1A 5F8GA 1IRQA 5KFAA 2HPUA 3KNAA 3VGTA 4TYBA 1VMBA 4AQYJ 3M2UB 2UXBJ 4JV0A 1S6QB 1KQKA 3V4IA 1RTIB 2XY6A 4CO2A 2FY1A 2VU5A 4YOEA 4OX6A 5DJBA 4OI1A 2IBKA 4ZA1A 1MN7A 3SIPB 4UTGA 4QCLA 3LUYA 4FYWB 3KLGA 4RNFA 4K0KJ 3U7JA 1IKWB 1NHKL 4LT6A 3U1NA 2KDOA 2I0XA 3TAPA 3RBEA 3DFEA 1NXIA 2FC8A 2HAFA 2A18A 1RT7B 3S6EA 2HFOA 4C48A 3TVZA 3H4DA 3MM5A 2RRNA 1GMWD 1CJVA 3K59A 2DH9A 1IVZA 1LW0A 4KJIA 3TAMB 3UFCX 5CYJA 2KG0A 1ARQA 2I5JB 2CNNB 2F65A 1RCXB 3OHBA 1S1WA 4CO1A 2R7XA 1NPKA 2P6SA 2GVZA 7AT1B 2HRYA 1TL1B 1I94J 2CKWA 2CIMA 4I69A 3KK2B 1CC8A 3V6HA 3IBWA 2GAHC 3J7A1 1WF1A 1Z4UA 3LW5C 4RUAA 3BS9A 4ZVHA 4PPDA 4DS5A 4EGLA 3TANA 1N4LA 1FT8A 3T6JA 1FWLA 2AGPA 2CQIA 3C6UB 1DJ0A 4L75A 2JEGA 2HWTA 2B5JB 2XGQA 2X1GA 2QMXA 3FRZA 1QLNA 3UD4P 2BJ7A 2UUAJ 5K9FA 1D8YA 3PX6A 3DGPA 1HNVA 1VCTA 2HVZA 4ZVTB 2BE9B 5L1KA 4FXVA 2FJXA 2ZH6A 3AOBA 5KT4A 1UKUA 4E98A 3G8QA 1S97A 1J5OB 4K7QA 1S49A 2VQEF 3NBPB 4IOBA 2KVIA 3BO3A 1D9AA 3PNIA 3RGIA 3RAXA 2ZBQA 4PCQA 5GVQA 1X5PA 3B78A 2W7PA 4ZLNA 2BXJA 3BN7A 1Y0HA 1RLDA 3FEYB 2R2RA 3EXYA 2VDIA 1JIHA 2HW3A 1NHUA 1C2PA 1K73T 1FJEB 3EWGA 4OI3A 3HJVA 3WC0A 2F4VF 5LXRA 3HHKA 2CQHA 4RW4B 1UVLA 2WTFA 1UJ6A 2EC2A 4OLOA 1OQ6A 1RT2B 1WORA 4KO0A 2VFSA 4RW7B 2HGMA 3A1YG 2C3MA 3FFIB 2ZC4A 3HX9A 4ECTA 3GCXP 5LL6d 2CQ3A 2B6AB 1Q5YA 1FDNA 2GGPA 1HI0P 1Y3JA 3BQ2A 1HBUA 2DB1A 3BH7B 1VBKA 1VK3A 4NXNJ 3EGVA 3L7UA 5DZ6A 2JFKA 1QTMA 5B08A 4H4OB 3NCQA 5C42A 2HWIA 1K8AT 1S99A 4PWDB 4C97A 1WTBA 1NM2A 5KTQA 4ZHRA 1WC0A 3MPVA 3BQ1A 1CBKA 1LWEA 3T41A 2ZHAA 4GVBB 1RB0A 4NEZA 2N4DA 1XMBA 3G6YA 4FBUA 2UP1A 2QFJA 3CJTA 4OYWA 3W65A 3AT1B 4GRSA 2Q79A 3UI3A 1VR6A 1FWPA 2HNDB 4OIXA 5DM6Q 1Q16B 4RU2A 2JEFA 1EIYB 3MHYA 4S0MA 2C2NA 2HNYA 3ZZZA 2J9CA 3R97A 4ZJQA 2XLKA 2BX6A 1R3NA 1Q8LA 3L7OA 3TVKA 1MMDA 3MAAB 5CCLA 1NMEB 1X8DA 4CLKA 1VQSA 3RW7A 3HF5A 4DV4J 1EZZB 3R5AA 3DU6A 3G96A 1JLGA 2HHSA 3M8QA 3NAHA 2XG8A 1R43A 2V8DA 4ED8A 2P9EA 1NSPA 1QE1A 3M7VA 1HNXF 5D8HB 1FRKA 5J2PB 3R2CJ 2BRKA 3FEZA 3I9V9 1S1XA 2FVPA 3GQCA 1MMLA 2ADLA 2DO4A 3R9LA 1DTQA 4WK3A 3Q0AA 1QVGR 2JLGA 5DRKA 2UVWA 3PW2A 2Z0GA 2VKRA 2IYGA 3NMRA 3UQSA 1VRTB 1FXLA 3HSDA 3GWCA 4ZVPB 2G2YA 1APSA 4F2RA 2LLZA 4PWWA 2ACMA 3POTB 4A8XA 5J1EB 4NYOA 4LVNP 4CM0A 1C0UA 4XIUA 3T9ZA 3ZZUA 4LF9J 3GR0A 1G1XA 3KG0A 1X4AA 1N6QB 4OMFG 2LQ9A 4U7CA 3PCOB 4Q7AA 1XK8A 3JYTA 2XZWA 2HRTA 5KFXA 1N5YB 1HL6A 2QYCA 1VQ5S 1ZH5A 1T3OA 4ES2A 1FKOA 5ETOA 1XJWB 1EA4A 3F41A 1YWXA 1P94A 1TVRB 4WBFA 5HMXA 3NCRA 6AT1B 2XHCA 1VQLS 4KHRA 4WZQA 4ED1A 4ZVOB 1KKHA 2Q1LA 2AJ2A 3VCDA 4LIWA 1OY8A 3FRYA 3S1TA 1M5PC 4B3SJ 2Q2KA 3CC7S 3IRXB 3FMTA 2VH7A 1GEHA 4WFYA 4P6QA 2UUCJ 4WFNQ 2AJQA 2VZ9A 2KH9A 2DEIA 1HWKA 2CQDA 1EETA 2KTQA 4JI1F 3R5JB 2BANA 1KDNA 3T1YF 3E8OA 4UZCA 2YKQA 2HKEA 1UJ5A 2FZKB 1S1UB 3ILIA 4LR7A 5L39A 2AJ0A 2W9CB 3CJ5A 3MURP 4DSIA 3OFGA 3CULA 1A7GE 1UVKA 4FF1A 4P2SA 4D3GA 3BYRA 2CG4A 3A8EA 4USWA 2BR0A 4IFYA 1OPZA 2W9BA 3CTRA 4ZVSB 1BQMB 1SUQB 3H5SA 3PW7A 2CQPA 5T14A 1KTVA 4DJBA 4B3MJ 1HWJA 4ETZA 3H87C 4MKBA 1VQ6S 1GX5A 2ZZNA 3RAQA 1WHWA 3HHLA 2AP6A 2NLWA 4JI4F 2DO0A 2R8GA 1SC1B 1HD1A 2V94A 5J2QB 4NZ7A 1FRLA 1LWCB 2HIYA 2MSSA 4NASA 1RYRA 3CGIA 2KKEA 4DL6A 3QO9A 3GILA 3MTJA 5D0RA 3VZHA 2K29A 5ETNA 4EO6A 3KK3A 4PAAA 3K2YA 1SQFA 4UOGA 1R8CA 1F60B 2Y0BB 3OLBA 4K4SA 4H4MA 1E6VB 4USHA 2X3GA 1YBAA 3ET6A 4CLWA 1X93A 3CJKA 4PG4A 1YBTA 2CPZA 3MI7X 2XMTA 4MKAA 3D6TB 2XCAA 3GG1A 1N32J 2FPHX 5HJXA 1VQ4S 2VPXB 1UCNA 2MHEA 2EKNA 4PXBA 5ADZA 3QLHB 4RL1A 3UN3A 3GYGA 1G4CA 4L6V3 1N48A 2PFFB 1RWOB 2EVZA 3Q8PB 1U6ZA 1S57A 1HPZA 1N0VC 3HPOA 1SJQA 4UOHA 2FIUA 2F7VA 2UVRA 4NA2A 1HNZJ 4M8LA 2MJUA 2DNLA 1N36F 4WFAQ 4YEAA 2VASA 1RT6B 3DOMA 2YVSA 4C8LA 2KKHA 2J76E 3G82B 1AW0A 4QWBA 3B8HA 3KHHA 2ZWPA 1F3FA 2XMVA 3QSIA 5DZ7A 1KNZA 1YKWA 3PR4A 3OV7A 1DBDA 2LXIA 2HWHA 2Q66A 1E6YB 2CPHA 3W9IA 4DL3A 2JEJA 3T5HA 1H2VZ 5GMKa 3CCES 3ADAC 2GIQA 1PJ5A 2DPIA 2GQCA 3U27A 4DL2A 4K59A 4IG3B 1FE4A 2LXFA 4DV6F 3OJSA 2Z4PA 5SUHA 3MAQA 2W2OP 2UXBF 5KFZA 1UMJA 5FLXY 1ACMB 4LR8A 4LSLB 5KFKA 2VG5A 2JC0A 2ZEJA 3AXMA 4CLUA 4I68A 1X9SA 4KHPJ 3DLKA 4IOCQ 2O1PA 1ARRA 3QRQA 2FHMA 4DBQA 2N3OA 2DGTA 2A6OA 5HK4A 2V34A 1UP1A 4OJ3A 3MCNA 3A3NB 3R27A 2QV6A 2HS0A 4MKVA 1RWWB 3HVTB 2MY8A 4WIQA 4K50A 4W4MA 1FDBA 3TA2A 4C11B 3ENQA 3JQJA 4DDFA 4G1QA 5CCMA 2ZITA 4OYIA 3N01A 3TJAA 4KB7A 4OZ3A 3MCMA 4JYAJ 1RWXB 2MGZA 3CJ4A 1S79A 3FZBA 3LTOA 4J9RA 5BR8F 3MUTP 2F9JA 3DMJB 1JNRB 1WOPA 1OWXA 4Y6IA 3MFHA 1CQNA 5LSRA 3M6UA 3UNYA 2GMHA 5KFLA 1MROB 2XB2D 4MFBA 5KFPA 1GK8A 1SC4B 2W25A 1XMQJ 1M5KC 3NMAA 2R8IA 3RJMB 4LF8F 2XC9A 1P9QC 2YKOA 5KFEA 2R3VA 4DQRA 4O44A 1JLEA 4LRAA 5J2NB 4UZBA 1T8EA 3CC2S 1G2EA 1AUDA 3OVBA 3IWLA 4HTJA 2HVHA 2QRRA 3KHLA 2VBYA 2VF3A 4ZIVA 1ZZFA 1MYKA 3PEHA 3BDPA 2KM8C 1IQZA 1VRUA 2QFIA 2DIVA 4ZCLA 4I56A 2XSFA 2CPEA 4LSNA 2OPQB 4I0WA 1MMNA 4F26A 3M6XA 3P96A 3O44A 1YRTA 3QMQA 1GX6A 1YI2S 3LANA 1VS3A 2R2UA 2W4DA 3BB5A 1VQYA 2WB4A 4RWWA 1HR0J 5HSPA 3M8PA 2AU0A 3E3XA 5LOQA 4ZLLA 9RUBA 3PJXA 2DY1A 1N33F 4F8RA 4B3RJ 4F0KA 4I2QB 4EMDA 1UJ4A 2B9XA 5HLFA 3CCWA 2MZQA 3W8PA 3PV8A 4NXNF 3SCJE 1RWVB 2BA9A 1ELOA 3M8RA 1U9PA 4NLUA 2OPPB 3J81U 5KFGA 2M0GB 4LJMA 3D2WA 1YVFA 3NNEA 4DV0F 2B0GA 1R8PA 4AXIA 4PPZA 1JLCB 3I31A 4C98A 5MAOA 1L3VA 1PYTA 1RTZA 4MT1A 1H7WA 1X60A 2E1PA 3JSBA 3RBXA 4ED6A 2DNYA 4PUOB 1RSCA 1TU0B 4QIVA 3HM9A 2PSZA 2ALYB 2G2OA 1B4SA 2JLFA 3RB4A 5AJ3F 1TKZB 4URSA 2YNFB 3MM9A 3H98A 1NDLA 4ME7E 3R6LB 1XNRJ 1XR5A 5C24B 4Q45A 2LDYA 2ZH7A 1GTHA 3H7HB 4DR6J 2B51A 2AEFA 1QDUB 4O3QA 4KGMA 1G7CB 1F2GA 1EARA 1MU2B 4B3OA 2G0JA 3BBFA 4MJWA 4I6WA 3R5CA 2HG4A 3VEBA 2BOAA 5JXSA 4A8QA 3ZNJ1 1U0HA 3R5BA 3GONA 2V4JA 1OYDA 1Q5VA 2F4FA 3HULA 2QTWA 1RGVA 4XO0A 4OI6A 3UCZP 1JKHB 1YZ7A 3J7YI 4OZJA 4ZVFA 1ZM4A 5LJ5Y 2UV8G 3HFKA 1HQEB 2NYHA 1BLUA 3LGNA 3OTBA 5K8NA 1U8SA 4F02A 2DTJA 2VONA 1T03B 2ZOGA 3A3PB 5ETMA 3OTOF 1LXNA 3KMSA 2CJXB 1KLMA 3TO8A 1K0TA 4K4UA 2MTLA 4Y3CA 4WYWA 2RT3A 2LQBA 3UDEA 2CJBA 4JB8B 2FJAB 2EPIA 4EEYA 4I67A 5DGBA 5DLGA 3P3DA 1AB8A 3JSMA 1ZBTA 3UVJB 1SJRA 4HACB 3PKYA 2YKMB 4LF7F 4MTPA 4URGA 5ETQA 2VV5A 4DX8H 2W8LA 1JLQA 1LFPA 2AV5A 4HHJA 4WTOB 5T41A 5MLCV 4QOTA 3R1HA 4O3PA 4NOHA 3KLIA 3PFEA 1KOHA 4I2PB 5A8RA 1IUJA 1FX2A 4KGVB 1J5EJ 1D09B 3MMCB 2BABA 4A46A 4A8KA 3O5TB 1Q8BA 1NHVA 2GO9A 2V8PA 3SQOP 3NEKA 4YB6A 1SC6A 5G4DA 1FNOA 4ED4A 3M9MB 4OZ5A 4NRTA 4YB5A 4IKAA 4R0JA 4YUDA 3AA9A 2MZTA 2VQFJ 3H90A 4B17A 4G65A 3MM8B 2Y1RI 2BRLA 4IO1A 2YH0A 2AY0A 3TP2A 4G1PA 4A8OA 3ZFVA 1M0SA 1G3OA 2Z2LA 2EC0A 1NCLA 2D3UA 4IH7A 1RT1A 3PYDA 5A76A 2ZJPQ 4QW8A 1PYOB 4DOZA 4DV5F 4CLYA 3RBDA 2BV3A 4ANEA 4KFBA 1S4EA 3KLEA 2XQCA 1FKPA 1N34F 2YWWA 4I4BA 3OSPA 3EPGA 2DGOA 2J7WA 2BYCA 4TY9A 3OR1A 1EB0A 5BYRA 3DRPA 2UUBJ 5C2GA 2WZ1A 3MEEB 1FDAA 3NNHA 1V3RA 2D41A 2WVBA 3HCXA 3M30B 4OV1A 4P72A 4LFCJ 2DJWA 1JNZB 1JJCB 3T9NA 1RXOB 1ZZNA 2WOMB 4M5IA 3K0JA 4DR2F 2W9AA 4LF6J 4MK9A 1NK4A 3BZQA 2FYXA 1CG2A 3LH2S 4RUHA 1FRHA 2MB0B 4QPTA 4ZVQB 1XBWA 2LU2A 2XLIA 4O4RA 1PAEX 4CYUB 2OIHA 3DLEB 1NU4A 3SEOA 4IH5A 3H42A 2JOQA 4ECQA 2IA0A 2V4QA 3K5LA 1NRKA 2G0CA 1RT3B 3OXFA 5AE2A 3P8BB 3GXQA 4CNYA 3CDWA 2XMJA 4NA3A 1TL7B 4IR1A 3HFZB 1NBEB 5CHCB 2YKPA 5D4OA 3CF5Q 4ZPWR 1NDCA 2M88A 3MECB 1R0CB 1W26A 4UF4A 1YJVA 2WSEC 3DRSB 3MR5A 3BSOA 3WHIA 3QIPB 1JLFA 1SH0A 4C8YA 3VAKA 3PYFA 1SIZA 3N5BA 1LKZA 4U7UK 2Y1JA 4DV7J 1LV5A 2OPRB 3UCUP 3QGPA 5HQLA 3DGVA 2A2CA 2DCLA 4USVA 3O8WA 1IBMJ 2CQ2A 4RLEA 2O66A 4CIOA 2C2DA 4PXEA 1CJTB 2VPZB 2JEIA 4PG7A 1MNEA 4K5SA 5LXYA 2ZH3A 2HMIA 2EFPA 3MPUB 2ROPA 3QZ7A 2B9YA 1FDDA 5DDRC 3BQ0A 2SXLA 3SCLE 3D54A 2XS5A 3MPYA 2CQBA 4K5RA 4Q2MA 3NNAA 2JX2A 1U2FA 5LMUJ 2QEXS 2IHR1 5F41A 1Y11A 4Q8EA 2CQGA 3Q89A 1VDHA 2FDNA 2H1OE 3THPA 4BC7A 4LF1A 3FK4A 4RBUA 4RW8A 4O3NA 2F40A 2GZOA 2CPFA 5F0UA 5CYMB 3LWMA 3W2VB 4YMEA 2AN7A 2MKSA 3R1LA 1QSSA 3C46A 3GIKA 3A8IA 1OJ4A 2FZGB 3V2UC 3NS7B 2EEYA 2OH2A 3WX4A 1DLOB 2KOEA 2ZH5A 4OJ1A 3CD6S 3D3BJ 1IM4A 4DEZA 1S6UA 2XYPB 1U8WA 2GQ2A 1ROFA 1WG5A 1SQGA 2FVQA 2RJZA 4JI7F 3GFYA 3AQPA 5U47A 4CTAB 3QZ8A 2KN4A 1Q95G 4NZ0A 1FNMA 2ZH1A 4DG1A 4WKYA 2DGXA 1S6OA 4ZP8A 1VJQA 1YJUA 2O3DA 4OZLA 4WU3A 2L48A 4AAIA 2B9EA 4DV1F 3ENVA 4JI3J 3M9OB 5HROA 4GO7X 1RYSA 4EU0A 2R9LA 4V19X 2LKZA 3SDEB 1NLKL 4AL6A 4FKYA 1IBKJ 1N5TA 1EQMA 2GC8A 4TY8A 5HVHA 4LFBF 2FJVA 3N6NA 3NS5A 3MOZA 4EYHB 3K58A 1VHIA 2J5AA 1WEZA 2V5HG 3IWXA 4ID5B 1LW2B 2Y1IA 4X4QA 1GMWA 4F4YA 4DSFA 1RWMB 2IVFB 2H54B 3V81A 2JXHA 3R8YA 2PA8D 4OL8A 3MR3A 3GZ7A 2J0XA 2E1RA 1NZ8A 2X1AA 2L9DA 2WSCC 3OBIA 3C2PA 3RTVA 1ZAXA 2AYEA 4DL4A 2KJVA 3VHQA 4NMLA 1NK9A 2M4MA 4Y28C 1T11A 2HVDA 5H9EK 3MM7A 2YWFA 3ZZPA 3IBFB 2V63A 6FDRA 2ADCA 3UCGA 2YQ1A 4NLDA 3FBFA 2MKJA 4R5PA 5EUHA 1KVIA 2OSQA 4OHWA 4HEA9 3D0IE 4O4GB 4NCGB 5KFUA 4GKJJ 2RQ4A 1RKJA 4PR6A 4IUFA 4KV8A 3UW1A 1AZSA 2RILA 3I56S 3EXCX 2W2PP 3LP0B 3M1VB 4Y2CA 3D67A 3HVWA 2E5GA 1PJ7A 2CQCA 3LP2A 2AYBA 1IM6A 3EMTA 1C1CB 4GKKF 1H2UX 1LNQA 2UZAA 1XMOF 3C3LA 3FMWA 2EK6A 1M1KT 2DCUB 3UWTA 1HBMB 4B9UA 1F5BA 4DV3J 4YY3J 2Y8WA 2ZD1B 2JNJA 2AJ4A 3OVAA 2VG6B 1FRJA 3HHLC 3CCZA 1JLAB 2KO1A 2BJ8A 4DX5A 3NOGA 5ETTA 2C2ZB 1B0VA 2VB6A 4ZOSA 2RKIB 5IM0A 3KLFB 2O67A 5D78A 4CO4A 3W9JA 2AKWB 4GC7A 4PQAA 4DU7A 3C66A 3US5A 4DR5F 3QWUA 3TUPA 3W5YA 5KFBA 1Q8KA 1T0TV 3I0RA 3A13A 2K1OA 1PIEA 2OPSB 4FF3A 5B0CA 3KHGA 2AEMA 3DOKA 4WKRA 3C15A 3IAS9 1C0TA 3FEXB 2BEFA 3TZYA 1IQTA 1O51A 1NKBA 4NLVA 3MEDB 2DRBA 2YX1A 3ENWA 4DXLA 1PJ6A 2BVZA 5BJRA 2ACYA 2I9SA 1H72C 2HVEA 1KSPA 1FA0A 4A4JA 3I87A 3PDNA 2RB7A 1U47A 2NXNA 4DPOA 1SKUB 1VK8A 3HFVA 2IAJB 2VBXA 2FVSA 1U2CA 5THWA 2GS8A 4ZN3A 