2HZAA

Nickel-bound full-length escherichia coli nikr
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Nickel-responsive regulator
publication title NikR-operator complex structure and the mechanism of repressor activation by metal ions.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2hzaA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2hzaA02
3BKTA 4ME7E 1ARRA 3VEAA 2BA3A 1EA4A 2WVBA 3LGHA 2BJ7A 2K6LA 3VEBA 2H1OE 2K9IA 2BJ8A 2WVEA 1MNTA 2JXIA 3FMTA 2BJ3A 1B28A 2FGCA 2F1FA 2CADA 1MYLA 2NZCA 2K1OA 1BDTA 1X93A 4FXEA 3OD2A 4D8JA 2HZAA 3VW4A 2BJ1A 1NLAA 2PC6A 2RBFA 3GXQA 3PHTA 2BSQE 2JXGA 2Y3YA 3QSIA 2K29A 4HV0A 1ARQA 3H87C 2AY0A 1IRQA 1P94A 1BAZA 1U9PA 1Q5YA 1MYKA 1BDVA 1Q5VA 2KELA 1B01A 1QTGA 3BKFA 2BNZA 2GPEA 2CA9A 3QOQA 3FT7A 2WVCA 2JXHA 2CPGA 1PARA 2BNWA 2CAJA 2BJ9A 2WVDA 2HZVA 3BKUA 2CAXA 2K5JA 2WVFA
chains in the Genus database with same CATH superfamily
3MM7A 3DLKB 2RDIA 3C2PA 1U2RA 3AH6A 2JVOA 3H42A 2MKSA 4KV8B 3TZXA 1KC8T 4A46A 1RA7A 2VFRA 1OO0B 1TKZB 1ACMB 2L9DA 1X0FA 4HVZA 4AYBD 3JYTA 1KVKA 3RR8A 1DTQA 2BMBA 1GXLA 3M2VA 2UXBJ 3M8RA 2P9GA 4YFUA 4QWAA 2LDIA 3I0SB 1PG5B 3H5UA 2PD1A 2HQGA 2FJWA 5KFGA 2W1BA 4HI2A 9ATCB 4IR1A 1U25A 2M9KA 2YVSA 4DV0F 3MMAB 2IIHA 4NEYA 2PI5A 4DL2A 4GVLA 4OI2A 1RAIB 2AX1A 3VGUA 4USJC 3BO3A 4B9VA 3QO9B 5IV3A 1OY8A 2L9WA 1WHVA 4KBIA 3T9ZA 4OYAA 2LMIA 5DLGA 4IO9Q 1YJ9S 1F9EB 1GMWD 2X1FA 1QSLA 2AWZA 5BR8J 2CADA 3VWSA 3PW2A 4ELUA 1DQ8A 5E33A 5BR8F 3UVJA 2QL7B 3AJ2A 4ZP9A 4ZPTR 4DV5J 1NRKA 2MLYA 4GKKF 3RGIA 5A6PA 3FC9A 5DDPC 2FD2A 4JI3F 3PRBA 3H8YA 3D0HE 3OFGA 3P5BP 1S1UA 1B01A 2J0WA 4RPFA 3OV7A 2W7OA 2ZHBA 1WC5A 1BE4A 2G1HA 3GIIA 4WIQA 1FEEA 3RBZA 1NDPA 2K8GA 3BGRA 4PPDA 4AUKA 3Q8PB 3SQGB 1S7HA 3DNCA 3M6VA 3M30B 2FLPA 2R4FA 3M8WA 3DOMA 2WSFC 1WHXA 2GIQA 2ZM6F 3AHPA 1KDNA 2HGLA 1B28A 4F4ZA 3FEYB 4F3QA 2KJWA 1UVJA 1HI1A 4FS2A 4WTOB 2QRRA 1IKYB 5J1NA 1IKVA 2B9EA 3C6UA 4RZRA 5KFOA 3PW7A 2XLKA 3NGDA 3GV8B 3THPA 5B0AA 4FYWB 5C25A 5D3GB 1RAJA 2E1CA 3V4IA 1WHYA 5DETA 1U24A 1X60A 1KONA 1MROB 2LLZA 2M8HA 3V6KA 2DD8S 1QTGA 1KTQA 2FYXA 5AT1B 4ES3A 4QIGA 4R0EA 2HHSA 2PA3A 1NK9A 4K7QA 3K5MA 4ANDA 2OPSB 4EBDA 4J9LA 4M5HA 2L3MA 3T6BA 3MPYA 3D54A 2DR5A 2HBQB 2K6LA 1EKSA 5BYQA 3VGVA 1D8YA 4DR4F 2FVPA 1MNTA 1X0PA 1GH8A 4QQBA 1UEKA 1YI2S 2DR6A 3CB4A 3D4JA 4PWWA 3R7NB 4U96A 3AOCA 2DISA 4DI6A 5GADU 4X4QA 2E7VA 3R97A 4YDXA 4V19X 4LFBF 4DBQA 1MMLA 7FDRA 3E2EA 5C24B 1JLFB 5KFSA 3AQOA 4RW8B 1Q4RA 1DHMA 5H9EJ 2RRNA 4N47A 4Y65A 3DDIA 3NOGA 3KLEA 4R0JA 2XYPB 4ZPBA 1BAZA 4K4SA 2ZKTA 2OUGA 4L74A 3G6VA 3RRGA 1Q95G 1VBZA 5AXNA 2DNHA 5K20B 3BF4A 2KZMA 1PJ6A 1FJCA 3OFFA 2R2SA 3KLFB 5EWFA 3QOQA 2GMLA 3NGSA 2NYIA 2AYMA 1WJ9A 1QVGR 1X5OA 4DR7J 1T3OA 3SSSA 3AY0A 4IH6A 2R8GA 1FFGB 1FRJA 4DR7F 5CHCB 3VGTA 3N6NA 2CG8A 2BZ2A 4FF3A 2CVEA 4OZLA 2DEIA 3J7YU 5A2QU 3W60A 1RT1B 3QJJA 1C0TB 2VG7A 3FRZA 1F60B 4BS2A 3ZTQA 4ZLLA 2Z2ZA 1HQ2A 2PA8D 4LSLA 4IG3B 1YG0A 1XNQJ 5B0DA 4M5LA 2DHXA 1X4CA 4XDDA 4ALZA 2AD9A 3TA1A 3CCWA 3R1LA 3FKBA 1JXVA 1V3RA 1F3VA 2EFPA 2NLWA 4DPWA 3ITHA 5DQHA 2NYHA 1CLFA 4J9MA 4JP8A 3J80Y 2ZH1A 3HHKA 2OAUA 1VJWA 1NKBA 4ES1A 4QYRA 3BB5A 4Z37A 4LREA 3IR7B 4ZVOB 2AYGA 4YEAA 1R0BG 3AD8C 4U9RA 5E3QA 3PM9A 3BR8A 3DXSX 2BW2A 1LNQA 1T0TV 4LIWA 5JJBA 1S1TB 1JJHA 4FXVA 4C97A 4U7UK 3Q22A 1TUVA 3E01A 4RNMA 2WONB 4NMLA 1X9MA 2AN7A 2YX4A 1UEVA 4R25A 1WOSA 2V2VA 3NRBA 3R7BB 1X4HA 3R5AA 2JDJA 1YGYA 1TKXB 3M2RA 4LF4J 3PYFA 3AD7C 2F1FA 3MR2A 1H2UX 2ZOFA 4I56A 1HHSA 2E7WA 4I2QA 1IBKJ 2H3AA 1RTHA 4FF2A 3I96A 3DOLB 5LMNJ 2AGPA 4JV0A 2L08A 4URGA 1BMQB 1JJCB 2YQ1A 5LMNF 1NPKA 1ZZFA 2DGQA 3P6YC 3I5CA 1KEKA 5I3UA 3KHRA 1HBNB 4RNNA 5B09A 5IC6B 1RADB 2B5JB 1C2PA 1BDVA 4DV3J 2A2BA 1NHVA 3VQSA 1ZZNA 4B9MA 3V5RA 3QWPA 2LEAA 3TR5A 4WZMA 1I94J 3VAMA 1J27A 2MKKA 1APSA 2CAJA 2BJEA 5L1KA 1G6BA 1BC6A 3NAHA 2JNJA 4ZDNA 4ZIWA 5D4NA 2IHR1 3HHLD 2HRTA 5C2CA 2XQCA 2YKMB 3HKWA 2HPUA 4Q7AA 1R0AA 2R8JA 2MSSA 4O3PA 3KLIB 1C4AA 1WD6A 5A8WA 3TO8A 3U27A 2GAHC 2EVZA 2XMAA 2DYAA 2ZH9A 2Z57B 1AA1B 3G8QA 2PEHA 1FVSA 4URQU 1H6KX 3GFYA 2VC1A 3KLGA 1TVRB 5KT7A 3OTCA 4KO0B 2CPXA 1Y5NB 3GU0A 5KFLA 2HHHJ 1N5YB 2R7RA 4ZVGA 3DHWC 1YHQS 3HSGA 1M5KC 4JI8J 3CJKB 4ITSA 3NP5A 2V34A 1BD6A 2R3VA 3T3FA 4LF9J 3UR3C 1EX8A 4JI8F 3R1HA 4JV5F 3Q89A 3UCZP 1X4FA 3UN2A 2AKWB 4OYPA 2IMWP 2MJUA 3B4MA 1TL4A 2V4QA 1NJXA 1VQOS 4WK3A 1RBOB 2H4YB 1R0CB 5KFXA 1PSDA 4HYKA 3NMAA 4HT5A 3MURP 5U47A 2Z58B 1ZTWA 5GAGU 3BQ0A 2QZ8A 2CWKA 3MOZA 1RGVA 4H4MB 1WI6A 4ZIVA 4I4BA 2VKZG 3B6BA 1QVFR 3CCMS 5JUMA 4NYOA 3KJFB 2DR7A 2FJEB 1I1GA 2C2KB 1HQEA 1IBLF 2PT0A 4B3TF 5FDLA 2YX1A 3GPAA 1ITPA 3PR4A 3QSYB 1N6QA 4WKYA 1N5VA 3MR7A 5LM7E 4ZJOA 1ZM4A 2KT3A 2FGOA 2F3JA 4KKOB 4JB8B 1B4SA 3FZ2A 3V81A 1AYEA 2DGOA 4OHVA 4QIEA 4FNIA 4ECYA 1WC6A 4P6QA 2R8HA 2G2ZA 3BSAA 1SC3B 5EWEA 3NY0A 2EPIA 3GONA 3QT8A 4B3MJ 5A8RB 1SV5B 4C3LA 1Y4ZB 4M8LA 2FVQA 2LU1A 4B3MF 1ZS6A 2AYEA 3NGUA 4Q5VA 3CCZA 3BYRA 3VHQA 2VB6A 2X7IA 1L3UA 2AV5A 2YNGA 2BBEA 5IWAJ 2R42A 4G1QA 5H9FK 