2HBZB 4WPAA 2HQDA 1Q82T 1X5SA 3K57A 1FJGF 3GE9A 3HHEA 2BDPA 3BPSP 1S9EB 3D6MB 4FNHA 2PE8A 2ZBRA 2VG7B 3BGUA 1BQXA 1FK9A 3GTYX 3IRWP 2XI3A 3CJQA 1U24A 5D3GB 3LA0A 2P2CB 3HZGA 4WE1B 4F04B 1F3VA 1PBUA 4RO0A 2CZ4A 3I5CA 2UXDF 2R7OA 3GV8B 1RI7A 4ZDNA 5E7OB 3LOUA 4ZJLA 3IG1B 4FBTA 3DI6A 1Z2ZA 5CABA 4EYIB 3KLHB 1U1NA 2E9ZA 1R8AA 2YTCA 2KT3A 1K0VA 1W7WA 2XYGB 5KFVA 1WWHA 3NL0A 4HH0A 2NS1B 1Y5NB 4HHUA 1CJUA 8RUCA 3LAKA 4RR5A 3TARA 1I1GA 1P1TA 4NZ6A 2IDEA 2ZKUA 4WP8A 2KB2A 2RUGA 2XSJB 2R7RA 1L3TA 7FD1A 4DV2J 5I4MA 1S12A 1YX2A 3GFXA 3GMGA 5HO4A 1HQ2A 2XZTB 2MXYA 4OZ2A 3C6TB 2ERRA 3X1LB 3R7BB 4JI6F 4KGKA 1SV5A 3JXOA 2OMLA 3ZZOA 4JV5J 5KT2A 5G0RA 2QT7A 1D9FA 2OSRA 2KXFA 2AGOA 2C2OB 4LF2A 2AZ1A 1U1RA 4QIEA 1WKKA 4C8OA 2BUNA 3WX8A 2E7VA 2KFYA 2MKCA 3J7Z5 3KJFB 3WIUA 3ZTOA 3MPWA 4C3MA 1HBNB 2GFFA 3GSIA 2AWZA 1UTAA 4CO0A 5IWAJ 4JI0J 1AUSL 5DG8A 4LFCF 2GNKA 1D3WA 4N56A 2KXHA 2HBYB 3SCIE 2A2BA 4UT4A 2BJDA 2HNZB 4DR4F 4RW9B 3DRYA 2RF2B 1WKJA 2HHVA 1NAQA 2LDIA 1VOMA 1RLCL 3RBZA 2CRLA 4P10A 2XEXA 4PQUA 3HT3A 3I4HX 4Z2XA 1IN0A 4OQJA 2OEJA 4HDHA 2JLEA 2M7SA 1UFWA 2KRRA 5M2UA 4WTYA 4DR7J 4QR0A 2JHEA 2QA2A 5F8NA 4NCAA 3N6MA 3OR2A 3G5OA 4CWBA 1WI6A 2XNRA 5EWFA 2G0IA 2DPJA 1T05B 3IC1A 4J9UE 5B0AA 4NCBA 1S6PA 4P75A 1RTDB 2CDQA 3SSSA 3HKZD 5LMNF 1RADB 4DWIA 4MIWA 4USTA 1NB7A 4MIBA 4CM2A 2V2ZA 4EK2A 1I6JA 2H4YB 3G2XA 2ZE2B 3ENAA 1HMVA 1YIJS 1U1KA 3CIZA 5A0YB 3DRXA 2X1BA 1CSJA 1T3NA 2GJ2A 4OJHA 5IZHA 3PACA 4ZP7A 5KG3A 4QYZK 2D9PA 5KFHA 4IOAQ 4RNOA 3M9NB 5CYQA 4BHQA 4LRBA 2YNHB 4DSLA 2CPYA 2HRUA 4LBPA 3BJYA 3GIRA 1MSWD 1KP6A 3H2LA 4PQUB 3I96A 1DRZA 1D1UA 5IQ6A 3BEGB 4L74A 4NLXA 5A8KA 4CT8A 2J9EA 1PBAA 3EE3A 2J0SD 3M2VB 1D9DA 3K5MA 3QJLA 2H51B 1LFWA 1WC3A 3QT6A 2NYIA 4DX7A 3C14B 3CEDA 3H4BA 3MMJA 4IFVB 1MWQA 1SKWA 3PW0A 3VGVA 4ECXA 1L3KA 2AJFE 1RTJB 2JXGA 5EGYA 1BC6A 1RA6A 4C8NA 4ZP6A 2DEJA 2ASYA 4ILLA 4LBIA 2ASJA 5FDLA 1PCAA 2HZVA 2DR7A 1DAXA 2EFQA 1B01A 1TV6A 3PIOQ 3G9CA 2DNQA 1FVSA 3PEJA 2RS8A 3ZZYA 4MYTA 4ES3A 4Q0BA 5HP1A 2RU3A 2RIJA 2HHHF 2ZVIA 2UXCJ 2X7IA 3HMJG 2GAGC 5B0DA 4WXOA 4XPEA 4L3NA 4K4YA 2OUGA 2QJ3A 2JH3A 2CVIA 1NK0A 5I42B 4LF5F 2ZZTA 2CAXA 2GIFA 3HD2A 5IS2A 3DLJA 1RUSA 5H9EJ 1EAYC 5KFNA 1BMQB 1REGX 2NR0A 2IPOB 1XNQJ 1RTHA 4M5MA 2KFNA 2HQCA 2H48B 2MMYA 4DUZF 1SB6A 2HHUA 2ZH9A 1AFJA 2YKAA 2X3DA 5IC6B 4P7VA 5HI7A 1EQ0A 4ECRA 2ZHBA 2YNIB 2YKNB 3RB3A 4X65J 2EI5A 4QR1A 1UVNA 2LEAA 2JL9A 2Y3YA 2ZBCA 3AJDA 2F8HA 2WSFC 4K2JA 4PXCA 3DOLB 2QSFA 2DKOB 3IO1A 4KH1B 1M5OC 3R7NB 4C3KA 4NI2B 2E44A 5C25B 3NXZA 4B3TJ 3TUIC 1HYSB 4M63A 1F9EB 3ULHA 5I3UA 4DPUA 3BV8A 3KJQB 1EX8A 1Q4RA 3ZTPA 2PN6A 2W2MP 4A8MP 4FP9A 2EBGA 3GLJA 1S76D 1TAUA 4YB1P 3Q2SC 2HFSA 3WC2A 1NSQA 5K14B 3MM6B 2GVDA 2IMOA 2IFXA 3SFGA 2HAIA 3UN5A 3AA8A 1JX4A 1U02A 3CDEA 4DR3F 3SMZA 3FDSA 4AL5A 4UY85 2E5LF 4WYLA 3RR7A 1SL2A 4RNNA 2R7WA 1FO1A 3PM9A 1S5ZA 5DQHA 4IDKB 2FHKA 3R2DJ 4UOFA 4TQSA 2LXUA 3TJ9A 4JV2A 2I2YA 3IGNA 3JTOA 1Y4ZB 5KFIA 4DLGA 5KT7A 1WDTA 1TL5A 4DPYA 1S9FA 2UU9J 1FESA 2V69A 5A8WA 2YNGB 1R6VA 4MH8A 3C16B 1GXUA 4FYDA 4ERDA 2KZZA 3CT9A 3H2VE 2ZJQQ 3M2UA 1R8BA 1LWXA 4X4TA 3VZIA 4PZVA 2JXIA 1S6QA 1TKTB 2KL8A 1GXTA 1RTIA 4Y0FA 1O5JA 3BGOP 1RK8A 1CPZA 1QSYA 4X62F 5L46A 2RBFA 2Q3PA 3O2IA 1ULRA 3NS6A 3TYTA 3P45B 3VGUA 1IKWA 3CXCR 3W2WB 3CCVS 3QJJA 5HBMB 4X4NA 4X64J 2BZ2A 3KJVB 5A2QY 2GHVC 4F4KA 3V4MA 2YY3A 4H54A 3EVOA 1F2HA 3T19A 3CVKA 1RT7A 3K7RA 5J1NA 4LREA 2ILZA 3L7PA 4LQ3A 3DM2B 2ZM6F 2BSQE 5IT0A 3MTKA 3KDNA 3OXLA 1T9YA 2G1DA 5K8OA 3TAMA 2I5JA 2PI5A 1TL1A 1WOSA 3KK2A 3M6VA 1UEUA 5F8IA 1Q79A 3VQTA 4HHHA 5J2MB 2VUGA 4YR2A 3JSRA 1NEEA 4OX9F 3DHXA 2ILYA 4OYOA 4CCHA 4QW9A 5FIIA 3T6BA 3QFHA 3C6UA 1TL3B 1C1BB 3K5PA 3F44A 4R8UB 3J81j 4KKOB 5HATA 1JLBB 2B5JA 1N56A 3W8GA 3SQGB 3M32B 1VLYA 3MR7A 1FRMA 5F8MA 5LM7E 1QSLA 5DDPC 5JMNA 3GU0A 4CRJA 2BE2B 1J5OA 2V50A 4ICLB 2MZSA 5DM7Q 1R7IA 3NBPA 1CQMA 5FD1A 2RDIA 4CLFA 1YJRA 2AJ1A 1U25A 3CJ0A 4WJBA 4F2SA 1Q53A 2IC3B 3WZ0A 5K8PA 4V19J 4ZLPA 2LQ5A 1LOUA 4ZS6A 1PAUB 1B0TA 1H6KX 2E5HA 1HNWF 4EBDA 5B0FA 2Z58B 3MF5A 1KFDA 2B4VA 1WHXA 1R31A 3VWSA 1IJEB 4RW4A 1SCJB 3N79A 3FSXA 1UVMA 3LQVA 1RT2A 2VBWA 5IOLA 1AROP 2FJDB 4KHMA 4RW7A 4K4ZA 1S10A 2OMOA 2J7KA 3FFIA 1RCOB 3ILOA 3AFGA 2B6AA 4I7FB 1R8HA 3R6GB 4CH0S 4O3SA 5A6WA 1FHTA 2GJFA 3PFOA 5K20B 1KQFB 4DUYF 3LPEA 2NCKL 5AXMA 4NXMJ 5C7PA 2WAQD 4H4OA 1FI4A 2ATCB 1YQHA 1RWPB 2HS4A 3MEKA 3ETMA 4PWDA 1O0PA 3W5XA 3PHEA 4IRCA 3JSYA 2V9KA 2RHQB 3J7ZT 1B64A 1BE4A 2DNOA 2FLLA 4GVBA 5H1SV 4X66F 3NGDA 3Q83A 3SSQA 1WTFA 2UVUA 2EXUA 1ZAVA 2YQ0A 2OFHX 1KLNA 3UNGC 2HNDA 2RVJA 2W7OA 3G4SS 1Q16A 1N0UA 2PMHA 3TJ8A 1GMVA 1RHQB 2MEWA 4CDIA 2E29A 4DU8A 2BOPA 1C4AA 3GJSB 4ALZA 3TUZC 1H2TZ 1M1GA 3FSYA 2PC6A 3K5NA 4HTIA 2GX8A 4R25A 3D0HE 1KR4A 3MAAA 1QUPA 3DYAB 1YDLA 5GADU 3UDLA 3M2RB 5B0EA 1YG0A 2OHDA 4HT5A 2NSBA 1U45A 3L3CA 1TP7A 4MJKA 2J8AA 4PXDA 4YHHF 4QYZJ 2V2VA 5J2PA 3ETOA 4M95A 2QLFB 2AX1A 4CH7A 1ZM3A 5E41A 1BQNB 3LP1B 4A8WA 3P5TL 4OYAA 2H5EA 3B4MA 1SH3A 2KZMA 1RJJA 4LFAJ 4DR1J 1HNIB 3H5XA 1VRTA 4F4AA 2D74B 2KT2A 4BC9A 5BYSA 2OD6A 2U1AA 1V5IB 4AE5A 3POTA 2LA4A 4OX7A 2IJFA 5J1EA 3THTA 4HR2A 2AT1B 5KFYA 1LK7A 3U1LA 2XMAA 2UUTA 4N41A 3J80Y 1N6QA 4G1IA 1RT4B 1SJ1A 3WIVA 4RW6B 2FHJD 4ZPVR 3CW2C 3H59A 4A47A 5BXIA 3EJMA 4NLTA 4G6VB 4B9LA 4ZCMA 2YBVA 1UL3A 2ALZA 1T9UA 1N5YA 4KQZA 1KQSR 1U1PA 3AHPA 1N52B 4QU6A 1RWNB 1SPBP 3CDUA 1TVRA 1YITS 2DR6A 2JWNA 5GAGU 3D6FB 1KN6A 3RB6A 1TFWA 2F63A 3BSNA 1F9FA 4P74A 2FJWA 4C8ZA 4JBCA 3IRXA 3CD0A 4YFUA 1NSKL 2A1BA 4ER8A 4QWEA 2XI2A 3BH6B 3PG9A 3TA0A 2EFNA 1SQEA 1RABB 3ELHA 1S1VB 2VBZA 2Z57B 1PG5B 5KFQA 1ZM9A 2MJNA 3AQOA 1YJ9S 1RAEB 1S1UA 1WHVA 2W9CA 1FD8A 5KG5A 2C2KB 1GQEA 2LVWA 3PY8A 4MMOA 3A12A 4WK1A 4RUCA 4RU9A 3I0SB 4CO3A 1Q8IA 1K44A 3V6KA 1GT8A 2B9WA 2BA3A 3CMES 4JI5F 1BQMA 3CCRS 1SUQA 2IIHA 4C3LA 4P71A 4ZJOA 3BGRB 2UVVA 2DHAA 3SXLA 1X4EA 2R2TA 1IKYB 2FLPA 2VC0A 4DN9A 4OHZA 1FX4A 1S0MA 1ITPA 1R6YA 2PO4A 3E51A 1LXJA 4J91A 3P4UB 4DX6A 5J2QA 5HVFA 3VR1A 3ZZ0A 1UW4A 2ZJRQ 4XAKA 1LWCA 3B4DA 4J9OA 4OYZA 5E0OA 5KOWA 2PMWA 2ZNYA 5CD4A 1JXEA 3OUYB 3HLUA 3QFWA 4JI8F 2Z56B 4QBUA 1S4FA 1BDTA 1QAIA 3Q23A 4X4PA 1SL1A 2E1AA 3GFZA 2VA2A 1R0AB 1BD6A 2KELA 1FTRA 3D6HB 3FMBA 2VQEJ 4W98A 2P8IA 1UA1A 2DNKA 3HSZA 2CZVC 1SJFA 5D0HA 1QM9A 1IR1A 1E6VA 2DR5A 1Y10A 1CULB 3ZNUA 1VQ8S 1HBOB 4BWMA 4K4VA 2F4VJ 1FVQA 1TKXB 1X5OA 4J9SA 2R2SA 2AX0A 1NDKA 3DRRB 3KYLA 1LEOA 2HK3A 3QLHA 2CPGA 1WNEA 3HKWA 2C2EA 2J7UA 4IG0B 4FXDA 3M6WA 4B9MA 1T9TA 2VIHA 4RBVA 2QLWA 4CO5A 2DGQA 4BBYA 1WHYA 1R89A 2RD5C 3T1HF 2CNOB 2XZDB 4LF4F 3CD5A 5KT5A 4YR0A 1WSVA 3TUJC 4KTQA 4UY8T 1RT6A 1HWIA 3G82A 3DHWC 1RU1A 3MUVP 1HQUB 3UD3P 1TL4A 2PI4A 3OD2A 2B7BB 2V8GA 3FVYA 2QN6B 2AHOB 1SL0A 5JVGQ 3G8SA 2W7AA 1M5SA 2BW7A 4RNMA 5AE1A 1FEHA 4W92B 2HGLA 1E6YA 4H4KA 2OTJS 4K8RA 4YDDB 5DQGA 3VAIA 2JDJA 4C7QA 7FDRA 3GIJA 3ZTSA 5D4PA 2L08A 4IG3A 4DL5A 3T5LA 4ZLJA 1LWFB 2CPXA 5KG1A 1YJNS 2FY8A 2E1MC 4J7CA 2ASDA 4ECUA 1FD2A 2CVEA 3UO0A 1RT5B 5GAEU 1U0SA 2VPWB 4NEYA 4KY3A 4LSLA 4EWTA 3SCKE 4ZVUB 1JJ4A 4E2FB 2X1FA 3E01B 4FF2A 2RU9A 1HNXJ 3T3FA 1HLWA 4ETXA 4LRCA 2D7SA 1V5VA 1YJTA 1X31C 3BGFA 3HVTA 4JI2F 2MYFA 4IR9A 2C1EB 4C11A 1F1BB 1Y5LB 2EFVA 3DLGB 2DY9A 4B9NA 1OHNA 3CC4S 3NGKA 3I5AA 2MDAA 3Q8SB 2OJ3A 2EFOA 2ZFHA 3IM8A 2M8DB 4CP5A 1JQGA 1MWZA 2Y9HA 3GV7B 3DMJA 1NH8A 1XERA 4Z7CA 5FLXU 4J9LA 3V5RA 4X2BA 1SIWA 1MROA 5AE3A 1FJ7A 2DXDA 1RDRA 2NXJA 4EZ6A 5F9LA 2AYGA 3MFIA 5F8HA 2AQ4A 3G71S 2CDRB 1VC5A 1SJ3P 5CD4H 4L3KA 1S0OA 2MSTA 3QWPA 1YRUA 3MMAB 2R8JA 3FBBA 5DG7A 4AQYF 4ILMA 1HW9A 3KG4A 2LEPA 1M5HA 2XTJP 3OFEA 5HMYA 3OTEA 1OSDA 4E8UA 5J2NA 5CZVA 4IRKA 5LSOA 1VGYA 3EVMA 3T5JA 2CPDA 3LO3A 2W01A 4DQIA 2ROEA 3L09A 3TX0A 3H5UA 4K0KF 3BREA 3I5BA 2IJRA 4JI1J 3BKUA 1WC6A 3TZZA 3T1YJ 1X4DA 2HFZA 2KVQE 5HQMA 5L9NA 2FTRA 3Q8YA 1EP4B 1UEVA 4QJVA 2OPQA 2AD9A 1X9MA 3MD3A 3DXBA 2N4CA 3IS9B 4P2XA 4OHYA 3KFWX 3G87A 4AL7A 2ZH8A 4TU8A 3VVTA 2OO4A 1X4CA 1V3ZA 1H73A 1TR0A 3ONQA 4IH6A 3QSYB 2HS3A 4YS2A 2BJ9A 4O0NA 1I94F 1UZDA 3VTIA 4DFPA 1FFGB 1RBOB 2HYIB 4JI4J 3JAMY 1SIWB 4I2QA 3OVSA 3CIMA 1RU2A 4N76A 4M5DB 1KWMA 1IKVB 2VD3A 3MUMP 2GV1A 3IR6B 2WK4A 2OPPA 3RB0A 2BJ3A 2RAQA 1GH8A 3HT0A 1ZETA 1JLCA 4TKTA 2UUAF 2FHOB 2FD2A 4BWJA 3K5OA 1XR7A 5HAOA 1X7VA 3BM7A 1UZHA 4PUOA 3B82A 1DQ8A 3F0NA 2K7KA 1JXVA 2XCPA 2MQLA 1REVB 1OY6A 2B4UA 3SI8A 1TKZA 1A0OB 2YNFA 4RPFA 3ZTQA 2HBRB 2CJYB 3TVYA 1UW9A 5C24A 1M90T 4PYAA 1UAWA 1TFYA 2C28A 2RUSA 1NDPA 1X0FA 3JS9A 4XPCA 2Q6BA 4FVMA 1MU2A 2PGCA 2EK1A 2K1RB 3GPAA 1U49A 4AD6A 4QIGA 1CS4B 1XTZA 1WSRA 3FQLA 4LMZA 2D3OR 1VI7A 1UWBB 3OFFA 3W62A 2FJEB 4WP3A 1BXNA 2L9WA 1N36J 1WUUA 3L9ZA 4N7TA 3J7AN 3IR7B 3SYZA 4DSEA 3NKYA 3ITHB 1YHQS 2FVRA 1JKHA 2OFGX 4NLRA 2CQ1A 3DLLQ 2GA7A 1QTNB 1PC5A 3KK1B 2HQIA 5KFMA 1WOOA 2F1FA 1HQEA 4DR1F 1YRXA 2WONB 4D8JA 2ZNZA 4J9QA 4DF4A 4FZVA 3PO5A 1T03A 1YSJA 1U7LA 2PEBA 3CJ8A 2MQPA 3OL9A 1WJ9A 5J1PA 1RHKB 3V6DB 2K5JA 3IP0A 5IT4A 3M4XA 1CJKB 2F3JA 4K4XA 3NNCA 1HI1A 4EBCA 2KI2A 4DV6J 2D1CA 5CAAA 3BO2A 3ZC4A 1IJFB 3UVJA 2DD8S 3EX7B 4HACA 3SV4A 2YKMA 2ZVSA 4RBTA 5HVGA 4TLRA 1UPPA 1VQNS 1IKXB 4FXEA 3TEHB 2H9ZA 2M2BA 2E9TA 1NJZA 1Y3KA 3IM9A 1FXRA 2M8HA 4DUTA 1PARA 2JRSA 4I2PA 3VAJA 3OL8A 4Q5VA 3MMCA 2WW8A 4DV4F 4U8YA 2LP4A 2C3OA 1XIQA 2V9WA 4CQ1A 3O1LA 3H40A 2ZOMA 3MMBB 1QAJA 3UPFA 2V67A 1S1TB 3H8YA 3U02A 3FUYA 1UFKA 1QD1A 2NPIA 5T7LB 3NRBA 3MM8A 3MWBA 3Q22A 2NQPA 5L1IA 1N54B 1VC6A 2FGCA 2MQNA 4LR9A 5BR8J 3SSRA 2LYVA 1ZM2A 2BACA 5GAHU 3FCWA 5KFTA 1HD0A 4LBHA 3BYPA 4LUBA 4ZIWA 1S0NA 2QX0A 1B7YB 1OY9A 