4BC9A 3IM9A 1LWFA 1LW2B 2HNZB 2Y0BB 2BJ1A 4PKDB 4NLPA 4JBCA 2GGPB 3PR5B 2RBFA 4WFAQ 2HK3A 4TQSA 2NREA 3D5MA 4O4GA 1VRUB 2LEBA 5D77A 4JI0J 4ZK7M 4WP8A 5F0WA 1NJIT 4ELTA 3BEGB 3BQ2A 2CZ9A 2W7AA 4B3RF 4RNFA 1JNZB 1U09A 1AZSA 4Q2MA 1U1NA 1O6XA 3EUNA 3N28A 3SCIE 1YBAA 4EBCA 5B0CA 2JRSA 2MYFA 3PXGa 1KVIA 3VF0B 3EDQB 4IFYB 4NMXA 3QT7A 5HMYA 2YNHA 3CJ4A 2V67A 4LQ9A 1AFJA 3TUPA 1X31C 1RLCL 2F7VA 4IH5A 2DNLA 1TELA 1SCJB 1R8BA 2AP6A 5ETKA 1VQ7S 4KE5A 4F0HA 2SXLA 4IRKA 1XBWA 3CJ0A 4LUBA 3TJ9A 4K5SA 4JV1A 2M88A 4USMA 5L46A 1B0VA 2HHPA 4L3NA 1UTAA 3J7AN 1FRHA 3CJSA 3I9V9 2J6SA 1RA6A 1CJKA 1LW0A 2EG2A 3NCRA 1E6YA 5E5NA 3TWZA 1X5PA 4ERDA 2E5GA 3PO5A 3NG8A 3A3OB 5FLXY 4O23A 2VIHA 5EHHA 4DUYJ 1S9GA 2VFTA 1PAUB 2I38A 1K73T 4DUYF 4FYDA 4X65J 4I2PB 4ZA1A 1SUQB 1S9EB 2AU0A 3IRXB 4X65F 1PYOB 3M32B 4DSLA 3GYNA 1KOHA 1XR7A 4KGZB 2KFZA 2HRUA 2XSJB 1JMTA 3BKUA 1S1VB 1P27B 1FDBA 3Q8RB 4DR5F 2HBRB 2FZCB 1SBRA 4DZ6A 3T1YF 2ROPA 4R5PB 3CVKA 3SFGA 1WDTA 3IG1A 4XO0A 3G82B 4IYQA 1WUUA 4CCHA 1A0OB 1R43A 1FCAA 2OMOA 2LCWA 2MEWA 4C98A 2VPZB 4EBEA 4LF7J 1IXKA 2EC0A 4RW9A 1X9WA 2Y1LB 4H4KA 2J0SD 1F5CA 2E5HA 2I6WA 1WHWA 4PPZA 2ATCB 5H9FJ 3EPIA 3EYZA 2VU5A 4Q44A 1Q7LB 2K29A 3JQMA 4Q45A 1GK8A 3EZUA 3RB4A 2H4WB 5HSPA 3K58A 1IR1A 1WNEA 3GIRA 2PEBA 1WG4A 5G4DA 2LQBA 2W2PP 4JYAJ 4X4SA 2FJXA 3MPVA 1DFDA 2I2YA 3ONQA 2YXLA 3I82A 4PQAA 4JYAF 3ZC4A 1CJUB 1TKTA 3M7VA 1DY3A 4KH1B 1FEHA 4LF6J 4FNHA 1XERA 1JLGA 2RQKA 4PR6A 1FWPA 1EHWA 4I68A 3I5AA 2XC9A 2GQQA 2B4OA 1Q0NA 4HTIA 4PUOB 3KK2B 4DFKA 2YQ0A 3DYAB 3PCOB 4ECWA 4QPXA 5LT5A 4IRCA 3NLCA 4WYWA 1NKEA 1K8AT 1GNKA 3MMCA 2BYCA 1S0OA 3FFIA 1IJEB 4N7TA 2VASA 2UV8A 2E7XA 3CC4S 3CCTA 3D66A 2X51A 4LF8J 3L4BC 4A8SA 1GAOA 5EX0A 4GKJJ 3PHTA 5THWA 1S1WB 5M2RA 2XULA 4EMDA 4HR2A 4LF8F 4HI1A 4GKJF 1NPPA 2FUG9 4TLRA 4TY8A 1AFIA 4X4TA 4USIA 4DX8H 3PRVA 2DVIA 2VUGA 3GJTB 3LA0A 3OHAA 2V4RA 4QOTA 4M5JA 1JLBB 2ZWPA 1JLAB 3FQLA 3DU5A 3R2DJ 5ETQA 4EU0A 2KT2A 1TP7A 3FBFA 2DH8A 3DMJA 2XS2A 2G2OA 5LSLA 1JLCB 2ZH8A 2QO3A 3NGRA 2HNDB 1ZH5A 2K06A 2QLWA 1AB8A 3P5TL 3FSYA 2C2RA 3A8EA 1MU2B 2VV5A 2WOMB 3MUVP 2HQDA 2OEMA 4O3QA 4MIAA 2J7WA 3OR1A 3GTYX 1HNWF 5F3TA 2ZOGA 1IJFB 3PX6A 3DLKA 1DLOA 1VMBA 2RUSA 4JV2A 1NAQA 4KV8A 1HQUA 2RHSB 1HR0F 2COLA 4ECRA 5EGYA 2VQFJ 2CJBA 2BOAA 2ERRA 2HHWA 3T1HJ 2Q1LA 1TV6A 4ZCLA 4DU8A 2KH9A 5ETMA 5GMEA 1TKZA 3UFCX 2V5HG 3QATA 4BC7A 1NK8A 2ZH6A 2KM8B 3C19A 1REVB 4E2FB 1F3FA 3JQKA 3B4DA 6FD1A 5KFVA 2JVRA 1YRXA 3IMQJ 1VQ6S 4P7TA 5KFRA 1SC6A 