3MAHA 3MEGB 4O3OA 3FCVA 1S9GB 4LF9F 2QE5A 4PYDA 2F8MA 1BWVA 3H2UB 3P5BP 3UN2A 5LSLA 3TZWA 1VHFA 2LEBA 4LF8J 2AYMA 5F8JA 4A48A 3EVWA 3PX0A 1W2BR 1RAAB 3I6PA 3I55S 1S72S 1SH2A 5KG6A 1P9YA 2DR8A 1ZAWA 3F56A 3V4IB 3BGLA 1W25A 2HQ3A 2RDJA 2DBBA 3MEEA 4ZVGA 3GYXB 4J9VA 5ETPA 3M30A 4HI2A 3KLGB 1YGYA 4FS2A 2GCFA 2WOMA 5D6GA 1KEKA 3M8WA 4B3SF 4JOUA 1NUEA 2R7TA 3Q8QB 2QG9B 2R7SA 1AT1B 1S77D 2VL1A 2UUCF 2J9DA 2DRAA 3RYLA 1TAQA 3CWJA 1RBLA 1H3DA 2FVCA 2UV8A 3MM5B 5EHHA 4CYUA 2EWHA 5KFSA 1CJVB 3GJRB 3DLEA 5E5NA 2KRBA 3CCMS 1LW0B 2VOPA 4F67A 2XBPA 4ENOA 2HIQA 5E3RA 2FZCB 4ZPTR 2E7WA 1S1WB 4O0IA 5DLFA 4AYBD 3W1YC 2OTLS 1CVJA 2GVZB 1RT3A 1HHTP 2DRDA 3JQKA 3MPDA 5KFFA 1O6XA 2ZUGA 1N33J 2GO8A 2MLYA 2MLZA 4DCOB 1TL7A 3AJ1A 4B3MF 5DGAA 2RH3A 3EM1A 2N3LA 4L73A 2CAJA 4A8SA 3AOAA 3IGVA 2CPIA 4YR3A 3MECA 4Y65A 2DHHA 2IYIA 2ZHOA 3DRSA 1L5UA 3KUHA 4DV0J 3K8WA 4M5LA 4F4WA 2CJAA 4QPXA 2DISA 3QIPA 3DGPB 1HNVB 3DXSX 3FQKA 5ETRA 1BDVA 4FKXA 3QT8A 5CH7B 2FUG9 4CLPA 3GJQB 1Y5IB 1PO6A 2B8QA 2OPRA 4RUBA 1SVDA 4HH1A 1J2VA 5AJ3J 4CLZA 4HKQA 2JZ5A 4DSJA 3NG8A 2IBOA 1ZPWX 3OSNA 1CJTA 1KS2A 1OS5A 1LK5A 2B8PA 3CDAA 2D3ZA 3PW4A 5LJ3Y 4USJC 4ZVRB 5IXUA 1FTCA 3UR0A 1RAIB 2EW9A 2L3MA 3MXHP 5D15A 1N32F 3AODA 2QC3A 2E7XA 1VQMS 4F25A 2YH1A 2VOOA 2XMMA 4HT7A 3VW4A 4NYPA 4KO0B 5KFDA 8AT1B 2XHWA 2FLNA 2HEKA 1WF0A 5B0GA 2NXUA 3UD5A 1QAYA 2AMCB 4LVOP 1KFSA 5CYMA 2GGPB 3W2VA 3M8ZA 5EWGA 4YP3A 2O01C 2MPUA 2BW2A 5EWEA 4DFKA 1HBUB 3MDFA 4Q2LA 2Z2YB 3CCUS 1Z2LA 1HNZF 5I3QA 4ZPAA 3PRBA 4FF4A 4C0OC 3HJFA 2XYHB 2F9DA 3C19A 1DLOA 5C42B 4FYVB 2AGQA 1P27B 2DYAA 3BR8A 1UEKA 2C3YA 4ZHRB 3GFHA 1K9MT 3H20A 1RHMB 3OTOJ 2J6UA 3D1QA 4DQSA 1CEZA 4CTAA 3L4BC 2YWEA 1F5AA 1LWEB 2QL7B 3ZTRA 4DN0A 1GFWB 4DCPB 4IRDA 4DL0C 3NGRA 4HYKA 3LWLA 4F7VA 3BPDA 2Q43A 4NLWA 4LF7J 2MHNA 3QYYA 4NMXA 1QUVA 2DXFA 2HNYB 5D4LA 2NZ4A 4KAIA 3SDEA 3Q8UA 4ECWA 3IMQJ 3GIIA 3DKDA 1WC4A 2BJ1A 2E66A 1T94A 5KT3A 2HHQA 2J0WA 1KQGB 2QLBB 2MQOA 4ZP9A 5L38A 4RX6A 5L1JA 3TOQA 4ID5A 1LW2A 1H7XA 1FCAA 1RWKB 3CJSA 1JLGB 4W90B 4KHPF 1TQLA 3M8QB 2JC1A 1HHQA 2FQQB 1QE1B 4CT9A 4B9SA 3HHNB 2CJ9A 4KH0B 1S1XB 1I5OB 2LCWA 1DTQB 4O23A 2A2DA 1SJ4P 1NJXA 1M5VC 1VBXA 3GP9A 2KYZA 3OT9A 2MZRA 4X4UA 1SC3B 4JYAF 2VHGA 4OYMA 4B9TA 1C0UB 3NGTA 3A4TA 2DGVA 1KTQA 4DV5J 4ZCKA 1XC9A 4ZPCA 3PYGA 3H0PA 4WCEQ 1L3SA 2RE1A 3FNNA 3CJRA 2IM0A 1NKCA 4ATNA 2NUHA 4FN5A 4NCGA 4O4GA 4U95A 2ZH4A 4RJVA 3JYTB 2HHWA 3NAIA 3KDOA 4UOCA 1N34J 3OTDA 5HQ8A 3LP0A 1XMQF 3AD8C 6FD1A 3Q8RB 3M1VA 5DQIA 1FKOB 4U9RA 2FJBB 1C1CA 2PEHA 1T9XA 4BDPA 1SKRA 2GQQA 1HBMA 2RRAA 5ETLA 3WDOA 3IBCB 4TYAA 2ZD1A 4BCAA 2DHXA 4DR2J 5KFRA 5DETA 1B70B 2VG6A 2OLWA 4MKYA 4U96A 4F50A 1JLAA 2YQ3A 1XWLA 4GO5X 4CH1A 4X4VA 1EETB 2BANB 5JUMA 2RKIA 1LQ9A 3KLFA 1RAOA 2DT9A 2DXEA 3BN4A 1NK6A 2B4OA 2V4RA 2KT5A 2E1CA 1OMSA 1B99A 3TRGA 2QA4S 4IFYB 2DH8A 1SBRA 2W9BB 2PIIA 4U67Q 2OPSA 2ROGA 2LQJA 2YX7A 1HR0F 3D68A 3IXQA 3MCSA 1X4GA 2RQCA 2FB0A 4DS4A 3HHLB 3CO0P 3MEDA 2V2KA 4B3RF 1P6TA 2V8VA 1X4FA 3CCJS 2Y8YA 2AW0A 2IM2A 3QO9B 3PHTA 2H4WB 3HHDA 1MW7A 3QT5A 3KK3B 4P52A 3CSKA 3M05A 2IVYA 3CCQS 1U4BA 1NK7A 2IAJA 1F5CA 3PW5A 1B3TA 5EN1A 2WHOA 2P6TA 3N6LA 4TXSA 1EKSA 3VAGA 4C9DA 4H4MB 4DFJA 3PKMA 1X9WA 3HXMA 3EZOA 1S9EA 3ET6B 4QIFA 4JP8A 1WELA 3CJKB 1K47A 5E3PA 2VG7A 1F6TA 3ILLA 3BKFA 2OGUA 4PG5A 2DVIA 1XNRF 2HFUA 2VFUA 5D3GA 3JTNA 1HA1A 1X4BA 2DNNA 3R5GA 2DITA 3JTPA 4DR6F 4U7UD 3NWRA 3OFHA 4WE1A 1D0EA 4N47A 1VLOA 2PA3A 2OP5A 3EYZA 2H3AA 4H4KC 1HPZB 1DHMA 2JFDA 2WBRA 3IG1A 3NY0A 5ETSA 1NK5A 1JMTA 5HN0A 4AFFA 3KLHA 4F3MA 2XO7A 2YX4A 2MZ1A 3VAFA 2MZJA 2OELA 3IN5A 3DOMB 3IFEA 2FHJA 4DMZA 4X84A 1TTHB 1IBLJ 2JVRA 3PXGa 2CNLB 2YXLA 4JI7J 2Y0SD 2KHDA 3QQCD 3DDKA 5KFJA 2XSJA 3FBEA 1NPPA 3NO7A 1TUWA 3N5FA 1JB0C 1EHWA 4MIAA 3K89A 2QZ8A 3R3TA 4DV1J 3C6TA 4ZITA 4WFXA 1NJYA 3BO4A 5GMDA 1VYAA 4USIA 4N8OA 2RS2A 4AUKA 1S59A 1IWAA 1RHRB 3D66A 4MAKA 4NWBA 5KG4A 3LJPA 5F9NA 1IBCB 4LFBJ 1CC7A 1N5SA 2P9GA 2KJWA 4GMKA 1GXLA 2MKYA 2CWXA 2QMWA 5D77A 1T7PA 2R8KA 2VG5B 2XO6A 1HBNA 3OQ2A 3DLKB 4KBIA 4ECZA 4C8MA 3CDBA 1J5EF 1VRQC 4O3RA 4M5KA 1NPRA 4USKA 1WC5A 1KVJA 2HNZA 1U1OA 4RW9A 1X4HA 2RF2A 5IQQA 4DPXA 2H1YA 1JJHA 4NYZA 4OHVA 4G1QB 2VFTA 3RR8A 1AXQA 4WF9Q 3KJNB 2VQFF 1QVFR 3RRGA 4B08A 2MGZB 5L1LA 3AAWB 2ZDOA 3NOCA 1NB2A 1J27A 3CE8A 4Y00A 2XY7A 5KFCA 4LSZB 1RZMA 5F3ZA 2KU7A 4KRWA 3D1HA 1TMJA 3IAM9 1SKSA 1JXLA 2HFVA 2IM1A 1T05A 2V6AA 3CPWR 4MFBB 3PO4A 2AEJA 4PABA 1RTDA 3GJTB 3QGIA 2NREA 4WZMA 3TX8A 2DNPA 3Q8VA 2HLUA 4WP9A 4GKKJ 4F3QA 1XMOJ 1OPIA 3CNQP 2ZE2A 4O44B 2B4PA 1JLEB 3AD7C 5A0YA 1VFJA 3D1OA 5BYQA 2UUBF 2C2MB 4KGXB 4ELVA 1N8RT 5C2CA 1M1HA 3EDRB 4DFMA 2M52A 3J81Y 3VAHA 2OAUA 1JJ2R 1TELA 4GC6A 4TQRA 2YNHA 2VKZG 3OW2R 1R0BG 1VRUB 4XTTA 4Z37A 4LF6F 4LSNB 4TVAB 4Y2AA 1XQIA 4DR5J 2BQ3A 4YQWA 2HZCA 1P1LA 4FPIA 3M2VA 2CJKA 4ITSA 1YTYA 2WCXA 4ED3A 3HI9A 3HVAA 2R42A 2VC1A 3CO9A 4RKUC 4PKDB 2ZDPA 3PTWA 2BM0A 3TQEA 3M8PB 3THVA 3C14A 2ZH2A 3ILJA 4FXWA 1HARA 4IFVA 4Q44A 5IV3A 5B0BA 1NNDA 2EG1A 3KWMA 3UDVA 5HLFB 1HW8A 3Q2TC 2FGOA 2ZUAA 4FDFA 1DURA 1RTJA 4IYQA 1RE1B 3H25A 4QIWD 2CJQA 2XY5A 2U2FA 4URQU 4ED0A 1HKAA 3ISZA 1P8GA 4XDCA 1UFLA 4DF8A 4ZPBA 1WDDA 2EBEA 2OKQA 3CMQA 4TN2A 4HI1A 3I9ZA 2M70A 1FJGJ 2JJ4D 3AB4B 3JQMA 3RG6A 1MG7A 4DV7F 1VIOA 2DNHA 2XGPA 3EGWB 2G4BA 3KHRA 5DG9A 4M5HA 1V6HA 5ITHA 2A6MA 1IBMF 3EUNA 5I42A 2NSCA 4KPYA 3MM9B 1SI9A 3PIPQ 1VQ9S 3QATA 2NZCA 2C2RA 4U8VA 1X5TA 2N7YA 1TK0A 3GSDA 2HQFA 3PVXA 1Q81T 4B3OB 3G8TA 3QRRA 4LRDA 4DCJB 2DNMA 3LPYA 5LMUF 4M1KA 2UXDJ 3P6YC 3T1AA 4D3HA 4LIRA 3Q86A 2YNIA 4ECYA 1U0HB 3B6BA 3KKFA 2V4JB 3TNVA 2YKNA 2LA6A 2DNRA 2H65B 3IR5B 5GADI 3I4PA 1KONA 3W7BA 2A0FB 3O3LA 4KT0C 5F8LA 3CJ2A 4N77A 3DOLA 3FT7A 2CZ9A 1HIYA 3A3OB 3DDNA 1KOOA 1T9WA 2CYYA 2X51A 4HV0A 4NI2A 1B7FA 5C25A 3BKTA 1HYSA 5E3CA 1OSCA 2NPFA 2LQ8A 2CQ4A 2ZWOA 2G1HA 4EO8A 1GMUA 8ATCB 3FGVA 1GAOA 2AIRB 1NH7A 2K3KA 1KLMB 2DIUA 2RNEA 2ZZMA 3ISND 1NK8A 4JUZA 2JVOA 3ZO7A 4ES1A 2CXEA 4JI6J 3PJ9A 3GG0A 5K14A 4CLTA 2F5GA 2IRUA 3MM6A 1TZ0A 1AFIA 1Q1KA 2BE7D 3JSMB 3TI0A 4JI3F 2J8SA 2ADBA 4IDKA 3OTCA 1B0PA 3EPIA 1JLQB 2YWHA 2WVFA 4TNOA 4KSEB 3D4JA 1IBKF 3G6VA 3KLIB 5A8RB 3PRDA 2G2ZA 3OL7A 1WC1A 4ZMMA 4Y2KA 4HL9A 4Y34A 3EGZA 2OEMA 2YNGA 3AY0A 3FC9A 3C16A 4LQ9A 3D28A 4DR4J 5GAGI 4NL5A 3DCAA 1ZPVA 2H5JB 4Y2IA 2V0NA 5KFOA 1XN9A 2QO3A 3KOAA 5HL7Q 2NXCA 2MQQA 4CLLA 2G13A 1TKTA 2LFVA 2BJEA 2CA9A 3G6ES 1S0VA 4C2MA 2L41A 9ATCB 4OJGA 2YPYA 1L3UA 3T5KA 2IM3A 2QLJB 5IFMA 2PD1A 2W24A 3TR5A 3I32A 4ANDA 3W2WA 4CI0B 1QJHA 2P9CA 5HBMA 4X4SA 1RT1B 3KJVA 4Z7YA 5DO2A 2IDLA 1FNXH 2R4FA 4OI4A 3SV3A 3N28A 4OZ0A 2GHWA 3CUNA 3DM2A 4Y2MA 4KFBB 2IJNA 4GKJF 3KLEB 5LMNJ 3U1MA 4J5OA 1FKPB 5M2RA 3AXKA 2PFDA 4YN3B 3ISNC 2XM3A 1PC4A 5HMWA 1U6BA 3TZXA 2APOA 1IWGA 1QAXA 3OR1B 2K9IA 4FVCA 3DRPB 1UA0A 5F0WA 2W8KA 1WEYA 5J2MA 2MLXA 5SZTA 3S01A 2I1RA 1XR6A 3TAQA 2HQGA 4J9PA 4Q8FA 4DV3F 1TL3A 4YY3F 1C1BA 4R8UA 4KKOA 2B3TB 1JLBA 1GTEA 2WBMA 2IY5B 3OL6A 2HHTA 3SQGA 3M32A 2C42A 4PWUA 4ED2A 3UE2A 2AZ3A 4RNHA 3GR1A 3VAMA 2PMZD 5A2QU 2W4PA 2BQRA 2BE2A 4ICLA 3MCOA 3HO1A 3HSJA 3D3CJ 3KNGA 1WKLA 4KIAA 4M5GA 3TA1A 1KD1T 4USUA 1EJ7L 2IC3A 4F4XA 5D0EA 3RRHA 4OX8A 2KG1A 4LRFA 3AJ2A 1UVJA 5H9FK 4HDGA 3RAMA 1RAJA 5DDQC 1RQ0A 5B09A 2C3UA 5CQGA 1RHUB 3LAMA 2K6LA 4E0DA 5AT1B 1TK5A 2VODA 1YZ6A 5CXTA 2V2QA 3N0VA
chains in the Genus database with same CATH topology
2BJ8A 3QSIA 1U9PA 1BDVA 2CA9A 1Q5VA 2JXGA 2K5JA 2FGCA 3GXQA 1X93A 2BSQE 2HZVA 1MYLA 1BDTA 2BJ9A 1MYKA 2Y3YA 1B01A 2H1OE 2NZCA 3LGHA 2HZAA 3PHTA 2KELA 1Q5YA 2WVEA 1QTGA 2WVCA 2BJ7A 4FXEA 2WVBA 3OD2A 2K1OA 3H87C 1EA4A 2CADA 2BNWA 1P94A 1PARA 4ME7E 2GPEA 2JXIA 2BJ3A 2WVFA 2PC6A 2JXHA 2AY0A 3VW4A 3QOQA 3BKUA 1NLAA 2CAXA 2BA3A 2RBFA 2CAJA 2K29A 2F1FA 3FT7A 3FMTA 3VEAA 1B28A 3BKFA 1BAZA 2K9IA 1ARRA 1ARQA 2WVDA 2K6LA 4HV0A 2BJ1A 2BNZA 4D8JA 3BKTA 1MNTA 2CPGA 3VEBA 1IRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ8 A;  3QSI A;  1U9P A;  1BDV A;  2CA9 A;  1Q5V A;  2JXG A;  2K5J A;  2FGC A;  3GXQ A;  1X93 A;  2BSQ E;  2HZV A;  1MYL A;  1BDT A;  2BJ9 A;  1MYK A;  2Y3Y A;  1B01 A;  2H1O E;  2NZC A;  3LGH A;  2HZA A;  3PHT A;  2KEL A;  1Q5Y A;  2WVE A;  1QTG A;  2WVC A;  2BJ7 A;  4FXE A;  2WVB A;  3OD2 A;  2K1O A;  3H87 C;  1EA4 A;  2CAD A;  2BNW A;  1P94 A;  1PAR A;  4ME7 E;  2GPE A;  2JXI A;  2BJ3 A;  2WVF A;  2PC6 A;  2JXH A;  2AY0 A;  3VW4 A;  3QOQ A;  3BKU A;  1NLA A;  2CAX A;  2BA3 A;  2RBF A;  2CAJ A;  2K29 A;  2F1F A;  3FT7 A;  3FMT A;  3VEA A;  1B28 A;  3BKF A;  1BAZ A;  2K9I A;  1ARR A;  1ARQ A;  2WVD A;  2K6L A;  4HV0 A;  2BJ1 A;  2BNZ A;  4D8J A;  3BKT A;  1MNT A;  2CPG A;  3VEB A;  1IRQ A; 
#chains in the Genus database with same CATH topology