4EK2A 4YB1P 4LRAA 1R89A 4PQUB 1Z2LA 5DLFA 3I0SA 1CC7A 1S79A 4K4UA 5F8LA 4DPTA 1NHUA 3K89A 9RUBA 1NDLA 3JTNA 3HJFA 1TL3B 3UO0A 3O3LA 2JFKA 2Y1RI 3UD4P 3QO9A 5CH7B 2H65B 4UUXA 2HNYB 1S7IA 4PZVA 1RKJA 3UDVA 3GV5B 3HSDA 2FIUA 4C8LA 4CO4A 2HFSA 1FESA 2RJZA 4RL1A 1ZTTA 5BJRA 3TQEA 3B8HA 8AT1B 3LANA 2ILYA 4OZJA 4USKA 3EVOA 2NSBA 3ENQA 4F25A 2RF2A 2RT3A 4AE5A 3T6JA 2MGZB 5HVFA 3MF5A 3VVTA 1T9XA 3BV8A 1WG1A 5KFQA 2DY1A 2CNOB 1VQPS 2K3KA 4Y2KA 1BWEA 3BBBA 4O0NA 1T11A 1FDNA 3RAMA 2C2ZB 2VA3A 2RIJA 2UV8G 1VHIA 2W25A 4DN9A 4L3KA 2OP5A 3BM7A 4DQIA 2IDEA 3D1OA 4WIIA 3BO2A 3M6XA 5I3PA 2W4PA 2VONA 5EN1A 3UW1A 5LXRA 2QG9B 3SQGA 1D8ZA 3C14B 3L95X 1DTQB 2CZVC 2XYGB 4USHA 3I6PA 3T41A 2CQGA 4DR2J 3BSCA 3TJAA 4LIRA 4OJHA 1KRPA 1N34J 3A3PB 2B0GA 1U1LA 1A7GE 3RR7A 3EICA 1N34F 3D0IE 2GJIA 1RAOA 2CJKA 3OTOJ 4ZN3A 3L7UA 1IKYA 1HI8A 1CJVB 4OYMA 1D0EA 4DR6J 3ICLA 1S6QB 2R8IA 2Y1JA 2BJ8A 5D3GA 4ZJQA 1NDCA 3X3UA 2DNYA 4NLUA 4FBUA 4WP3A 5A6WA 1RT2B 1LFWA 2AW0A 4ZN1A 2F9DA 3JSMB 3MEDB 2OJ3A 4QW8A 3JAMU 3MAAB 2OPSA 5F8JA 1LXNA 5L1IA 4X64J 3UVJB 4JI1J 2YKNA 3K59A 4K2XA 3V2UC 1OQ3A 3CO9A 3FMBA 4KHRA 1PO6A 1K0VA 5E3CA 2UUBJ 3AQPA 2O66A 4RUCA 2RAQA 4F4WA 3W1YC 2OPRB 3MM6B 2UUAJ 4CH1A 4YR3A 2ZWOA 2EC2A 1FF2A 3TVZA 1WF2A 3JTPA 3N4WA 2CQPA 2HQFA 2XI2A 5C24A 2MZQA 1JLFA 3H90A 4RW8A 2U2FA 1IKXB 1ZAVA 4Y2IA 2FPHX 1DJ0A 2P9EA 4E98A 3BGRB 3AODA 1CULB 2FTRA 3Q8SB 4MJWA 3OR2A 2Z4PA 1LK5A 1KLMA 2OMLA 1C1BB 1C1CA 5E2QA 3BZQA 1TAQA 2WZ1A 3OD2A 2L41A 3E8OA 3OJUA 1Z4UA 1XIQA 4X4RA 2NZ4A 4NI2A 1HLWA 4C9DA 3KLHB 3GXQA 3BH7B 4I6AA 4CTAB 2MLXA 2VF3A 3WDOA 3BPSP 3IO1A 3UCUP 1OJ4A 1N32F 1RT1A 2F8HA 1IKVB 1C0TA 3GIJA 2HHQA 1HPZA 1NK7A 4ZMMA 3EPGA 4DQPA 4IG3A 3DU6A 1L3SA 4B3SF 2R7OA 4QBUA 4A4JA 2CNKB 4IFVB 1PARA 2DJWA 4BHQA 3VV2B 5HO4A 2BV3A 2VFVA 3OHBA 3Q0AA 4MIWA 2W24A 2KL8A 3US5A 2OTLS 1FRIA 2BKPA 2QJ3A 2D74B 1NSPA 3KG4A 3NOCA 3IR7A 4IKAA 2ZJQQ 3PIOQ 2DPIA 2QLJB 4MKYA 3QFHA 1UPPA 1M1GA 3GLJA 4XK8C 2YKAA 3VW4A 2X3DA 1FFSB 2D1CA 3OTEA 1QSSA 3ET6B 1RT5A 3ISZA 1PC4A 1YJWS 2P5VA 3PYGA 1X7VA 2KXNB 5L8RC 5HQ8A 2CG4A 2JWNA 1M5PC 1TKXA 5J2PB 1SH3A 1MYKA 1S76D 3ZZTA 3W5ZA 2FQQB 1SKWA 4ZLPA 3F44A 1TL1A 4N56A 2EKNA 3DLBA 2C2OB 3GV7B 2IVMA 1UW9A 3DOLA 2D69A 4NLSA 5E3AA 3TZYA 2M52A 4M5IA 3RW6A 4PXBA 1W2IA 4P74A 3HX9A 2J5AA 2V8PA 5KFBA 2H1OE 4ELVA 1RWWB 4U95A 3C15B 3L9ZA 3HHLB 2I9SA 5D0GA 2ZZMA 1HBNA 1YDLA 1HNXF 5ETTA 4C2MA 1ZYQA 4DL0C 2R7SA 2B5JA 4LRDA 1WSVA 2ZH5A 3IFEA 1HIYA 5HVGA 3FMWA 4KYZA 3Q24A 4X4UA 2BANB 2LYVA 3LAMA 2VG7B 2AJ4A 1WELA 1MLAA 2RQCA 1VCTA 1TQLA 3HVWA 2E5LF 4DLGA 2P9CA 3F73A 4ANCA 5D4LA 2O1PA 4RWXA 1RUSA 4B9NA 5E3RA 1NBEB 4F3OA 3CDAA 2YKMA 1RTIB 4AL7A 3BN7A 3GYXB 1CS4B 2GX8A 3D7SB 2BRLA 5CA5A 3KLIA 2QMXA 3DLEB 4ED6A 1QAYA 1QAIA 3HHLC 4QWDA 3OVBA 2DIVA 5LMUF 2C22A 4HHJA 3ILIA 3FK4A 4QIVA 2DIUA 3WBZA 1IM6A 1FNXH 4CI0B 1M1HA 4ICLA 4ZJLA 4J9RA 1U1QA 2LA6A 2QEXS 1TVRA 2DH7A 4ME7E 3W9HA 3DRSB 2MQQA 2ZBIA 4B3OA 3TW0A 3KMQA 4JI2F 5A76A 4OFZA 3CJKA 5C2GA 1FDDA 2AT1B 3P8BB 2DNQA 3RRHA 2DB1A 2QYGA 4NA3A 4TN2A 1XEZA 4Y0FA 5DG8A 1VDHA 3M2RB 2FZGB 4ED8A 4EZ6A 2Z30B 2GHWA 1U1RA 4TU8A 2N4DA 4ZPAA 3QGPA 2BSQE 1RTHB 3DRXA 3HFKA 1JWWA 2DHHA 5EUHA 2V50A 2WBMA 5D78A 5CD4H 2OPQB 5DGBA 4ZVEA 3A8JA 1WTFA 4YOEA 2MQMA 4H4MA 1OPZA 1N36F 4ED5A 2ASYA 3U1LA 1OY6A 1YLXA 4ZVUB 1ICEB 2C2EA 1NO8A 4ZVPB 2RH3A 4UT4A 1S59A 4DX7A 3B82A 5HBMB 5DM7Q 1G1XA 2MXYA 3UCGA 4QU6A 2AEJA 3AOBA 2VQEJ 4NEZA 2RUGA 4OX7A 2VQEF 3LPEA 2VPXB 2LQ5A 3CDBA 3IGNA 1HNVB 1OHNA 4KKOA 3PHEA 1JX4A 1F2HA 1YJRA 3E3XA 1LKZA 2CQIA 4NCGA 4LJMA 3L7PA 1RSCA 3TX8A 4P72A 4W90B 2WTFA 3HKZD 1S49A 2MQNA 3PNIA 2FVSA 5A8RA 4LFAJ 1SV5A 3EGVA 3J81Y 3MEEA 1AT1B 1RHRB 4ZVTB 4KHPF 4LFAF 4O3RA 2N82B 5I42B 2BEFA 3KKFA 3KLGB 4ZVFA 1PILA 2CQ4A 1FJGJ 1FERA 3TVKA 4QR1A 2Z2MA 3TA2A 3CD7A 3GILA 3A13A 3W3SA 4TYBA 2HNZA 4CM2A 3LP1A 1WF1A 2GGPA 1GEHA 4Z7YA 4GC7A 1AROP 3CMQA 3HZGA 3RZAA 3D28A 2R9LA 4FYVB 3HP6A 2GQCA 4ZP8A 1HNZJ 2MQPA 1R27B 1CPZA 5HL7Q 1UFWA 2KG0A 2E29A 3OL6A 4N41A 2BJDA 1HNZF 1UFLA 1V5VA 3TZWA 2CUYA 3N6LA 3TRGA 1U26A 4AXIA 3PRDA 1RT6B 3JSBA 4IFYA 2CDQA 2XMKA 4L73A 3T5KA 1K1SA 5D4PA 5T7LA 3AXMA 2YNIB 1S57A 2MZ1A 1HQEB 3AB4B 4N8OA 4Z7CA 2B3TB 4ID5A 4FYXB 3PJWA 4C8ZA 2E44A 4OHXA 1TK8A 4C11B 1UP1A 3KMSA 3CPWR 1RT7A 3U02A 1U8WA 2W4CA 2EFGA 2E1RA 1D9DA 4ILRA 1URRA 3LOUA 4I64A 1W2BR 4F02A 4OI1A 4MIBA 1W25A 2KVIA 2QSWA 5CZVA 3OPKA 2OTJS 2QYCA 1JK9B 1YZ7A 3LF0A 2HYIB 3W7BA 4XDCA 4X4NA 1S9EA 4NWBA 3MZIA 3IRXA 4IUFA 3SFUA 5B0FA 2QIFA 3ELHA 3DRRB 3T9NA 3M32A 4RR5A 3KXDA 3I55S 2JXGA 5KFEA 3D6MB 3RUBL 2CJXB 4O3NA 5GVQA 1LWFB 1RWKB 1JQGA 3WC2A 3D3CJ 2IDLA 4R5PA 3G82A 4KFBA 1VC5A 3W65A 4DFPA 1Y11A 1UWAA 4H4OB 4PG8A 3CXCR 2QLFB 3BBFA 1B64A 4USWA 2H54B 4Y28C 2ZH2A 5IQ6A 2ASLA 5DZ6A 4DL7A 3OL7A 4DV2J 2BE9B 2EFOA 3UDCA 3HD2A 3IS9B 4ZHRB 3FZBA 5A8KB 1QE1A 1UL3A 4W98A 1UPMB 3FBCA 2DR8A 3PKYA 1OG7A 3SSQA 3HSZA 2GHVC 1YITS 5LJ3Y 2W9CB 4NLGA 4OLPA 3M8SA 4ED1A 3AXKA 2HZAA 3FNNA 2C28A 5KG5A 4HTJA 1KQKA 1CJUA 3OTBA 2W2NP 