 3CCT A;  1BGX T;  2XS2 A;  2POK A;  1IBL F;  5KAK A;  4QQB A;  1JLF B;  2MQ8 A;  1KRP A;  3OHA A;  3VQS A;  4OZN A;  3S8S A;  2Z2Z A;  1H98 A;  4OYP A;  2HHH J;  1PIL A;  4I7F A;  1U48 A;  1UWA A;  1UVI A;  4DPW A;  2COL A;  4F0H A;  4LF5 J;  2WRM A;  1KHW A;  3PX4 A;  4DHV A;  1H0H B;  2ABY A;  5EDW A;  2HMI B;  4V1A k;  4OV6 A;  2IRY A;  4WWS A;  2XMK A;  1WEX A;  3DU5 A;  4K4W A;  3QNW B;  2W4C A;  2M3D A;  3HHL D;  3VGS A;  1RAF B;  1F9H A;  2C22 A;  4DUZ J;  4R0E A;  4J37 A;  2H3E B;  2IA6 A;  2Z30 B;  2DNG A;  1FRX A;  3GCW P;  1KVK A;  3GIM A;  1OQ3 A;  2KFZ A;  1WI8 A;  1WAC A;  3S7R A;  3QGH A;  4RW8 B;  5GAE I;  1VIS A;  3LF0 A;  2GIR A;  2EG2 A;  1NJI T;  2BMB A;  2XWX A;  1F0X A;  1OO0 B;  3QPI A;  3TQ1 A;  2R7U A;  4I6Y A;  4OI2 A;  2PT0 A;  3FJ2 A;  4ZN1 A;  2DK2 A;  4IQM A;  3EZU A;  3L95 X;  4OHX A;  2YWG A;  4ANC A;  1VBY A;  3DYA A;  2XMU A;  2M5Y A;  1YBU A;  3M2R A;  2F8E X;  3J7Y U;  1OIA A;  3AD9 C;  1R27 B;  3GB0 A;  4OYX A;  2EFG A;  4NLP A;  2QYG A;  5AXK A;  4FYX B;  1HWU A;  3TWZ A;  4DG1 B;  1ZYQ A;  4DV2 F;  5KG7 A;  3Q24 A;  3AH6 A;  4FNI A;  2RQM A;  1BQN A;  3LP1 A;  2H5I B;  4DR3 J;  4DZD A;  3RU0 A;  1FEE A;  2E5L J;  2VJV A;  5E3Q A;  1UPM B;  5HRO B;  2DR9 A;  1HNI A;  4JV5 F;  2DNZ A;  2HLT A;  4PEO A;  3QAE A;  2R8H A;  3PRV A;  4DSK A;  5CA5 A;  1ZTT A;  3W3S A;  1U6F A;  4HLB A;  5E33 A;  2VA3 A;  4Q43 A;  4B9V A;  4TY8 B;  3N9U C;  2MKK A;  1O8B A;  2NXE A;  4YDX A;  1RT4 A;  1NJW A;  1RA7 A;  4RW6 A;  2GJI A;  2J0Q D;  1FER A;  1WG4 A;  4ELT A;  2DHG A;  3MOJ B;  2QLX A;  4NLY A;  3KG1 A;  4OLP A;  1DZ5 A;  2VFV A;  3V81 B;  1OG7 A;  5M2P A;  3W5Z A;  5IWA F;  3D5M A;  4JI0 F;  2XWY A;  1DQ9 A;  2IVM A;  4UUX A;  3GV5 B;  2BM1 A;  3G6X A;  4KE5 A;  1JWW A;  3BBC A;  4F36 A;  2KHC A;  1FFW B;  3K17 A;  2FC9 A;  2RDD A;  2EKY A;  4X62 J;  4DI6 A;  4C8K A;  4P7T A;  2D9O A;  3MZI A;  2C3P A;  3MM7 B;  4ELU A;  1VJW A;  3UR3 C;  1VQK S;  2DGU A;  3VAL A;  4F4Z A;  1DQA A;  4C0H A;  4IQX A;  4ZK7 M;  3NWG A;  1IR2 A;  1U26 A;  4J9K A;  1S1V A;  1BAZ A;  5KFW A;  4DR7 F;  3FBC A;  4R5P B;  5KOX A;  1RBA A;  2WVD A;  5RUB A;  3J80 U;  2BNZ A;  2ZM6 J;  1Z1Z A;  3W64 A;  2P5V A;  4ID8 A;  4KV8 B;  1AZS B;  4J9N A;  2HBQ B;  4RZR A;  5FJ4 A;  2A3J A;  4AT1 B;  3I0S A;  3NGS A;  5EX3 A;  2KXN B;  2LEC A;  2CNK B;  3LP2 B;  4U6P A;  5AXL A;  4M94 A;  1EKR A;  2PDA A;  4C6A A;  2RML A;  3BGR A;  4OX9 J;  3EGN A;  2VJU A;  3CCS S;  3M8S A;  4TU9 A;  5C5J A;  1IKY A;  3KUG A;  4A8Y A;  5A6P A;  3PYE A;  1VQP S;  3X3U A;  1DY3 A;  2B56 A;  4QU7 A;  1DAR A;  4DPT A;  1KHV A;  4MK7 A;  4UQG A;  1KC8 T;  3OUY A;  2D69 A;  3VV2 B;  3KMQ A;  3OPK A;  5IM0 B;  3CCL S;  1S7H A;  1R0A A;  4ED5 A;  4KYZ A;  3HSG A;  1TMM A;  2XUL A;  2R7Q A;  4UUW A;  1N5V A;  2V68 A;  4NPO A;  4C4W A;  1UET A;  3I0R B;  3HDS A;  2BKP A;  1HNW J;  1PYS B;  4WFZ A;  3DOK B;  1MN9 A;  1CUL A;  3F73 A;  1HBO A;  1GNK A;  3C15 B;  3CJ3 A;  3DN9 A;  3HK2 A;  3PR5 B;  4TLQ A;  1C0T B;  1V3S A;  1U09 A;  1HHS A;  1HWL A;  3NGU A;  4KPC A;  1TKX A;  1YJ7 A;  2DGW A;  1JK9 B;  5HMZ A;  4K2X A;  2HZA A;  3QRP A;  3DRR A;  2ZOF A;  4UQT A;  4J90 A;  1PGZ A;  3HD1 A;  1CLF A;  4IG0 A;  1NSA A;  1YJW S;  3KLV A;  2MKI A;  1ZOT A;  5GME A;  1WG1 A;  2BNW A;  4A8F A;  4DQP A;  4AXJ A;  3FSI A;  5IV4 A;  1IXK A;  5LT5 A;  3QAU A;  1BY9 A;  2CQ0 A;  4DUY J;  2BQU A;  4MYU A;  1A6L A;  4DZ6 A;  4NA1 A;  3K8V A;  3DNC A;  1VIX A;  4QR2 A;  2M9K A;  5HJY A;  2UXC F;  4KR0 B;  1XEZ A;  4EZ9 A;  3EZ5 A;  1C4C A;  1HQU A;  2YWK A;  5KG0 A;  1FK9 B;  3TEG A;  4QWD A;  4X66 J;  1RIS A;  3EDQ B;  3OXG A;  1Q86 T;  2NUU G;  2QMU B;  2CPJ A;  1XNQ F;  4ED7 A;  1MWY A;  1FXD A;  4G3I A;  2E5I A;  1URN A;  1QTG A;  2HSE B;  5AXN A;  1LWF A;  3H5Y A;  3DI6 B;  1N88 A;  1K1Q A;  4X65 F;  2DH7 A;  1TUG B;  3QID A;  2VFR A;  4M5N A;  1RT5 A;  1A9N B;  2HUR A;  1WF2 A;  2QSW A;  4ZCI A;  4NLQ A;  1CJU B;  4GVL A;  1Y7P A;  1FKA F;  5KG2 A;  1VQ7 S;  1VQO S;  2ZBI A;  1FF2 A;  4B3T F;  1K1S A;  3D0G E;  3E01 A;  4YHH J;  2OD4 A;  1FE0 A;  1TKD A;  3D7S B;  2DHS A;  2FLO A;  3RUB L;  2KYX A;  3FCH A;  5IT9 U;  5K8M A;  3G86 A;  4CLS A;  3MR2 A;  1RP5 A;  2ZC3 A;  3P49 B;  2RHS B;  5GAH I;  1W2I A;  1SV5 B;  1VBZ A;  2QGF B;  1ICE B;  2VDH A;  2HGN A;  1BHN A;  1YK9 A;  4QWC A;  3DLG A;  5G0R B;  1S7I A;  4NLO A;  3PZP A;  4USM A;  1U2R A;  2E5J A;  4PRF A;  4C0B A;  3BR9 A;  5IT9 Y;  5DDO C;  2I6W A;  4XK8 C;  3DDI A;  2WVC A;  5L9X A;  1T95 A;  4WII A;  2JBV A;  3RZA A;  4P2F A;  5H9F J;  2J6T A;  1Y9O A;  4CNZ A;  2UU9 F;  4N8N A;  1RKI A;  5IC4 B;  2K8G A;  3MR6 A;  3W61 A;  1NO8 A;  4LRV A;  3QOQ A;  2XLJ A;  3MMA A;  2QA1 A;  3B54 A;  3OLA A;  1H74 A;  2GML A;  1B28 A;  1I51 B;  4F3O A;  4I1T A;  3N4W A;  4BLG A;  4OYB A;  2XS7 A;  3DLH A;  2K3I A;  2QL9 B;  1Q78 A;  1ZTW A;  1MNT A;  1V9O A;  4WFB Q;  1T02 A;  5B7W A;  2ZKT A;  3AB2 B;  2RSQ A;  2W2Q P;  3LAL A;  3ICL A;  1HI8 A;  2K7J A;  2MQM A;  1I3O B;  3KXD A;  3VF0 B;  1RAG B;  1Q0N A;  3W9H A;  5EX0 A;  3W60 A;  4NRU A;  3NCP A;  3SBM A;  3OR2 B;  1PSD A;  2L9N A;  4L72 B;  1FFS B;  4X64 F;  3FKB A;  1EP4 A;  1Q7L B;  3RRK A;  1RHJ B;  3ZXW A;  1S6P B;  3E2E A;  3IS9 A;  4QZV B;  4ZKA A;  4OI0 A;  3V6J A;  1FJC A;  2QL5 B;  2A10 A;  3BF4 A;  4JI5 J;  3WBZ A;  2CAD A;  3ZZR A;  4MK8 A;  3O6Q A;  2IRX A;  2LMI A;  2GPE A;  4NX9 A;  1T9V A;  2D3O 1;  1HMV B;  2VPY B;  4I6A A;  4JV1 A;  2CUY A;  3EIC A;  5D0G A;  1NLA A;  4HVZ A;  1DFD A;  4K4T A;  2HFN A;  2DGS A;  4M5D A;  1IKV A;  1X0P A;  3TW0 A;  4P2M A;  5KT6 A;  3AOC A;  1G6B A;  1ZA1 B;  3BDE A;  5HAN A;  4JI8 J;  5CYQ B;  4ECV A;  2RQK A;  2R7V A;  2B43 A;  2HHP A;  3FZ2 A;  4PG8 A;  2XMW A;  3SZ2 A;  1KBR A;  1AA1 B;  4FPR A;  2N82 B;  1MYL A;  3KUE A;  5K5M A;  1SXL A;  5A8K B;  1TUV A;  3LGH A;  2VIC A;  1PKU A;  1REV A;  1S48 A;  1NZA A;  2AF6 A;  1IR0 A;  4F0M A;  4I64 A;  2BBE A;  3SFU A;  1BWE A;  3CD7 A;  2YPZ A;  2ASL A;  4EBE A;  2WB1 D;  2QIF A;  3W63 A;  1MLA A;  4ILR A;  5E3A A;  4M5J A;  3QBC A;  3JAM U;  2K06 A;  2LU1 A;  1U1M A;  2E9R X;  2RRB A;  2K1R A;  5CZX A;  5FDL B;  1CS4 A;  2Y1L B;  4OZ1 A;  1TV6 B;  1NKE A;  2I38 A;  4KGZ B;  1UWB A;  2CG8 A;  4EFA C;  3LGM A;  3T1H J;  3KTQ A;  4Q0B B;  5HP1 B;  4LF4 J;  4IO9 Q;  4OFZ A;  5F3T A;  3IR7 A;  2MKH A;  2ATL A;  3ITH A;  2V8H A;  4UW2 A;  4CZC A;  4DL7 A;  5L8R C;  4J9M A;  2KM8 B;  4FS1 A;  4WXW A;  2J9D E;  2UUW A;  1DTT A;  3KK1 A;  2OI2 A;  2I8E A;  1U1Q A;  5E2Q A;  2G9O A;  2B7C B;  4NXM F;  4XDD A;  2QA4 G;  1YLX A;  4KC5 A;  4DLE A;  3QJP A;  3R7S B;  4PG6 A;  2HVI A;  2WVE A;  3C8Y A;  2WON A;  4ZPD A;  1TK8 A;  1RWU A;  1WD6 A;  1RAC B;  1D8Z A;  3W66 A;  3A8J A;  3HP6 A;  3BBB A;  2ZBP A;  2J6S A;  1Q7Y T;  1RTH B;  2JSX A;  3M8Y A;  3UDC A;  3V6D A;  1ZA2 B;  4TU7 A;  4QWA A;  4NE9 C;  3ZZT A;  1CJK A;  5ETV A;  2O5D A;  3VVU A;  2HK2 A;  1AYE A;  2BKO A;  4WU2 A;  4BS2 A;  1ZS6 A;  2GMJ A;  1IKX A;  5JVH Q;  2GHP A;  3D9B A;  2HHX A;  1FRI A;  4P73 A;  4NLS A;  1N5Q A;  2MY7 A;  5ETK A;  4FYY B;  5DS7 A;  4ECS A;  3BSA A;  1OYE A;  1U1L A;  1HFE L;  1RAH B;  3NP5 A;  5I3U B;  2Z8Q A;  2W2N P;  3GYN A;  4B02 A;  3WQP A;  3NLC A;  3QGG A;  3BSC A;  4JI2 J;  2K2P A;  3HZE A;  3MMB A;  1BUX A;  4YB7 A;  3A8K A;  2CFX A;  3IWN C;  2Q6C A;  1URR A;  4N5S A;  1QY7 A;  1S1T A;  3MGJ A;  2WW4 A;  3QT7 A;  3DC2 A;  3CMA S;  1Y00 A;  2GVD B;  3DLB A;  4QYR A;  2IMW P;  4RWX A;  3PJW A;  5T7L A;  2CWK A;  1DTT B;  4ZVE A;  5D4N A;  4P9S A;  5JJB A;  3IA0 A;  4X4O A;  4L76 A;  4LFA F;  3CB4 A;  2N7C A;  5I3P A;  4DQQ A;  2BKN A;  3JB9 k;  2W1B A;  2OEK A;  4EI2 A;  2GW8 A;  2Z2M A;  3HVR A;  4X4R A;  4EUV A;  3MEG A;  1S9G A;  3VEA A;  1VC0 A;  3OJU A;  3RW6 A;  1H38 A;  5A8W B;  1FWK A;  3I82 A;  3R5D A;  2XNQ A;  4NLG A;  3MD1 A;  5F8G A;  1IRQ A;  5KFA A;  2HPU A;  3KNA A;  3VGT A;  4TYB A;  1VMB A;  4AQY J;  3M2U B;  2UXB J;  4JV0 A;  1S6Q B;  1KQK A;  3V4I A;  1RTI B;  2XY6 A;  4CO2 A;  2FY1 A;  2VU5 A;  4YOE A;  4OX6 A;  5DJB A;  4OI1 A;  2IBK A;  4ZA1 A;  1MN7 A;  3SIP B;  4UTG A;  4QCL A;  3LUY A;  4FYW B;  3KLG A;  4RNF A;  4K0K J;  3U7J A;  1IKW B;  1NHK L;  4LT6 A;  3U1N A;  2KDO A;  2I0X A;  3TAP A;  3RBE A;  3DFE A;  1NXI A;  2FC8 A;  2HAF A;  2A18 A;  1RT7 B;  3S6E A;  2HFO A;  4C48 A;  3TVZ A;  3H4D A;  3MM5 A;  2RRN A;  1GMW D;  1CJV A;  3K59 A;  2DH9 A;  1IVZ A;  1LW0 A;  4KJI A;  3TAM B;  3UFC X;  5CYJ A;  2KG0 A;  1ARQ A;  2I5J B;  2CNN B;  2F65 A;  1RCX B;  3OHB A;  1S1W A;  4CO1 A;  2R7X A;  1NPK A;  2P6S A;  2GVZ A;  7AT1 B;  2HRY A;  1TL1 B;  1I94 J;  2CKW A;  2CIM A;  4I69 A;  3KK2 B;  1CC8 A;  3V6H A;  3IBW A;  2GAH C;  3J7A 1;  1WF1 A;  1Z4U A;  3LW5 C;  4RUA A;  3BS9 A;  4ZVH A;  4PPD A;  4DS5 A;  4EGL A;  3TAN A;  1N4L A;  1FT8 A;  3T6J A;  1FWL A;  2AGP A;  2CQI A;  3C6U B;  1DJ0 A;  4L75 A;  2JEG A;  2HWT A;  2B5J B;  2XGQ A;  2X1G A;  2QMX A;  3FRZ A;  1QLN A;  3UD4 P;  2BJ7 A;  2UUA J;  5K9F A;  1D8Y A;  3PX6 A;  3DGP A;  1HNV A;  1VCT A;  2HVZ A;  4ZVT B;  2BE9 B;  5L1K A;  4FXV A;  2FJX A;  2ZH6 A;  3AOB A;  5KT4 A;  1UKU A;  4E98 A;  3G8Q A;  1S97 A;  1J5O B;  4K7Q A;  1S49 A;  2VQE F;  3NBP B;  4IOB A;  2KVI A;  3BO3 A;  1D9A A;  3PNI A;  3RGI A;  3RAX A;  2ZBQ A;  4PCQ A;  5GVQ A;  1X5P A;  3B78 A;  2W7P A;  4ZLN A;  2BXJ A;  3BN7 A;  1Y0H A;  1RLD A;  3FEY B;  2R2R A;  3EXY A;  2VDI A;  1JIH A;  2HW3 A;  1NHU A;  1C2P A;  1K73 T;  1FJE B;  3EWG A;  4OI3 A;  3HJV A;  3WC0 A;  2F4V F;  5LXR A;  3HHK A;  2CQH A;  4RW4 B;  1UVL A;  2WTF A;  1UJ6 A;  2EC2 A;  4OLO A;  1OQ6 A;  1RT2 B;  1WOR A;  4KO0 A;  2VFS A;  4RW7 B;  2HGM A;  3A1Y G;  2C3M A;  3FFI B;  2ZC4 A;  3HX9 A;  4ECT A;  3GCX P;  5LL6 d;  2CQ3 A;  2B6A B;  1Q5Y A;  1FDN A;  2GGP A;  1HI0 P;  1Y3J A;  3BQ2 A;  1HBU A;  2DB1 A;  3BH7 B;  1VBK A;  1VK3 A;  4NXN J;  3EGV A;  3L7U A;  5DZ6 A;  2JFK A;  1QTM A;  5B08 A;  4H4O B;  3NCQ A;  5C42 A;  2HWI A;  1K8A T;  1S99 A;  4PWD B;  4C97 A;  1WTB A;  1NM2 A;  5KTQ A;  4ZHR A;  1WC0 A;  3MPV A;  3BQ1 A;  1CBK A;  1LWE A;  3T41 A;  