4KC5A 4B9UA 1HMVA 5AXKA 2K7JA 4JI5F 4LMZA 5IT9U 5ETRA 1KQFB 3H2UB 1R8PA 1HBOA 2YH0A 4DQRA 1WDDA 3CSKA 4PUOA 2CQCA 1AXQA 2FLNA 1T9VA 3MAHA 4P2SA 3GYGA 3DYAA 2MZRA 1LW0B 2GVZB 2IRYA 3J81j 2HLUA 2DRAA 1S9GB 1HBUB 1RTJB 3TEGA 4FPRA 1UVIA 3QRRA 3FEXB 2V4JB 3UN3A 2KFYA 3MXHP 2XMUA 2MMYA 2R7QA 2BM1A 3MR5A 4D3GA 4DOZA 1D1UA 2BA3A 1G2EA 1S0VA 3A3NB 4IOBA 5CYJA 1RAEB 3KG1A 1BLUA 1EIYB 5B7WA 1BQMB 5IOLA 1YQHA 2RQ4A 2RILA 1SI9A 2FJVA 1FRXA 3NGKA 2LXFA 1KVJA 2IJFA 3O5TB 3CJ8A 3FVYA 3IG1B 4EFAC 2OIHA 4NXMF 2B8QA 3CJ5A 4K4WA 2WK4A 3O2IA 2I5JB 3FEZA 3IRWP 1RQ0A 4DV6J 2EFQA 1QAJA 1YX2A 3ZTRA 4MYUA 2R7TA 4QCLA 2CQ1A 3NWRA 1JLCA 2HIYA 4G6VB 2BA9A 2ZZNA 2HNDA 1WG5A 1FXLA 1H3DA 1FE0A 3KG0A 1ZM2A 4DUZJ 1N0VC 2V6AA 4OZ1A 3NKYA 2BJ9A 4PG7A 2MKHA 1NUEA 4NPOA 4DQSA 1IBMF 2EBEA 2HK2A 3R9LA 1Y7PA 4ED4A 1JLGB 2MLZA 3UPFA 2YKQA 1N4LA 1Y5IB 4CO5A 2VBXA 4CLSA 4RU9A 4WWSA 3BGFA 3F56A 4PCQA 1WKKA 1RABB 1YRTA 2ROEA 1QAXA 1K1QA 1JB0C 5KFDA 4OV6A 3W61A 3H98A 3FFIB 3CCQS 1LWEB 4LVNP 3OJSA 3IWNC 5KT5A 5HI7A 5J2QA 2KXHA 3GR0A 1KOOA 3D67A 1Q5YA 1B7FA 2K7KA 4PQUA 2QV6A 2YY3A 4UY85 1FE4A 1YVFA 1GMWA 4RJVA 5KFNA 2R7VA 3ZNJ1 4ED3A 5KAKA 2Y9HA 1S6PA 3CEDA 2DXEA 4YY3F 4B9LA 3NBPB 4QIFA 2J9CA 2ADBA 1YIJS 1NNDA 4FBTA 4WFZA 4ZPDA 2MB0B 3BSNA 1FTCA 2HS0A 4QZVB 5GAHI 4DFJA 2XGQA 5GAEI 2XLIA 4HDHA 3N0VA 4M5KA 2VG6B 3CMAS 3BSOA 1SJRA 2PE8A 5CYMB 2XNRA 3G5OA 2DBBA 1H0HB 4D3HA 5F3ZA 4K5RA 3FJ2A 4CLUA 4ZP7A 1HKAA 3SQOP 2I1RA 4YB6A 1KFSA 1IQZA 4FZVA 1N48A 5KFAA 5GAHU 4O44A 2UUCJ 2HVZA 1D09B 1I5OB 2J9EA 2HBYB 2A2DA 1DQ9A 2B4PA 1S1XB 2HHTA 4KSEB 3DXBA 4LR8A 5ETVA 2K1RB 3OR1B 1VQYA 3CJ2A 3DCAA 1S10A 4NASA 4B08A 3MFHA 2YWKA 1MMDA 3TX0A 5CABA 2A0FB 3KJQB 3KK3B 2YPZA 3LUYA 4MJKA 5K8NA 4X4VA 1X9SA 1U2CA 1DLOB 3O8WA 1NH8A 1S77D 1MNEA 1FTRA 1NPRA 1HQUB 4F0KA 1KP6A 3DLJA 2UU9J 3PYEA 1R8CA 5DG9A 1BQNB 3ZZRA 1TV6B 3ZZPA 2YH1A 4NRTA 3VEAA 1WEYA 1O0PA 3VGSA 1U02A 2AHOB 3MMBB 3JS9A 1MSWD 1SL0A 4OMFG 3C14A 3HO1A 4WE1A 1U1PA 1PYSB 3IBWA 4ZPWR 4ZITA 1H98A 4JI6J 2CQBA 4B9SA 2XSFA 4DZDA 3G6XA 2GA7A 3AA9A 2D3UA 4HHUA 4JI6F 2JC0A 3GIMA 3DOKB 2UXBF 2VOPA 4RNHA 2CJYB 2D3OR 2AGOA 2ALYB 4DF4A 3DRPB 2C3UA 1XMQJ 1CJVA 2DNMA 2JH3A 4NZ7A 3E51A 1M90T 3R6LB 3W2WB 1EQMA 1XMQF 1S6QA 3QIPA 4ED7A 1IVZA 1VQSA 3CD6S 4OYWA 4MAKA 4FXWA 2Q66A 2JSXA 1H7XA 2YNFB 1DTTB 4DR1J 3PG9A 5AJ3J 3QQCD 3GB0A 3MI7X 1RT2A 3M9OB 5HP1B 3JSMA 2UXCJ 3MEDA 2CPEA 3ZTOA 2OPPB 4Z2XA 2G0IA 5DS7A 4ECSA 2E9RX 3MAAA 4I69A 3HZEA 1M1KT 4C8MA 1EKRA 5J1PA 2XMTA 