2ZHA A;  4GVB B;  1RB0 A;  4NEZ A;  2N4D A;  1XMB A;  3G6Y A;  4FBU A;  2UP1 A;  2QFJ A;  3CJT A;  4OYW A;  3W65 A;  3AT1 B;  4GRS A;  2Q79 A;  3UI3 A;  1VR6 A;  1FWP A;  2HND B;  4OIX A;  5DM6 Q;  1Q16 B;  4RU2 A;  2JEF A;  1EIY B;  3MHY A;  4S0M A;  2C2N A;  2HNY A;  3ZZZ A;  2J9C A;  3R97 A;  4ZJQ A;  2XLK A;  2BX6 A;  1R3N A;  1Q8L A;  3L7O A;  3TVK A;  1MMD A;  3MAA B;  5CCL A;  1NME B;  1X8D A;  4CLK A;  1VQS A;  3RW7 A;  3HF5 A;  4DV4 J;  1EZZ B;  3R5A A;  3DU6 A;  3G96 A;  1JLG A;  2HHS A;  3M8Q A;  3NAH A;  2XG8 A;  1R43 A;  2V8D A;  4ED8 A;  2P9E A;  1NSP A;  1QE1 A;  3M7V A;  1HNX F;  5D8H B;  1FRK A;  5J2P B;  3R2C J;  2BRK A;  3FEZ A;  3I9V 9;  1S1X A;  2FVP A;  3GQC A;  1MML A;  2ADL A;  2DO4 A;  3R9L A;  1DTQ A;  4WK3 A;  3Q0A A;  1QVG R;  2JLG A;  5DRK A;  2UVW A;  3PW2 A;  2Z0G A;  2VKR A;  2IYG A;  3NMR A;  3UQS A;  1VRT B;  1FXL A;  3HSD A;  3GWC A;  4ZVP B;  2G2Y A;  1APS A;  4F2R A;  2LLZ A;  4PWW A;  2ACM A;  3POT B;  4A8X A;  5J1E B;  4NYO A;  4LVN P;  4CM0 A;  1C0U A;  4XIU A;  3T9Z A;  3ZZU A;  4LF9 J;  3GR0 A;  1G1X A;  3KG0 A;  1X4A A;  1N6Q B;  4OMF G;  2LQ9 A;  4U7C A;  3PCO B;  4Q7A A;  1XK8 A;  3JYT A;  2XZW A;  2HRT A;  5KFX A;  1N5Y B;  1HL6 A;  2QYC A;  1VQ5 S;  1ZH5 A;  1T3O A;  4ES2 A;  1FKO A;  5ETO A;  1XJW B;  1EA4 A;  3F41 A;  1YWX A;  1P94 A;  1TVR B;  4WBF A;  5HMX A;  3NCR A;  6AT1 B;  2XHC A;  1VQL S;  4KHR A;  4WZQ A;  4ED1 A;  4ZVO B;  1KKH A;  2Q1L A;  2AJ2 A;  3VCD A;  4LIW A;  1OY8 A;  3FRY A;  3S1T A;  1M5P C;  4B3S J;  2Q2K A;  3CC7 S;  3IRX B;  3FMT A;  2VH7 A;  1GEH A;  4WFY A;  4P6Q A;  2UUC J;  4WFN Q;  2AJQ A;  2VZ9 A;  2KH9 A;  2DEI A;  1HWK A;  2CQD A;  1EET A;  2KTQ A;  4JI1 F;  3R5J B;  2BAN A;  1KDN A;  3T1Y F;  3E8O A;  4UZC A;  2YKQ A;  2HKE A;  1UJ5 A;  2FZK B;  1S1U B;  3ILI A;  4LR7 A;  5L39 A;  2AJ0 A;  2W9C B;  3CJ5 A;  3MUR P;  4DSI A;  3OFG A;  3CUL A;  1A7G E;  1UVK A;  4FF1 A;  4P2S A;  4D3G A;  3BYR A;  2CG4 A;  3A8E A;  4USW A;  2BR0 A;  4IFY A;  1OPZ A;  2W9B A;  3CTR A;  4ZVS B;  1BQM B;  1SUQ B;  3H5S A;  3PW7 A;  2CQP A;  5T14 A;  1KTV A;  4DJB A;  4B3M J;  1HWJ A;  4ETZ A;  3H87 C;  4MKB A;  1VQ6 S;  1GX5 A;  2ZZN A;  3RAQ A;  1WHW A;  3HHL A;  2AP6 A;  2NLW A;  4JI4 F;  2DO0 A;  2R8G A;  1SC1 B;  1HD1 A;  2V94 A;  5J2Q B;  4NZ7 A;  1FRL A;  1LWC B;  2HIY A;  2MSS A;  4NAS A;  1RYR A;  3CGI A;  2KKE A;  4DL6 A;  3QO9 A;  3GIL A;  3MTJ A;  5D0R A;  3VZH A;  2K29 A;  5ETN A;  4EO6 A;  3KK3 A;  4PAA A;  3K2Y A;  1SQF A;  4UOG A;  1R8C A;  1F60 B;  2Y0B B;  3OLB A;  4K4S A;  4H4M A;  1E6V B;  4USH A;  2X3G A;  1YBA A;  3ET6 A;  4CLW A;  1X93 A;  3CJK A;  4PG4 A;  1YBT A;  2CPZ A;  3MI7 X;  2XMT A;  4MKA A;  3D6T B;  2XCA A;  3GG1 A;  1N32 J;  2FPH X;  5HJX A;  1VQ4 S;  2VPX B;  1UCN A;  2MHE A;  2EKN A;  4PXB A;  5ADZ A;  3QLH B;  4RL1 A;  3UN3 A;  3GYG A;  1G4C A;  4L6V 3;  1N48 A;  2PFF B;  1RWO B;  2EVZ A;  3Q8P B;  1U6Z A;  1S57 A;  1HPZ A;  1N0V C;  3HPO A;  1SJQ A;  4UOH A;  2FIU A;  2F7V A;  2UVR A;  4NA2 A;  1HNZ J;  4M8L A;  2MJU A;  2DNL A;  1N36 F;  4WFA Q;  4YEA A;  2VAS A;  1RT6 B;  3DOM A;  2YVS A;  4C8L A;  2KKH A;  2J76 E;  3G82 B;  1AW0 A;  4QWB A;  3B8H A;  3KHH A;  2ZWP A;  1F3F A;  2XMV A;  3QSI A;  5DZ7 A;  1KNZ A;  1YKW A;  3PR4 A;  3OV7 A;  1DBD A;  2LXI A;  2HWH A;  2Q66 A;  1E6Y B;  2CPH A;  3W9I A;  4DL3 A;  2JEJ A;  3T5H A;  1H2V Z;  5GMK a;  3CCE S;  3ADA C;  2GIQ A;  1PJ5 A;  2DPI A;  2GQC A;  3U27 A;  4DL2 A;  4K59 A;  4IG3 B;  1FE4 A;  2LXF A;  4DV6 F;  3OJS A;  2Z4P A;  5SUH A;  3MAQ A;  2W2O P;  2UXB F;  5KFZ A;  1UMJ A;  5FLX Y;  1ACM B;  4LR8 A;  4LSL B;  5KFK A;  2VG5 A;  2JC0 A;  2ZEJ A;  3AXM A;  4CLU A;  4I68 A;  1X9S A;  4KHP J;  3DLK A;  4IOC Q;  2O1P A;  1ARR A;  3QRQ A;  2FHM A;  4DBQ A;  2N3O A;  2DGT A;  2A6O A;  5HK4 A;  2V34 A;  1UP1 A;  4OJ3 A;  3MCN A;  3A3N B;  3R27 A;  2QV6 A;  2HS0 A;  4MKV A;  1RWW B;  3HVT B;  2MY8 A;  4WIQ A;  4K50 A;  4W4M A;  1FDB A;  3TA2 A;  4C11 B;  3ENQ A;  3JQJ A;  4DDF A;  4G1Q A;  5CCM A;  2ZIT A;  4OYI A;  3N01 A;  3TJA A;  4KB7 A;  4OZ3 A;  3MCM A;  4JYA J;  1RWX B;  2MGZ A;  3CJ4 A;  1S79 A;  3FZB A;  3LTO A;  4J9R A;  5BR8 F;  3MUT P;  2F9J A;  3DMJ B;  1JNR B;  1WOP A;  1OWX A;  4Y6I A;  3MFH A;  1CQN A;  5LSR A;  3M6U A;  3UNY A;  2GMH A;  5KFL A;  1MRO B;  2XB2 D;  4MFB A;  5KFP A;  1GK8 A;  1SC4 B;  2W25 A;  1XMQ J;  1M5K C;  3NMA A;  2R8I A;  3RJM B;  4LF8 F;  2XC9 A;  1P9Q C;  2YKO A;  5KFE A;  2R3V A;  4DQR A;  4O44 A;  1JLE A;  4LRA A;  5J2N B;  4UZB A;  1T8E A;  3CC2 S;  1G2E A;  1AUD A;  3OVB A;  3IWL A;  4HTJ A;  2HVH A;  2QRR A;  3KHL A;  2VBY A;  2VF3 A;  4ZIV A;  1ZZF A;  1MYK A;  3PEH A;  3BDP A;  2KM8 C;  1IQZ A;  1VRU A;  2QFI A;  2DIV A;  4ZCL A;  4I56 A;  2XSF A;  2CPE A;  4LSN A;  2OPQ B;  4I0W A;  1MMN A;  4F26 A;  3M6X A;  3P96 A;  3O44 A;  1YRT A;  3QMQ A;  1GX6 A;  1YI2 S;  3LAN A;  1VS3 A;  2R2U A;  2W4D A;  3BB5 A;  1VQY A;  2WB4 A;  4RWW A;  1HR0 J;  5HSP A;  3M8P A;  2AU0 A;  3E3X A;  5LOQ A;  4ZLL A;  9RUB A;  3PJX A;  2DY1 A;  1N33 F;  4F8R A;  4B3R J;  4F0K A;  4I2Q B;  4EMD A;  1UJ4 A;  2B9X A;  5HLF A;  3CCW A;  2MZQ A;  3W8P A;  3PV8 A;  4NXN F;  3SCJ E;  1RWV B;  2BA9 A;  1ELO A;  3M8R A;  1U9P A;  4NLU A;  2OPP B;  3J81 U;  5KFG A;  2M0G B;  4LJM A;  3D2W A;  1YVF A;  3NNE A;  4DV0 F;  2B0G A;  1R8P A;  4AXI A;  4PPZ A;  1JLC B;  3I31 A;  4C98 A;  5MAO A;  1L3V A;  1PYT A;  1RTZ A;  4MT1 A;  1H7W A;  1X60 A;  2E1P A;  3JSB A;  3RBX A;  4ED6 A;  2DNY A;  4PUO B;  1RSC A;  1TU0 B;  4QIV A;  3HM9 A;  2PSZ A;  2ALY B;  2G2O A;  1B4S A;  2JLF A;  3RB4 A;  5AJ3 F;  1TKZ B;  4URS A;  2YNF B;  3MM9 A;  3H98 A;  1NDL A;  4ME7 E;  3R6L B;  1XNR J;  1XR5 A;  5C24 B;  4Q45 A;  2LDY A;  2ZH7 A;  1GTH A;  3H7H B;  4DR6 J;  2B51 A;  2AEF A;  1QDU B;  4O3Q A;  4KGM A;  1G7C B;  1F2G A;  1EAR A;  1MU2 B;  4B3O A;  2G0J A;  3BBF A;  4MJW A;  4I6W A;  3R5C A;  2HG4 A;  3VEB A;  2BOA A;  5JXS A;  4A8Q A;  3ZNJ 1;  1U0H A;  3R5B A;  3GON A;  2V4J A;  1OYD A;  1Q5V A;  2F4F A;  3HUL A;  2QTW A;  1RGV A;  4XO0 A;  4OI6 A;  3UCZ P;  1JKH B;  1YZ7 A;  3J7Y I;  4OZJ A;  4ZVF A;  1ZM4 A;  5LJ5 Y;  2UV8 G;  3HFK A;  1HQE B;  2NYH A;  1BLU A;  3LGN A;  3OTB A;  5K8N A;  1U8S A;  4F02 A;  2DTJ A;  2VON A;  1T03 B;  2ZOG A;  3A3P B;  5ETM A;  3OTO F;  1LXN A;  3KMS A;  2CJX B;  1KLM A;  3TO8 A;  1K0T A;  4K4U A;  2MTL A;  4Y3C A;  4WYW A;  2RT3 A;  2LQB A;  3UDE A;  2CJB A;  4JB8 B;  2FJA B;  2EPI A;  4EEY A;  4I67 A;  5DGB A;  5DLG A;  3P3D A;  1AB8 A;  3JSM A;  1ZBT A;  3UVJ B;  1SJR A;  4HAC B;  3PKY A;  2YKM B;  4LF7 F;  4MTP A;  4URG A;  5ETQ A;  2VV5 A;  4DX8 H;  2W8L A;  1JLQ A;  1LFP A;  2AV5 A;  4HHJ A;  4WTO B;  5T41 A;  5MLC V;  4QOT A;  3R1H A;  4O3P A;  4NOH A;  3KLI A;  3PFE A;  1KOH A;  4I2P B;  5A8R A;  1IUJ A;  1FX2 A;  4KGV B;  1J5E J;  1D09 B;  3MMC B;  2BAB A;  4A46 A;  4A8K A;  3O5T B;  1Q8B A;  1NHV A;  2GO9 A;  2V8P A;  3SQO P;  3NEK A;  4YB6 A;  1SC6 A;  5G4D A;  1FNO A;  4ED4 A;  3M9M B;  4OZ5 A;  4NRT A;  4YB5 A;  4IKA A;  4R0J A;  4YUD A;  3AA9 A;  2MZT A;  2VQF J;  3H90 A;  4B17 A;  4G65 A;  3MM8 B;  2Y1R I;  2BRL A;  4IO1 A;  2YH0 A;  2AY0 A;  3TP2 A;  4G1P A;  4A8O A;  3ZFV A;  1M0S A;  1G3O A;  2Z2L A;  2EC0 A;  1NCL A;  2D3U A;  4IH7 A;  1RT1 A;  3PYD A;  5A76 A;  2ZJP Q;  4QW8 A;  1PYO B;  4DOZ A;  4DV5 F;  4CLY A;  3RBD A;  2BV3 A;  4ANE A;  4KFB A;  1S4E A;  3KLE A;  2XQC A;  1FKP A;  1N34 F;  2YWW A;  4I4B A;  3OSP A;  3EPG A;  2DGO A;  2J7W A;  2BYC A;  4TY9 A;  3OR1 A;  1EB0 A;  5BYR A;  3DRP A;  2UUB J;  5C2G A;  2WZ1 A;  3MEE B;  1FDA A;  3NNH A;  1V3R A;  2D41 A;  2WVB A;  3HCX A;  3M30 B;  4OV1 A;  4P72 A;  4LFC J;  2DJW A;  1JNZ B;  1JJC B;  3T9N A;  1RXO B;  1ZZN A;  2WOM B;  4M5I A;  3K0J A;  4DR2 F;  2W9A A;  4LF6 J;  4MK9 A;  1NK4 A;  3BZQ A;  2FYX A;  1CG2 A;  3LH2 S;  4RUH A;  1FRH A;  2MB0 B;  4QPT A;  4ZVQ B;  1XBW A;  2LU2 A;  2XLI A;  4O4R A;  1PAE X;  4CYU B;  2OIH A;  3DLE B;  1NU4 A;  3SEO A;  4IH5 A;  3H42 A;  2JOQ A;  4ECQ A;  2IA0 A;  2V4Q A;  3K5L A;  1NRK A;  2G0C A;  1RT3 B;  3OXF A;  5AE2 A;  3P8B B;  3GXQ A;  4CNY A;  3CDW A;  2XMJ A;  4NA3 A;  1TL7 B;  4IR1 A;  3HFZ B;  1NBE B;  5CHC B;  2YKP A;  5D4O A;  3CF5 Q;  4ZPW R;  1NDC A;  2M88 A;  3MEC B;  1R0C B;  1W26 A;  4UF4 A;  1YJV A;  2WSE C;  3DRS B;  3MR5 A;  3BSO A;  3WHI A;  3QIP B;  1JLF A;  1SH0 A;  4C8Y A;  3VAK A;  3PYF A;  1SIZ A;  3N5B A;  1LKZ A;  4U7U K;  2Y1J A;  4DV7 J;  1LV5 A;  2OPR B;  3UCU P;  3QGP A;  5HQL A;  3DGV A;  2A2C A;  2DCL A;  4USV A;  3O8W A;  1IBM J;  2CQ2 A;  4RLE A;  2O66 A;  4CIO A;  2C2D A;  4PXE A;  1CJT B;  2VPZ B;  2JEI A;  4PG7 A;  1MNE A;  4K5S A;  5LXY A;  2ZH3 A;  2HMI A;  2EFP A;  3MPU B;  2ROP A;  3QZ7 A;  2B9Y A;  1FDD A;  5DDR C;  3BQ0 A;  2SXL A;  3SCL E;  3D54 A;  2XS5 A;  3MPY A;  2CQB A;  4K5R A;  4Q2M A;  3NNA A;  2JX2 A;  1U2F A;  5LMU J;  2QEX S;  2IHR 1;  5F41 A;  1Y11 A;  4Q8E A;  2CQG A;  3Q89 A;  1VDH A;  2FDN A;  2H1O E;  3THP A;  4BC7 A;  4LF1 A;  3FK4 A;  4RBU A;  4RW8 A;  4O3N A;  2F40 A;  2GZO A;  2CPF A;  5F0U A;  5CYM B;  3LWM A;  3W2V B;  4YME A;  2AN7 A;  2MKS A;  3R1L A;  1QSS A;  3C46 A;  3GIK A;  3A8I A;  1OJ4 A;  2FZG B;  3V2U C;  3NS7 B;  2EEY A;  2OH2 A;  3WX4 A;  1DLO B;  2KOE A;  2ZH5 A;  4OJ1 A;  3CD6 S;  3D3B J;  1IM4 A;  4DEZ A;  1S6U A;  2XYP B;  1U8W A;  2GQ2 A;  1ROF A;  1WG5 A;  1SQG A;  2FVQ A;  2RJZ A;  4JI7 F;  3GFY A;  3AQP A;  5U47 A;  4CTA B;  3QZ8 A;  2KN4 A;  1Q95 G;  4NZ0 A;  1FNM A;  2ZH1 A;  4DG1 A;  4WKY A;  2DGX A;  1S6O A;  4ZP8 A;  1VJQ A;  1YJU A;  2O3D A;  4OZL A;  4WU3 A;  2L48 A;  4AAI A;  2B9E A;  4DV1 F;  3ENV A;  4JI3 J;  3M9O B;  5HRO A;  4GO7 X;  1RYS A;  4EU0 A;  2R9L A;  4V19 X;  2LKZ A;  3SDE B;  1NLK L;  4AL6 A;  4FKY A;  1IBK J;  1N5T A;  1EQM A;  2GC8 A;  4TY8 A;  5HVH A;  4LFB F;  2FJV A;  3N6N A;  3NS5 A;  3MOZ A;  4EYH B;  3K58 A;  1VHI A;  2J5A A;  1WEZ A;  2V5H G;  3IWX A;  4ID5 B;  1LW2 B;  2Y1I A;  4X4Q A;  1GMW A;  4F4Y A;  4DSF A;  1RWM B;  2IVF B;  2H54 B;  3V81 A;  2JXH A;  3R8Y A;  2PA8 D;  4OL8 A;  3MR3 A;  3GZ7 A;  2J0X A;  2E1R A;  1NZ8 A;  2X1A A;  2L9D A;  2WSC C;  3OBI A;  3C2P A;  3RTV A;  1ZAX A;  2AYE A;  4DL4 A;  2KJV A;  3VHQ A;  4NML A;  1NK9 A;  2M4M A;  4Y28 C;  1T11 A;  2HVD A;  5H9E K;  3MM7 A;  2YWF A;  3ZZP A;  3IBF B;  2V63 A;  6FDR A;  2ADC A;  3UCG A;  2YQ1 A;  4NLD A;  3FBF A;  2MKJ A;  4R5P A;  5EUH A;  1KVI A;  2OSQ A;  4OHW A;  4HEA 9;  3D0I E;  4O4G B;  4NCG B;  5KFU A;  4GKJ J;  2RQ4 A;  1RKJ A;  4PR6 A;  4IUF A;  4KV8 A;  3UW1 A;  1AZS A;  2RIL A;  3I56 S;  3EXC X;  2W2P P;  3LP0 B;  3M1V B;  4Y2C A;  3D67 A;  3HVW A;  2E5G A;  1PJ7 A;  2CQC A;  3LP2 A;  2AYB A;  1IM6 A;  3EMT A;  1C1C B;  4GKK F;  1H2U X;  1LNQ A;  2UZA A;  1XMO F;  3C3L A;  3FMW A;  2EK6 A;  1M1K T;  2DCU B;  3UWT A;  1HBM B;  4B9U A;  1F5B A;  4DV3 J;  4YY3 J;  2Y8W A;  2ZD1 B;  2JNJ A;  2AJ4 A;  3OVA A;  2VG6 B;  1FRJ A;  3HHL C;  3CCZ A;  1JLA B;  2KO1 A;  2BJ8 A;  4DX5 A;  3NOG A;  5ETT A;  2C2Z B;  1B0V A;  2VB6 A;  4ZOS A;  2RKI B;  5IM0 A;  3KLF B;  2O67 A;  5D78 A;  4CO4 A;  3W9J A;  2AKW B;  4GC7 A;  4PQA A;  4DU7 A;  3C66 A;  3US5 A;  4DR5 F;  3QWU A;  3TUP A;  3W5Y A;  5KFB A;  1Q8K A;  1T0T V;  3I0R A;  3A13 A;  2K1O A;  1PIE A;  2OPS B;  4FF3 A;  5B0C A;  3KHG A;  2AEM A;  3DOK A;  4WKR A;  3C15 A;  3IAS 9;  1C0T A;  3FEX B;  2BEF A;  3TZY A;  1IQT A;  1O51 A;  1NKB A;  4NLV A;  3MED B;  2DRB A;  2YX1 A;  3ENW A;  4DXL A;  1PJ6 A;  2BVZ A;  5BJR A;  2ACY A;  2I9S A;  1H72 C;  2HVE A;  1KSP A;  1FA0 A;  4A4J A;  3I87 A;  3PDN A;  2RB7 A;  1U47 A;  2NXN A;  4DPO A;  1SKU B;  1VK8 A;  3HFV A;  2IAJ B;  2VBX A;  2FVS A;  1U2C A;  5THW A;  2GS8 A;  4ZN3 A;  2HBZ B;  4WPA A;  2HQD A;  1Q82 T;  1X5S A;  3K57 A;  1FJG F;  3GE9 A;  3HHE A;  2BDP A;  3BPS P;  1S9E B;  3D6M B;  4FNH A;  2PE8 A;  2ZBR A;  2VG7 B;  3BGU A;  1BQX A;  1FK9 A;  3GTY X;  3IRW P;  2XI3 A;  3CJQ A;  1U24 A;  5D3G B;  3LA0 A;  2P2C B;  3HZG A;  4WE1 B;  4F04 B;  1F3V A;  1PBU A;  4RO0 A;  2CZ4 A;  3I5C A;  2UXD F;  2R7O A;  3GV8 B;  1RI7 A;  4ZDN A;  5E7O B;  3LOU A;  4ZJL A;  3IG1 B;  4FBT A;  3DI6 A;  1Z2Z A;  5CAB A;  4EYI B;  3KLH B;  1U1N A;  2E9Z A;  1R8A A;  2YTC A;  2KT3 A;  1K0V A;  1W7W A;  2XYG B;  5KFV A;  1WWH A;  3NL0 A;  4HH0 A;  2NS1 B;  1Y5N B;  4HHU A;  1CJU A;  8RUC A;  3LAK A;  4RR5 A;  3TAR A;  1I1G A;  1P1T A;  4NZ6 A;  2IDE A;  2ZKU A;  4WP8 A;  2KB2 A;  2RUG A;  2XSJ B;  2R7R A;  1L3T A;  7FD1 A;  4DV2 J;  5I4M A;  1S12 A;  1YX2 A;  3GFX A;  3GMG A;  5HO4 A;  1HQ2 A;  2XZT B;  2MXY A;  4OZ2 A;  3C6T B;  2ERR A;  3X1L B;  3R7B B;  4JI6 F;  4KGK A;  1SV5 A;  3JXO A;  2OML A;  3ZZO A;  4JV5 J;  5KT2 A;  5G0R A;  2QT7 A;  1D9F A;  2OSR A;  2KXF A;  2AGO A;  2C2O B;  4LF2 A;  2AZ1 A;  1U1R A;  4QIE A;  1WKK A;  4C8O A;  2BUN A;  3WX8 A;  2E7V A;  2KFY A;  2MKC A;  3J7Z 5;  3KJF B;  3WIU A;  3ZTO A;  3MPW A;  4C3M A;  1HBN B;  2GFF A;  3GSI A;  2AWZ A;  1UTA A;  4CO0 A;  5IWA J;  4JI0 J;  1AUS L;  5DG8 A;  4LFC F;  2GNK A;  1D3W A;  4N56 A;  2KXH A;  2HBY B;  3SCI E;  2A2B A;  4UT4 A;  2BJD A;  2HNZ B;  4DR4 F;  4RW9 B;  3DRY A;  2RF2 B;  1WKJ A;  2HHV A;  1NAQ A;  2LDI A;  1VOM A;  1RLC L;  3RBZ A;  2CRL A;  4P10 A;  2XEX A;  4PQU A;  3HT3 A;  3I4H X;  4Z2X A;  1IN0 A;  4OQJ A;  2OEJ A;  4HDH A;  2JLE A;  2M7S A;  1UFW A;  2KRR A;  5M2U A;  4WTY A;  4DR7 J;  4QR0 A;  2JHE A;  2QA2 A;  5F8N A;  4NCA A;  3N6M A;  3OR2 A;  3G5O A;  4CWB A;  1WI6 A;  2XNR A;  5EWF A;  2G0I A;  2DPJ A;  1T05 B;  3IC1 A;  4J9U E;  5B0A A;  4NCB A;  1S6P A;  4P75 A;  1RTD B;  2CDQ A;  3SSS A;  3HKZ D;  5LMN F;  1RAD B;  4DWI A;  4MIW A;  4UST A;  1NB7 A;  4MIB A;  4CM2 A;  2V2Z A;  4EK2 A;  1I6J A;  2H4Y B;  3G2X A;  2ZE2 B;  3ENA A;  1HMV A;  1YIJ S;  1U1K A;  3CIZ A;  5A0Y B;  3DRX A;  2X1B A;  1CSJ A;  1T3N A;  2GJ2 A;  4OJH A;  5IZH A;  3PAC A;  4ZP7 A;  5KG3 A;  4QYZ K;  2D9P A;  5KFH A;  4IOA Q;  4RNO A;  3M9N B;  5CYQ A;  4BHQ A;  4LRB A;  2YNH B;  4DSL A;  2CPY A;  2HRU A;  4LBP A;  3BJY A;  3GIR A;  1MSW D;  1KP6 A;  3H2L A;  4PQU B;  3I96 A;  1DRZ A;  1D1U A;  5IQ6 A;  3BEG B;  4L74 A;  4NLX A;  5A8K A;  4CT8 A;  2J9E A;  1PBA A;  3EE3 A;  2J0S D;  3M2V B;  1D9D A;  3K5M A;  3QJL A;  2H51 B;  1LFW A;  1WC3 A;  3QT6 A;  2NYI A;  4DX7 A;  3C14 B;  3CED A;  3H4B A;  3MMJ A;  4IFV B;  1MWQ A;  1SKW A;  3PW0 A;  3VGV A;  4ECX A;  1L3K A;  2AJF E;  1RTJ B;  2JXG A;  5EGY A;  1BC6 A;  1RA6 A;  4C8N A;  4ZP6 A;  2DEJ A;  2ASY A;  4ILL A;  4LBI A;  2ASJ A;  5FDL A;  1PCA A;  2HZV A;  2DR7 A;  1DAX A;  2EFQ A;  1B01 A;  1TV6 A;  3PIO Q;  3G9C A;  2DNQ A;  1FVS A;  3PEJ A;  2RS8 A;  3ZZY A;  4MYT A;  4ES3 A;  4Q0B A;  5HP1 A;  2RU3 A;  2RIJ A;  2HHH F;  2ZVI A;  2UXC J;  2X7I A;  3HMJ G;  2GAG C;  5B0D A;  4WXO A;  4XPE A;  4L3N A;  4K4Y A;  2OUG A;  2QJ3 A;  2JH3 A;  2CVI A;  1NK0 A;  5I42 B;  4LF5 F;  2ZZT A;  2CAX A;  2GIF A;  3HD2 A;  5IS2 A;  3DLJ A;  1RUS A;  5H9E J;  1EAY C;  5KFN A;  1BMQ B;  1REG X;  2NR0 A;  2IPO B;  1XNQ J;  1RTH A;  4M5M A;  2KFN A;  2HQC A;  2H48 B;  2MMY A;  4DUZ F;  1SB6 A;  2HHU A;  2ZH9 A;  1AFJ A;  2YKA A;  2X3D A;  5IC6 B;  4P7V A;  5HI7 A;  1EQ0 A;  4ECR A;  2ZHB A;  2YNI B;  2YKN B;  3RB3 A;  4X65 J;  2EI5 A;  4QR1 A;  1UVN A;  2LEA A;  2JL9 A;  2Y3Y A;  2ZBC A;  3AJD A;  2F8H A;  2WSF C;  4K2J A;  4PXC A;  3DOL B;  2QSF A;  2DKO B;  3IO1 A;  4KH1 B;  1M5O C;  3R7N B;  4C3K A;  4NI2 B;  2E44 A;  5C25 B;  3NXZ A;  4B3T J;  3TUI C;  1HYS B;  4M63 A;  1F9E B;  3ULH A;  5I3U A;  4DPU A;  3BV8 A;  3KJQ B;  1EX8 A;  1Q4R A;  3ZTP A;  2PN6 A;  2W2M P;  4A8M P;  4FP9 A;  2EBG A;  3GLJ A;  1S76 D;  1TAU A;  4YB1 P;  3Q2S C;  2HFS A;  3WC2 A;  1NSQ A;  5K14 B;  3MM6 B;  2GVD A;  2IMO A;  2IFX A;  3SFG A;  2HAI A;  3UN5 A;  3AA8 A;  1JX4 A;  1U02 A;  3CDE A;  4DR3 F;  3SMZ A;  3FDS A;  4AL5 A;  4UY8 5;  2E5L F;  4WYL A;  3RR7 A;  1SL2 A;  4RNN A;  2R7W A;  1FO1 A;  3PM9 A;  1S5Z A;  5DQH A;  4IDK B;  2FHK A;  3R2D J;  4UOF A;  4TQS A;  2LXU A;  3TJ9 A;  4JV2 A;  2I2Y A;  3IGN A;  3JTO A;  1Y4Z B;  5KFI A;  4DLG A;  5KT7 A;  1WDT A;  1TL5 A;  4DPY A;  1S9F A;  2UU9 J;  1FES A;  2V69 A;  5A8W A;  2YNG B;  1R6V A;  4MH8 A;  3C16 B;  1GXU A;  4FYD A;  4ERD A;  2KZZ A;  3CT9 A;  3H2V E;  2ZJQ Q;  3M2U A;  1R8B A;  1LWX A;  4X4T A;  3VZI A;  4PZV A;  2JXI A;  1S6Q A;  1TKT B;  2KL8 A;  1GXT A;  1RTI A;  4Y0F A;  1O5J A;  3BGO P;  1RK8 A;  1CPZ A;  1QSY A;  4X62 F;  5L46 A;  2RBF A;  2Q3P A;  3O2I A;  1ULR A;  3NS6 A;  3TYT A;  3P45 B;  3VGU A;  1IKW A;  3CXC R;  3W2W B;  3CCV S;  3QJJ A;  5HBM B;  4X4N A;  4X64 J;  2BZ2 A;  3KJV B;  5A2Q Y;  2GHV C;  4F4K A;  3V4M A;  2YY3 A;  4H54 A;  3EVO A;  1F2H A;  3T19 A;  3CVK A;  1RT7 A;  3K7R A;  5J1N A;  4LRE A;  2ILZ A;  3L7P A;  4LQ3 A;  3DM2 B;  2ZM6 F;  2BSQ E;  5IT0 A;  3MTK A;  3KDN A;  3OXL A;  1T9Y A;  2G1D A;  5K8O A;  3TAM A;  2I5J A;  2PI5 A;  1TL1 A;  1WOS A;  3KK2 A;  3M6V A;  1UEU A;  5F8I A;  1Q79 A;  3VQT A;  4HHH A;  5J2M B;  2VUG A;  4YR2 A;  3JSR A;  1NEE A;  4OX9 F;  3DHX A;  2ILY A;  4OYO A;  4CCH A;  4QW9 A;  5FII A;  3T6B A;  3QFH A;  3C6U A;  1TL3 B;  1C1B B;  3K5P A;  3F44 A;  4R8U B;  3J81 j;  4KKO B;  5HAT A;  1JLB B;  2B5J A;  1N56 A;  3W8G A;  3SQG B;  3M32 B;  1VLY A;  3MR7 A;  1FRM A;  5F8M A;  5LM7 E;  1QSL A;  5DDP C;  5JMN A;  3GU0 A;  4CRJ A;  2BE2 B;  1J5O A;  2V50 A;  4ICL B;  2MZS A;  5DM7 Q;  1R7I A;  3NBP A;  1CQM A;  5FD1 A;  2RDI A;  4CLF A;  1YJR A;  2AJ1 A;  1U25 A;  3CJ0 A;  4WJB A;  4F2S A;  1Q53 A;  2IC3 B;  3WZ0 A;  5K8P A;  4V19 J;  4ZLP A;  2LQ5 A;  1LOU A;  4ZS6 A;  1PAU B;  1B0T A;  1H6K X;  2E5H A;  1HNW F;  4EBD A;  5B0F A;  2Z58 B;  3MF5 A;  1KFD A;  2B4V A;  1WHX A;  1R31 A;  3VWS A;  1IJE B;  4RW4 A;  1SCJ B;  3N79 A;  3FSX A;  1UVM A;  3LQV A;  1RT2 A;  2VBW A;  5IOL A;  1ARO P;  2FJD B;  4KHM A;  4RW7 A;  4K4Z A;  1S10 A;  2OMO A;  2J7K A;  3FFI A;  1RCO B;  3ILO A;  3AFG A;  2B6A A;  4I7F B;  1R8H A;  3R6G B;  4CH0 S;  4O3S A;  5A6W A;  1FHT A;  2GJF A;  3PFO A;  5K20 B;  1KQF B;  4DUY F;  3LPE A;  2NCK L;  5AXM A;  4NXM J;  5C7P A;  2WAQ D;  4H4O A;  1FI4 A;  2ATC B;  1YQH A;  1RWP B;  2HS4 A;  3MEK A;  3ETM A;  4PWD A;  1O0P A;  3W5X A;  3PHE A;  4IRC A;  3JSY A;  2V9K A;  2RHQ B;  3J7Z T;  1B64 A;  1BE4 A;  2DNO A;  2FLL A;  4GVB A;  5H1S V;  4X66 F;  3NGD A;  3Q83 A;  3SSQ A;  1WTF A;  2UVU A;  2EXU A;  1ZAV A;  2YQ0 A;  2OFH X;  1KLN A;  3UNG C;  2HND A;  2RVJ A;  2W7O A;  3G4S S;  1Q16 A;  1N0U A;  2PMH A;  3TJ8 A;  1GMV A;  1RHQ B;  2MEW A;  4CDI A;  2E29 A;  4DU8 A;  2BOP A;  1C4A A;  3GJS B;  4ALZ A;  3TUZ C;  1H2T Z;  1M1G A;  3FSY A;  2PC6 