1NK0A 5H1SV 5H9EK 2RF2B 2VKRA 1VJQA 5DJBA 5BYSA 2JEFA 4J7CA 1WEXA 2A18A 2MKCA 3M05A 3NNAA 2YWWA 4JI7J 2JFDA 3VZIA 3I56S 4DV5F 4OZ2A 3CJTA 3I4PA 2OPRA 3QFWA 2IJRA 3MM6A 3TOQA 1IQTA 2PC6A 3H7HB 4DCOB 2GO9A 3N79A 1UEUA 3MOJB 3A4TA 1RJJA 4DL6A 8ATCB 3BO4A 2ZNZA 3MTKA 1IKXA 1B0TA 1VLYA 4OX9J 3RBEA 1FKAF 1CULA 5DG7A 1FK9A 1C0UB 1WC0A 2GHPA 1C1BA 1RISA 1NH7A 2OFGX 4CT9A 3QRPA 4WF9Q 4DL5A 4U6PA 3DRYA 3FCWA 1VQ8S 3NCPA 1JLQB 3KLHA 2DNRA 3UNYA 2OHDA 2FY1A 2LQJA 4XTTA 3LGHA 5F0UA 5LSRA 4CTAA 1GQEA 1XTZA 2NR0A 2FJDB 4KPCA 3KTQA 3QBCA 4RO0A 3TJ8A 4HEA9 2KU7A 3CT9A 3LALA 3D1QA 1TFWA 1U0SA 2JEGA 2ZKUA 1KWMA 4CT8A 2HLTA 4C0HA 2IM3A 4X4PA 1RT3A 5F8GA 4CZCA 2V8VA 1CQNA 2MY8A 4IFVA 2HHXA 4JOUA 3AAWB 3IN5A 4PG6A 1JJ4A 2F5GA 1KQGB 2B7BB 3RRKA 1DARA 2V0NA 1FFWB 3CCVS 5KT4A 3DGPB 4YR0A 3EE3A 4H54A 4CO1A 2V69A 5KFCA 2FJAB 2E1AA 2YKNB 3C66A 1ROFA 4X66J 2CA9A 3UDEA 3DDNA 4B02A 3P3DA 4NYPA 4G1PA 3HJVA 4K4XA 4J37A 3J7Z5 1YKWA 5A2QY 2KZZA 2QA1A 1VQ5S 3TP2A 5LJ5Y 3MPDA 2ACYA 1FI4A 1KLNA 3OQ2A 3ET6A 1REGX 5JXSA 4F4YA 1U47A 4J5OA 3BGUA 4ZVRB 5ETPA 5J2PA 2FGCA 4UZCA 2DTJA 3T5HA 2K2PA 4L75A 2WHOA 3NGTA 4ECTA 2XYHB 2WCXA 3GG0A 3AOAA 4ES2A 2XBPA 3KYLA 3OR2B 2D9PA 5IM0B 1KLMB 2DEJA 1RB0A 1C1CB 2W2QP 2CRLA 5BYRA 1N5SA 2G0CA 4ZKAA 2ATLA 3D6HB 4TU9A 4NI2B 4EGLA 4M95A 2CNNB 4MTPA 1GX5A 1RTZA 3C15A 3I9ZA 3HHLA 2Y1IA 3TI0A 2KOEA 4RBUA 1SJQA 2KDOA 4CP5A 4P2XA 4NYZA 1H72C 2WBRA 1WOOA 2HVDA 3QLHB 1S9FA 1EB0A 5DQIA 2BANA 2Q6BA 3VZHA 4J9KA 4I7FB 4NXNJ 1HPZB 2C3MA 4DSIA 1P9QC 3BQ1A 5L1JA 3PX0A 4HT7A 2VD3A 1XNQF 2IFXA 3CUNA 4YHHJ 3RG6A 2BR0A 3NAIA 2ZUAA 4G65A 1RTIA 1CS4A 4J9PA 2H9ZA 2OLWA 3DLEA 2MKIA 3G4SS 2BVZA 1SKSA 4UZBA 1SQFA 2CZ4A 3UN5A 1RAFB 1FVQA 3PFEA 1RU2A 2GJ2A 3DRSA 3G8TA 2EXUA 4FF1A 3D68A 1RU1A 5CCLA 2KI2A 4MK9A 2RKIA 1RT5B 4OHWA 1YJNS 3CO0P 3H59A 1BHNA 5HJXA 1ZPWX 2Z56B 2XCAA 5IXUA 2DR9A 2Z8QA 3PKMA 2XMVA 2W4DA 2CAXA 1U49A 1V3ZA 4LF4F 1TL1B 2F4VJ 2DNKA 4OI6A 5HMXA 2UVWA 2Y0SD 1T94A 4RW7B 4DSKA 1RYRA 1TL7A 1HI0P 1IBKF 4KGXB 2DK2A 2DO0A 2OPQA 1KSPA 4GO7X 1DQAA 4UW2A 1F1BB 3UDLA 3OL9A 4IO1A 5L39A 4PRFA 3SZ2A 1ZOTA 1VHFA 2KKEA 1A9NB 3HM9A 2LQ9A 3ILJA 3FSIA 2W8LA 5HBMA 1QUPA 3VAHA 4LF5J 2MQLA 1O8BA 2CIMA 3BS9A 4DV3F 2JC1A 5J2NA 2PMWA 5T41A 5AE2A 4UTGA 1I94F 1HNVA 2LXUA 5GMKa 3P96A 3LTOA 4F50A 3FBEA 4YQWA 2E1PA 3BH6B 4Q0BB 3HULA 2A6OA 2LEPA 2DXDA 2FVCA 4YUDA 2NXCA 3SEOA 4ER8A 2XMWA 3B78A 3GWCA 4ICLB 3M2UA 5I42A 4ECVA 1RDRA 3N5FA 2HFOA 7AT1B 2HGNA 1VQNS 4CYUA 1VRTA 4G3IA 1S5ZA 