A;  3K5N A;  4HTI A;  2GX8 A;  4R25 A;  3D0H E;  1KR4 A;  3MAA A;  1QUP A;  3DYA B;  1YDL A;  5GAD U;  3UDL A;  3M2R B;  5B0E A;  1YG0 A;  2OHD A;  4HT5 A;  2NSB A;  1U45 A;  3L3C A;  1TP7 A;  4MJK A;  2J8A A;  4PXD A;  4YHH F;  4QYZ J;  2V2V A;  5J2P A;  3ETO A;  4M95 A;  2QLF B;  2AX1 A;  4CH7 A;  1ZM3 A;  5E41 A;  1BQN B;  3LP1 B;  4A8W A;  3P5T L;  4OYA A;  2H5E A;  3B4M A;  1SH3 A;  2KZM A;  1RJJ A;  4LFA J;  4DR1 J;  1HNI B;  3H5X A;  1VRT A;  4F4A A;  2D74 B;  2KT2 A;  4BC9 A;  5BYS A;  2OD6 A;  2U1A A;  1V5I B;  4AE5 A;  3POT A;  2LA4 A;  4OX7 A;  2IJF A;  5J1E A;  3THT A;  4HR2 A;  2AT1 B;  5KFY A;  1LK7 A;  3U1L A;  2XMA A;  2UUT A;  4N41 A;  3J80 Y;  1N6Q A;  4G1I A;  1RT4 B;  1SJ1 A;  3WIV A;  4RW6 B;  2FHJ D;  4ZPV R;  3CW2 C;  3H59 A;  4A47 A;  5BXI A;  3EJM A;  4NLT A;  4G6V B;  4B9L A;  4ZCM A;  2YBV A;  1UL3 A;  2ALZ A;  1T9U A;  1N5Y A;  4KQZ A;  1KQS R;  1U1P A;  3AHP A;  1N52 B;  4QU6 A;  1RWN B;  1SPB P;  3CDU A;  1TVR A;  1YIT S;  2DR6 A;  2JWN A;  5GAG U;  3D6F B;  1KN6 A;  3RB6 A;  1TFW A;  2F63 A;  3BSN A;  1F9F A;  4P74 A;  2FJW A;  4C8Z A;  4JBC A;  3IRX A;  3CD0 A;  4YFU A;  1NSK L;  2A1B A;  4ER8 A;  4QWE A;  2XI2 A;  3BH6 B;  3PG9 A;  3TA0 A;  2EFN A;  1SQE A;  1RAB B;  3ELH A;  1S1V B;  2VBZ A;  2Z57 B;  1PG5 B;  5KFQ A;  1ZM9 A;  2MJN A;  3AQO A;  1YJ9 S;  1RAE B;  1S1U A;  1WHV A;  2W9C A;  1FD8 A;  5KG5 A;  2C2K B;  1GQE A;  2LVW A;  3PY8 A;  4MMO A;  3A12 A;  4WK1 A;  4RUC A;  4RU9 A;  3I0S B;  4CO3 A;  1Q8I A;  1K44 A;  3V6K A;  1GT8 A;  2B9W A;  2BA3 A;  3CME S;  4JI5 F;  1BQM A;  3CCR S;  1SUQ A;  2IIH A;  4C3L A;  4P71 A;  4ZJO A;  3BGR B;  2UVV A;  2DHA A;  3SXL A;  1X4E A;  2R2T A;  1IKY B;  2FLP A;  2VC0 A;  4DN9 A;  4OHZ A;  1FX4 A;  1S0M A;  1ITP A;  1R6Y A;  2PO4 A;  3E51 A;  1LXJ A;  4J91 A;  3P4U B;  4DX6 A;  5J2Q A;  5HVF A;  3VR1 A;  3ZZ0 A;  1UW4 A;  2ZJR Q;  4XAK A;  1LWC A;  3B4D A;  4J9O A;  4OYZ A;  5E0O A;  5KOW A;  2PMW A;  2ZNY A;  5CD4 A;  1JXE A;  3OUY B;  3HLU A;  3QFW A;  4JI8 F;  2Z56 B;  4QBU A;  1S4F A;  1BDT A;  1QAI A;  3Q23 A;  4X4P A;  1SL1 A;  2E1A A;  3GFZ A;  2VA2 A;  1R0A B;  1BD6 A;  2KEL A;  1FTR A;  3D6H B;  3FMB A;  2VQE J;  4W98 A;  2P8I A;  1UA1 A;  2DNK A;  3HSZ A;  2CZV C;  1SJF A;  5D0H A;  1QM9 A;  1IR1 A;  1E6V A;  2DR5 A;  1Y10 A;  1CUL B;  3ZNU A;  1VQ8 S;  1HBO B;  4BWM A;  4K4V A;  2F4V J;  1FVQ A;  1TKX B;  1X5O A;  4J9S A;  2R2S A;  2AX0 A;  1NDK A;  3DRR B;  3KYL A;  1LEO A;  2HK3 A;  3QLH A;  2CPG A;  1WNE A;  3HKW A;  2C2E A;  2J7U A;  4IG0 B;  4FXD A;  3M6W A;  4B9M A;  1T9T A;  2VIH A;  4RBV A;  2QLW A;  4CO5 A;  2DGQ A;  4BBY A;  1WHY A;  1R89 A;  2RD5 C;  3T1H F;  2CNO B;  2XZD B;  4LF4 F;  3CD5 A;  5KT5 A;  4YR0 A;  1WSV A;  3TUJ C;  4KTQ A;  4UY8 T;  1RT6 A;  1HWI A;  3G82 A;  3DHW C;  1RU1 A;  3MUV P;  1HQU B;  3UD3 P;  1TL4 A;  2PI4 A;  3OD2 A;  2B7B B;  2V8G A;  3FVY A;  2QN6 B;  2AHO B;  1SL0 A;  5JVG Q;  3G8S A;  2W7A A;  1M5S A;  2BW7 A;  4RNM A;  5AE1 A;  1FEH A;  4W92 B;  2HGL A;  1E6Y A;  4H4K A;  2OTJ S;  4K8R A;  4YDD B;  5DQG A;  3VAI A;  2JDJ A;  4C7Q A;  7FDR A;  3GIJ A;  3ZTS A;  5D4P A;  2L08 A;  4IG3 A;  4DL5 A;  3T5L A;  4ZLJ A;  1LWF B;  2CPX A;  5KG1 A;  1YJN S;  2FY8 A;  2E1M C;  4J7C A;  2ASD A;  4ECU A;  1FD2 A;  2CVE A;  3UO0 A;  1RT5 B;  5GAE U;  1U0S A;  2VPW B;  4NEY A;  4KY3 A;  4LSL A;  4EWT A;  3SCK E;  4ZVU B;  1JJ4 A;  4E2F B;  2X1F A;  3E01 B;  4FF2 A;  2RU9 A;  1HNX J;  3T3F A;  1HLW A;  4ETX A;  4LRC A;  2D7S A;  1V5V A;  1YJT A;  1X31 C;  3BGF A;  3HVT A;  4JI2 F;  2MYF A;  4IR9 A;  2C1E B;  4C11 A;  1F1B B;  1Y5L B;  2EFV A;  3DLG B;  2DY9 A;  4B9N A;  1OHN A;  3CC4 S;  3NGK A;  3I5A A;  2MDA A;  3Q8S B;  2OJ3 A;  2EFO A;  2ZFH A;  3IM8 A;  2M8D B;  4CP5 A;  1JQG A;  1MWZ A;  2Y9H A;  3GV7 B;  3DMJ A;  1NH8 A;  1XER A;  4Z7C A;  5FLX U;  4J9L A;  3V5R A;  4X2B A;  1SIW A;  1MRO A;  5AE3 A;  1FJ7 A;  2DXD A;  1RDR A;  2NXJ A;  4EZ6 A;  5F9L A;  2AYG A;  3MFI A;  5F8H A;  2AQ4 A;  3G71 S;  2CDR B;  1VC5 A;  1SJ3 P;  5CD4 H;  4L3K A;  1S0O A;  2MST A;  3QWP A;  1YRU A;  3MMA B;  2R8J A;  3FBB A;  5DG7 A;  4AQY F;  4ILM A;  1HW9 A;  3KG4 A;  2LEP A;  1M5H A;  2XTJ P;  3OFE A;  5HMY A;  3OTE A;  1OSD A;  4E8U A;  5J2N A;  5CZV A;  4IRK A;  5LSO A;  1VGY A;  3EVM A;  3T5J A;  2CPD A;  3LO3 A;  2W01 A;  4DQI A;  2ROE A;  3L09 A;  3TX0 A;  3H5U A;  4K0K F;  3BRE A;  3I5B A;  2IJR A;  4JI1 J;  3BKU A;  1WC6 A;  3TZZ A;  3T1Y J;  1X4D A;  2HFZ A;  2KVQ E;  5HQM A;  5L9N A;  2FTR A;  3Q8Y A;  1EP4 B;  1UEV A;  4QJV A;  2OPQ A;  2AD9 A;  1X9M A;  3MD3 A;  3DXB A;  2N4C A;  3IS9 B;  4P2X A;  4OHY A;  3KFW X;  3G87 A;  4AL7 A;  2ZH8 A;  4TU8 A;  3VVT A;  2OO4 A;  1X4C A;  1V3Z A;  1H73 A;  1TR0 A;  3ONQ A;  4IH6 A;  3QSY B;  2HS3 A;  4YS2 A;  2BJ9 A;  4O0N A;  1I94 F;  1UZD A;  3VTI A;  4DFP A;  1FFG B;  1RBO B;  2HYI B;  4JI4 J;  3JAM Y;  1SIW B;  4I2Q A;  3OVS A;  3CIM A;  1RU2 A;  4N76 A;  4M5D B;  1KWM A;  1IKV B;  2VD3 A;  3MUM P;  2GV1 A;  3IR6 B;  2WK4 A;  2OPP A;  3RB0 A;  2BJ3 A;  2RAQ A;  1GH8 A;  3HT0 A;  1ZET A;  1JLC A;  4TKT A;  2UUA F;  2FHO B;  2FD2 A;  4BWJ A;  3K5O A;  1XR7 A;  5HAO A;  1X7V A;  3BM7 A;  1UZH A;  4PUO A;  3B82 A;  1DQ8 A;  3F0N A;  2K7K A;  1JXV A;  2XCP A;  2MQL A;  1REV B;  1OY6 A;  2B4U A;  3SI8 A;  1TKZ A;  1A0O B;  2YNF A;  4RPF A;  3ZTQ A;  2HBR B;  2CJY B;  3TVY A;  1UW9 A;  5C24 A;  1M90 T;  4PYA A;  1UAW A;  1TFY A;  2C28 A;  2RUS A;  1NDP A;  1X0F A;  3JS9 A;  4XPC A;  2Q6B A;  4FVM A;  1MU2 A;  2PGC A;  2EK1 A;  2K1R B;  3GPA A;  1U49 A;  4AD6 A;  4QIG A;  1CS4 B;  1XTZ A;  1WSR A;  3FQL A;  4LMZ A;  2D3O R;  1VI7 A;  1UWB B;  3OFF A;  3W62 A;  2FJE B;  4WP3 A;  1BXN A;  2L9W A;  1N36 J;  1WUU A;  3L9Z A;  4N7T A;  3J7A N;  3IR7 B;  3SYZ A;  4DSE A;  3NKY A;  3ITH B;  1YHQ S;  2FVR A;  1JKH A;  2OFG X;  4NLR A;  2CQ1 A;  3DLL Q;  2GA7 A;  1QTN B;  1PC5 A;  3KK1 B;  2HQI A;  5KFM A;  1WOO A;  2F1F A;  1HQE A;  4DR1 F;  1YRX A;  2WON B;  4D8J A;  2ZNZ A;  4J9Q A;  4DF4 A;  4FZV A;  3PO5 A;  1T03 A;  1YSJ A;  1U7L A;  2PEB A;  3CJ8 A;  2MQP A;  3OL9 A;  1WJ9 A;  5J1P A;  1RHK B;  3V6D B;  2K5J A;  3IP0 A;  5IT4 A;  3M4X A;  1CJK B;  2F3J A;  4K4X A;  3NNC A;  1HI1 A;  4EBC A;  2KI2 A;  4DV6 J;  2D1C A;  5CAA A;  3BO2 A;  3ZC4 A;  1IJF B;  3UVJ A;  2DD8 S;  3EX7 B;  4HAC A;  3SV4 A;  2YKM A;  2ZVS A;  4RBT A;  5HVG A;  4TLR A;  1UPP A;  1VQN S;  1IKX B;  4FXE A;  3TEH B;  2H9Z A;  2M2B A;  2E9T A;  1NJZ A;  1Y3K A;  3IM9 A;  1FXR A;  2M8H A;  4DUT A;  1PAR A;  2JRS A;  4I2P A;  3VAJ A;  3OL8 A;  4Q5V A;  3MMC A;  2WW8 A;  4DV4 F;  4U8Y A;  2LP4 A;  2C3O A;  1XIQ A;  2V9W A;  4CQ1 A;  3O1L A;  3H40 A;  2ZOM A;  3MMB B;  1QAJ A;  3UPF A;  2V67 A;  1S1T B;  3H8Y A;  3U02 A;  3FUY A;  1UFK A;  1QD1 A;  2NPI A;  5T7L B;  3NRB A;  3MM8 A;  3MWB A;  3Q22 A;  2NQP A;  5L1I A;  1N54 B;  1VC6 A;  2FGC A;  2MQN A;  4LR9 A;  5BR8 J;  3SSR A;  2LYV A;  1ZM2 A;  2BAC A;  5GAH U;  3FCW A;  5KFT A;  1HD0 A;  4LBH A;  3BYP A;  4LUB A;  4ZIW A;  1S0N A;  2QX0 A;  1B7Y B;  1OY9 A;  3MAH A;  3MEG B;  4O3O A;  3FCV A;  1S9G B;  4LF9 F;  2QE5 A;  4PYD A;  2F8M A;  1BWV A;  3H2U B;  3P5B P;  3UN2 A;  5LSL A;  3TZW A;  1VHF A;  2LEB A;  4LF8 J;  2AYM A;  5F8J A;  4A48 A;  3EVW A;  3PX0 A;  1W2B R;  1RAA B;  3I6P A;  3I55 S;  1S72 S;  1SH2 A;  5KG6 A;  1P9Y A;  2DR8 A;  1ZAW A;  3F56 A;  3V4I B;  3BGL A;  1W25 A;  2HQ3 A;  2RDJ A;  2DBB A;  3MEE A;  4ZVG A;  3GYX B;  4J9V A;  5ETP A;  3M30 A;  4HI2 A;  3KLG B;  1YGY A;  4FS2 A;  2GCF A;  2WOM A;  5D6G A;  1KEK A;  3M8W A;  4B3S F;  4JOU A;  1NUE A;  2R7T A;  3Q8Q B;  2QG9 B;  2R7S A;  1AT1 B;  1S77 D;  2VL1 A;  2UUC F;  2J9D A;  2DRA A;  3RYL A;  1TAQ A;  3CWJ A;  1RBL A;  1H3D A;  2FVC A;  2UV8 A;  3MM5 B;  5EHH A;  4CYU A;  2EWH A;  5KFS A;  1CJV B;  3GJR B;  3DLE A;  5E5N A;  2KRB A;  3CCM S;  1LW0 B;  2VOP A;  4F67 A;  2XBP A;  4ENO A;  2HIQ A;  5E3R A;  2FZC B;  4ZPT R;  2E7W A;  1S1W B;  4O0I A;  5DLF A;  4AYB D;  3W1Y C;  2OTL S;  1CVJ A;  2GVZ B;  1RT3 A;  1HHT P;  2DRD A;  3JQK A;  3MPD A;  5KFF A;  1O6X A;  2ZUG A;  1N33 J;  2GO8 A;  2MLY A;  2MLZ A;  4DCO B;  1TL7 A;  3AJ1 A;  4B3M F;  5DGA A;  2RH3 A;  3EM1 A;  2N3L A;  4L73 A;  2CAJ A;  4A8S A;  3AOA A;  3IGV A;  2CPI A;  4YR3 A;  3MEC A;  4Y65 A;  2DHH A;  2IYI A;  2ZHO A;  3DRS A;  1L5U A;  3KUH A;  4DV0 J;  3K8W A;  4M5L A;  4F4W A;  2CJA A;  4QPX A;  2DIS A;  3QIP A;  3DGP B;  1HNV B;  3DXS X;  3FQK A;  5ETR A;  1BDV A;  4FKX A;  3QT8 A;  5CH7 B;  2FUG 9;  4CLP A;  3GJQ B;  1Y5I B;  1PO6 A;  2B8Q A;  2OPR A;  4RUB A;  1SVD A;  4HH1 A;  1J2V A;  5AJ3 J;  4CLZ A;  4HKQ A;  2JZ5 A;  4DSJ A;  3NG8 A;  2IBO A;  1ZPW X;  3OSN A;  1CJT A;  1KS2 A;  1OS5 A;  1LK5 A;  2B8P A;  3CDA A;  2D3Z A;  3PW4 A;  5LJ3 Y;  4USJ C;  4ZVR B;  5IXU A;  1FTC A;  3UR0 A;  1RAI B;  2EW9 A;  2L3M A;  3MXH P;  5D15 A;  1N32 F;  3AOD A;  2QC3 A;  2E7X A;  1VQM S;  4F25 A;  2YH1 A;  2VOO A;  2XMM A;  4HT7 A;  3VW4 A;  4NYP A;  4KO0 B;  5KFD A;  8AT1 B;  2XHW A;  2FLN A;  2HEK A;  1WF0 A;  5B0G A;  2NXU A;  3UD5 A;  1QAY A;  2AMC B;  4LVO P;  1KFS A;  5CYM A;  2GGP B;  3W2V A;  3M8Z A;  5EWG A;  4YP3 A;  2O01 C;  2MPU A;  2BW2 A;  5EWE A;  4DFK A;  1HBU B;  3MDF A;  4Q2L A;  2Z2Y B;  3CCU S;  1Z2L A;  1HNZ F;  5I3Q A;  4ZPA A;  3PRB A;  4FF4 A;  4C0O C;  3HJF A;  2XYH B;  2F9D A;  3C19 A;  1DLO A;  5C42 B;  4FYV B;  2AGQ A;  1P27 B;  2DYA A;  3BR8 A;  1UEK A;  2C3Y A;  4ZHR B;  3GFH A;  1K9M T;  3H20 A;  1RHM B;  3OTO J;  2J6U A;  3D1Q A;  4DQS A;  1CEZ A;  4CTA A;  3L4B C;  2YWE A;  1F5A A;  1LWE B;  2QL7 B;  3ZTR A;  4DN0 A;  1GFW B;  4DCP B;  4IRD A;  4DL0 C;  3NGR A;  4HYK A;  3LWL A;  4F7V A;  3BPD A;  2Q43 A;  4NLW A;  4LF7 J;  2MHN A;  3QYY A;  4NMX A;  1QUV A;  2DXF A;  2HNY B;  5D4L A;  2NZ4 A;  4KAI A;  3SDE A;  3Q8U A;  4ECW A;  3IMQ J;  3GII A;  3DKD A;  1WC4 A;  2BJ1 A;  2E66 A;  1T94 A;  5KT3 A;  2HHQ A;  2J0W A;  1KQG B;  2QLB B;  2MQO A;  4ZP9 A;  5L38 A;  4RX6 A;  5L1J A;  3TOQ A;  4ID5 A;  1LW2 A;  1H7X A;  1FCA A;  1RWK B;  3CJS A;  1JLG B;  4W90 B;  4KHP F;  1TQL A;  3M8Q B;  2JC1 A;  1HHQ A;  2FQQ B;  1QE1 B;  4CT9 A;  4B9S A;  3HHN B;  2CJ9 A;  4KH0 B;  1S1X B;  1I5O B;  2LCW A;  1DTQ B;  4O23 A;  2A2D A;  1SJ4 P;  1NJX A;  1M5V C;  1VBX A;  3GP9 A;  2KYZ A;  3OT9 A;  2MZR A;  4X4U A;  1SC3 B;  4JYA F;  2VHG A;  4OYM A;  4B9T A;  1C0U B;  3NGT A;  3A4T A;  2DGV A;  1KTQ A;  4DV5 J;  4ZCK A;  1XC9 A;  4ZPC A;  3PYG A;  3H0P A;  4WCE Q;  1L3S A;  2RE1 A;  3FNN A;  3CJR A;  2IM0 A;  1NKC A;  4ATN A;  2NUH A;  4FN5 A;  4NCG A;  4O4G A;  4U95 A;  2ZH4 A;  4RJV A;  3JYT B;  2HHW A;  3NAI A;  3KDO A;  4UOC A;  1N34 J;  3OTD A;  5HQ8 A;  3LP0 A;  1XMQ F;  3AD8 C;  6FD1 A;  3Q8R B;  3M1V A;  5DQI A;  1FKO B;  4U9R A;  2FJB B;  1C1C A;  2PEH A;  1T9X A;  4BDP A;  1SKR A;  2GQQ A;  1HBM A;  2RRA A;  5ETL A;  3WDO A;  3IBC B;  4TYA A;  2ZD1 A;  4BCA A;  2DHX A;  4DR2 J;  5KFR A;  5DET A;  1B70 B;  2VG6 A;  2OLW A;  4MKY A;  4U96 A;  4F50 A;  1JLA A;  2YQ3 A;  1XWL A;  4GO5 X;  4CH1 A;  4X4V A;  1EET B;  2BAN B;  5JUM A;  2RKI A;  1LQ9 A;  3KLF A;  1RAO A;  2DT9 A;  2DXE A;  3BN4 A;  1NK6 A;  2B4O A;  2V4R A;  2KT5 A;  2E1C A;  1OMS A;  1B99 A;  3TRG A;  2QA4 S;  4IFY B;  2DH8 A;  1SBR A;  2W9B B;  2PII A;  4U67 Q;  2OPS A;  2ROG A;  2LQJ A;  2YX7 A;  1HR0 F;  3D68 A;  3IXQ A;  3MCS A;  1X4G A;  2RQC A;  2FB0 A;  4DS4 A;  3HHL B;  3CO0 P;  3MED A;  2V2K A;  4B3R F;  1P6T A;  2V8V A;  1X4F A;  3CCJ S;  2Y8Y A;  2AW0 A;  2IM2 A;  3QO9 B;  3PHT A;  2H4W B;  3HHD A;  1MW7 A;  3QT5 A;  3KK3 B;  4P52 A;  3CSK A;  3M05 A;  2IVY A;  3CCQ S;  1U4B A;  1NK7 A;  2IAJ A;  1F5C A;  3PW5 A;  1B3T A;  5EN1 A;  2WHO A;  2P6T A;  3N6L A;  4TXS A;  1EKS A;  3VAG A;  4C9D A;  4H4M B;  4DFJ A;  3PKM A;  1X9W A;  3HXM A;  3EZO A;  1S9E A;  3ET6 B;  4QIF A;  4JP8 A;  1WEL A;  3CJK B;  1K47 A;  5E3P A;  2VG7 A;  1F6T A;  3ILL A;  3BKF A;  2OGU A;  4PG5 A;  2DVI A;  1XNR F;  2HFU A;  2VFU A;  5D3G A;  3JTN A;  1HA1 A;  1X4B A;  2DNN A;  3R5G A;  2DIT A;  3JTP A;  4DR6 F;  4U7U D;  3NWR A;  3OFH A;  4WE1 A;  1D0E A;  4N47 A;  1VLO A;  2PA3 A;  2OP5 A;  3EYZ A;  2H3A A;  4H4K C;  1HPZ B;  1DHM A;  2JFD A;  2WBR A;  3IG1 A;  3NY0 A;  5ETS A;  1NK5 A;  1JMT A;  5HN0 A;  4AFF A;  3KLH A;  4F3M A;  2XO7 A;  2YX4 A;  2MZ1 A;  3VAF A;  2MZJ A;  2OEL A;  3IN5 A;  3DOM B;  3IFE A;  2FHJ A;  4DMZ A;  4X84 A;  1TTH B;  1IBL J;  2JVR A;  3PXG a;  2CNL B;  2YXL A;  4JI7 J;  2Y0S D;  2KHD A;  3QQC D;  3DDK A;  5KFJ A;  2XSJ A;  3FBE A;  1NPP A;  3NO7 A;  1TUW A;  3N5F A;  1JB0 C;  1EHW A;  4MIA A;  3K89 A;  2QZ8 A;  3R3T A;  4DV1 J;  3C6T A;  4ZIT A;  4WFX A;  1NJY A;  3BO4 A;  5GMD A;  1VYA A;  4USI A;  4N8O A;  2RS2 A;  4AUK A;  1S59 A;  1IWA A;  1RHR B;  3D66 A;  4MAK A;  4NWB A;  5KG4 A;  3LJP A;  5F9N A;  1IBC B;  4LFB J;  1CC7 A;  1N5S A;  2P9G A;  2KJW A;  4GMK A;  1GXL A;  2MKY A;  2CWX A;  2QMW A;  5D77 A;  1T7P A;  2R8K A;  2VG5 B;  2XO6 A;  1HBN A;  3OQ2 A;  3DLK B;  4KBI A;  4ECZ A;  4C8M A;  3CDB A;  1J5E F;  1VRQ C;  4O3R A;  4M5K A;  1NPR A;  4USK A;  1WC5 A;  1KVJ A;  2HNZ A;  1U1O A;  4RW9 A;  1X4H A;  2RF2 A;  5IQQ A;  4DPX A;  2H1Y A;  1JJH A;  4NYZ A;  4OHV A;  4G1Q B;  2VFT A;  3RR8 A;  1AXQ A;  4WF9 Q;  3KJN B;  2VQF F;  1QVF R;  3RRG A;  4B08 A;  2MGZ B;  5L1L A;  3AAW B;  2ZDO A;  3NOC A;  1NB2 A;  1J27 A;  3CE8 A;  4Y00 A;  2XY7 A;  5KFC A;  4LSZ B;  1RZM A;  5F3Z A;  2KU7 A;  4KRW A;  3D1H A;  1TMJ A;  3IAM 9;  1SKS A;  1JXL A;  2HFV A;  2IM1 A;  1T05 A;  2V6A A;  3CPW R;  4MFB B;  3PO4 A;  2AEJ A;  4PAB A;  1RTD A;  3GJT B;  3QGI A;  2NRE A;  4WZM A;  3TX8 A;  2DNP A;  3Q8V A;  2HLU A;  4WP9 A;  4GKK J;  4F3Q A;  1XMO J;  1OPI A;  3CNQ P;  2ZE2 A;  4O44 B;  2B4P A;  1JLE B;  3AD7 C;  5A0Y A;  1VFJ A;  3D1O A;  5BYQ A;  2UUB F;  2C2M B;  4KGX B;  4ELV A;  1N8R T;  5C2C A;  1M1H A;  3EDR B;  4DFM A;  2M52 A;  3J81 Y;  3VAH A;  2OAU A;  1JJ2 R;  1TEL A;  4GC6 A;  4TQR A;  2YNH A;  2VKZ G;  3OW2 R;  1R0B G;  1VRU B;  4XTT A;  4Z37 A;  4LF6 F;  4LSN B;  4TVA B;  4Y2A A;  1XQI A;  4DR5 J;  2BQ3 A;  4YQW A;  2HZC A;  1P1L A;  4FPI A;  3M2V A;  2CJK A;  4ITS A;  1YTY A;  2WCX A;  4ED3 A;  3HI9 A;  3HVA A;  2R42 A;  2VC1 A;  3CO9 A;  4RKU C;  4PKD B;  2ZDP A;  3PTW A;  2BM0 A;  3TQE A;  3M8P B;  3THV A;  3C14 A;  2ZH2 A;  3ILJ A;  4FXW A;  1HAR A;  4IFV A;  4Q44 A;  5IV3 A;  5B0B A;  1NND A;  2EG1 A;  3KWM A;  3UDV A;  5HLF B;  1HW8 A;  3Q2T C;  2FGO A;  2ZUA A;  4FDF A;  1DUR A;  1RTJ A;  4IYQ A;  1RE1 B;  3H25 A;  4QIW D;  2CJQ A;  2XY5 A;  2U2F A;  4URQ U;  4ED0 A;  1HKA A;  3ISZ A;  1P8G A;  4XDC A;  1UFL A;  4DF8 A;  4ZPB A;  1WDD A;  2EBE A;  2OKQ A;  3CMQ A;  4TN2 A;  4HI1 A;  3I9Z A;  2M70 A;  1FJG J;  2JJ4 D;  3AB4 B;  3JQM A;  3RG6 A;  1MG7 A;  4DV7 F;  1VIO A;  2DNH A;  2XGP A;  3EGW B;  2G4B A;  3KHR A;  5DG9 A;  4M5H A;  1V6H A;  5ITH A;  2A6M A;  1IBM F;  3EUN A;  5I42 A;  2NSC A;  4KPY A;  3MM9 B;  1SI9 A;  3PIP Q;  1VQ9 S;  3QAT A;  2NZC A;  2C2R A;  4U8V A;  1X5T A;  2N7Y A;  1TK0 A;  3GSD A;  2HQF A;  3PVX A;  1Q81 T;  4B3O B;  3G8T A;  3QRR A;  4LRD A;  4DCJ B;  2DNM A;  3LPY A;  5LMU F;  4M1K A;  2UXD J;  3P6Y C;  3T1A A;  4D3H A;  4LIR A;  3Q86 A;  2YNI A;  4ECY A;  1U0H B;  3B6B A;  3KKF A;  2V4J B;  3TNV A;  2YKN A;  2LA6 A;  2DNR A;  2H65 B;  3IR5 B;  5GAD I;  3I4P A;  1KON A;  3W7B A;  2A0F B;  3O3L A;  4KT0 C;  5F8L A;  3CJ2 A;  4N77 A;  3DOL A;  3FT7 A;  2CZ9 A;  1HIY A;  3A3O B;  3DDN A;  1KOO A;  1T9W A;  2CYY A;  2X51 A;  4HV0 A;  4NI2 A;  1B7F A;  5C25 A;  3BKT A;  1HYS A;  5E3C A;  1OSC A;  2NPF A;  2LQ8 A;  2CQ4 A;  2ZWO A;  2G1H A;  4EO8 A;  1GMU A;  8ATC B;  3FGV A;  1GAO A;  2AIR B;  1NH7 A;  2K3K A;  1KLM B;  2DIU A;  2RNE A;  2ZZM A;  3ISN D;  1NK8 A;  4JUZ A;  2JVO A;  3ZO7 A;  4ES1 A;  2CXE A;  4JI6 J;  3PJ9 A;  3GG0 A;  5K14 A;  4CLT A;  2F5G A;  2IRU A;  3MM6 A;  1TZ0 A;  1AFI A;  1Q1K A;  2BE7 D;  3JSM B;  3TI0 A;  4JI3 F;  2J8S A;  2ADB A;  4IDK A;  3OTC A;  1B0P A;  3EPI A;  1JLQ B;  2YWH A;  2WVF A;  4TNO A;  4KSE B;  3D4J A;  1IBK F;  3G6V A;  3KLI B;  5A8R B;  3PRD A;  2G2Z A;  3OL7 A;  1WC1 A;  4ZMM A;  4Y2K A;  4HL9 A;  4Y34 A;  3EGZ A;  2OEM A;  2YNG A;  3AY0 A;  3FC9 A;  3C16 A;  4LQ9 A;  3D28 A;  4DR4 J;  5GAG I;  4NL5 A;  3DCA A;  1ZPV A;  2H5J B;  4Y2I A;  2V0N A;  5KFO A;  1XN9 A;  2QO3 A;  3KOA A;  5HL7 Q;  2NXC A;  2MQQ A;  4CLL A;  2G13 A;  1TKT A;  2LFV A;  2BJE A;  2CA9 A;  3G6E S;  1S0V A;  4C2M A;  2L41 A;  9ATC B;  4OJG A;  2YPY A;  1L3U A;  3T5K A;  2IM3 A;  2QLJ B;  5IFM A;  2PD1 A;  2W24 A;  3TR5 A;  3I32 A;  4AND A;  3W2W A;  4CI0 B;  1QJH A;  2P9C A;  5HBM A;  4X4S A;  1RT1 B;  3KJV A;  4Z7Y A;  5DO2 A;  2IDL A;  1FNX H;  2R4F A;  4OI4 A;  3SV3 A;  3N28 A;  4OZ0 A;  2GHW A;  3CUN A;  3DM2 A;  4Y2M A;  4KFB B;  2IJN A;  4GKJ F;  3KLE B;  5LMN J;  3U1M A;  4J5O A;  1FKP B;  5M2R A;  3AXK A;  2PFD A;  4YN3 B;  3ISN C;  2XM3 A;  1PC4 A;  5HMW A;  1U6B A;  3TZX A;  2APO A;  1IWG A;  1QAX A;  3OR1 B;  2K9I A;  4FVC A;  3DRP B;  1UA0 A;  5F0W A;  2W8K A;  1WEY A;  5J2M A;  2MLX A;  5SZT A;  3S01 A;  2I1R A;  1XR6 A;  3TAQ A;  2HQG A;  4J9P A;  4Q8F A;  4DV3 F;  1TL3 A;  4YY3 F;  1C1B A;  4R8U A;  4KKO A;  2B3T B;  1JLB A;  1GTE A;  2WBM A;  2IY5 B;  3OL6 A;  2HHT A;  3SQG A;  3M32 A;  2C42 A;  4PWU A;  4ED2 A;  3UE2 A;  2AZ3 A;  4RNH A;  3GR1 A;  3VAM A;  2PMZ D;  5A2Q U;  2W4P A;  2BQR A;  2BE2 A;  4ICL A;  3MCO A;  3HO1 A;  3HSJ A;  3D3C J;  3KNG A;  1WKL A;  4KIA A;  4M5G A;  3TA1 A;  1KD1 T;  4USU A;  1EJ7 L;  2IC3 A;  4F4X A;  5D0E A;  3RRH A;  4OX8 A;  2KG1 A;  4LRF A;  3AJ2 A;  1UVJ A;  5H9F K;  4HDG A;  3RAM A;  1RAJ A;  5DDQ C;  1RQ0 A;  5B09 A;  2C3U A;  5CQG A;  1RHU B;  3LAM A;  2K6L A;  4E0D A;  5AT1 B;  1TK5 A;  2VOD A;  1YZ6 A;  5CXT A;  2V2Q A;  3N0V A; 
#chains in the Genus database with same CATH homology
 2BJ8 A;  3QSI A;  1U9P A;  1BDV A;  2CA9 A;  1Q5V A;  2JXG A;  2K5J A;  2FGC A;  3GXQ A;  1X93 A;  2BSQ E;  2HZV A;  1MYL A;  1BDT A;  2BJ9 A;  1MYK A;  2Y3Y A;  1B01 A;  2H1O E;  2NZC A;  3LGH A;  2HZA A;  3PHT A;  2KEL A;  1Q5Y A;  2WVE A;  1QTG A;  2WVC A;  2BJ7 A;  4FXE A;  2WVB A;  3OD2 A;  2K1O A;  3H87 C;  1EA4 A;  2CAD A;  2BNW A;  1P94 A;  1PAR A;  4ME7 E;  2GPE A;  2JXI A;  2BJ3 A;  2WVF A;  2PC6 A;  2JXH A;  2AY0 A;  3VW4 A;  3QOQ A;  3BKU A;  1NLA A;  2CAX A;  2BA3 A;  2RBF A;  2CAJ A;  2K29 A;  2F1F A;  3FT7 A;  3FMT A;  3VEA A;  1B28 A;  3BKF A;  1BAZ A;  2K9I A;  1ARR A;  1ARQ A;  2WVD A;  2K6L A;  4HV0 A;  2BJ1 A;  2BNZ A;  4D8J A;  3BKT A;  1MNT A;  2CPG A;  3VEB A;  1IRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...