4A8XA 3QIDA 4GC6A 3MM8A 3POTA 4B3OB 1H73A 3KLVA 2NPIA 2HHHF 3MM9A 2E5IA 2BACA 1D3WA 1Q1KA 3EX7B 4KQZA 1RK8A 3SYZA 1RE1B 4YMEA 4LF9F 1ARQA 2CFXA 4WK1A 4PEOA 1RP5A 5KOXA 4J9UE 4USVA 2J9DE 3LW5C 2VOOA 2M5YA 3PJ9A 5B0GA 4CH0S 2OGUA 5KG4A 2Q6CA 3QMQA 1Q5VA 2QL9B 1UETA 1H74A 2FHOB 1CQMA 5ITHA 3LPYA 3Q86A 1QSYA 5GMDA 4P2FA 4TY9A 2ZE2B 2JLFA 4RKUC 1RT6A 1S4FA 2DRBA 3K5NA 4USTA 2ZZTA 2NXJA 1J5EJ 1MWYA 2H5IB 2YNIA 4A8OA 3I0RA 1YWXA 1J5EF 1IWGA 1RCXB 1OSCA 1VS3A 3I5BA 4J9QA 4YS2A 4PWDB 4GMKA 4A47A 1ZM9A 5HQLA 2W01A 3KUGA 4C11A 2MKYA 4OYXA 3KHLA 3K5PA 2D7SA 4KAIA 4AQYJ 2AJ1A 2LVWA 1GMUA 5E7OB 1TMMA 1ULRA 1VBKA 2V63A 4MFBA 2F9JA 4NCGB 2IM1A 3QSIA 4NE9C 5JMNA 3WC0A 4DV4J 4BCAA 3GFXA 2RS2A 3C46A 4IDKB 3R2CJ 1RHJB 2GQ2A 4MH8A 2A2CA 6FDRA 3D1HA 3MEEB 4XPCA 2K3IA 3OXFA 2VPWB 2VC0A 3CNQP 2ALZA 4AAIA 4UOHA 3DRRA 4Y34A 5M2UA 3GQCA 2ZC4A 3H20A 5IWAF 2F40A 2V8DA 5HAOA 2PMZD 4IG0B 2K9IA 2VFSA 4J9SA 1WWHA 4RNOA 5K8OA 1BQXA 1N33J 3LP1B 3TA0A 1W26A 3UWTA 5KFIA 3OUYA 2DRDA 4K4VA 1N33F 4H4OA 1H2TZ 1TZ0A 4P9SA 1IBCB 4NZ6A 5CYQB 1Y5LB 3DLLQ 2LP4A 4AL6A 4JI0F 2OEKA 1SKRA 3H5YA 1QTNB 2YTCA 3M8PB 2FHMA 1HWIA 2MHNA 2OELA 3GJRB 3DHXA 4WJBA 5G0RB 1YRUA 3IS9A 4ZHRA 3G87A 1S0MA 3RU0A 1S72S 5A8KA 4QPTA 3IM8A 2JOQA 5IT4A 3KJVA 1PJ5A 2QA2A 5T7LB 1WC1A 3NS5A 3CJRA 3BYPA 4F4AA 2LA4A 1U6ZA 1FRLA 2W9CA 3CD0A 2DNNA 4ID5B 5I4MA 1VK8A 4PXCA 1GT8A 2BE2B 1N5TA 1B0PA 1RT7B 1S48A 2WVBA 5DQGA 2EK1A 1VBXA 3CW2C 2CQ0A 1MN7A 1RHUB 2ZVIA 3CC7S 2GVZA 4XIUA 1WORA 1O51A 2I0XA 3NO7A 3U7JA 2IRXA 1MMNA 1RCOB 2ZH7A 1HBUA 1RTJA 2DGWA 1HWLA 2B4UA 2HURA 3TQ1A 2V4JA 4B9TA 2VL1A 4UOGA 3MR3A 4WFNQ 4LRBA 4QR0A 5C42A 1UW4A 1RHQB 3OLAA 2DT9A 1RACB 4I6WA 2FC8A 5EDWA 1RWMB 2GV1A 1F9FA 3L3CA 1BQMA 2C3OA 1JIHA 5J2MB 2C2NA 5DDRC 4DXLA 4CWBA 4DPXA 2BW7A 2WW8A 1E6VB 1QD1A 4K4YA 3OVSA 1VIOA 2GS8A 5ETSA 4IR9A 1T95A 4FP9A 2FHJD 4KFBB 1SKUB 4X62J 2IM2A 2I5JA 3R5CA 5LSOA 3NS7B 1Q8KA 3BDPA 1HARA 3LGMA 4X62F 2UXDJ 2IA6A 1T8EA 2OKQA 3ADAC 3RW7A 4LF7F 2AIRB 2PMHA 2C42A 3R5DA 2PN6A 4DPUA 2M3DA 1L5UA 1QE1B 4DJBA 3C8YA 5KFPA 4KPYA 3GIKA 4P10A 4F4KA 4A8WA 3G9CA 4ENOA 2RDJA 1RTDB 4OYOA 5LL6d 1YJ7A 1Y10A 1VQ4S 3QAEA 4NLYA 4J90A 3THVA 5CQGA 4FVMA 2D3O1 1UVLA 3PZPA 2RB7A 3AD9C 1SPBP 1WF0A 2HWHA 1HMVB 1Q7YT 2VG5B 3M6WA 3RB6A 2F8MA 4WPAA 1HBOB 4LF6F 3R5BA 1HBMB 2PSZA 1NCLA 3GFHA 5AXLA 4LRFA 1TUGB 2BE7D 2DGVA 2ZOMA 2PGCA 2ROGA 1HW9A 2XMJA 4DV0J 1BXNA 2KG1A 5DGAA 3PW4A 3VQTA 1JJ2R 3AB2B 3DI6B 2MPUA 1LWEA 1RAHB 2CJQA 3IWLA 3P45B 4LF1A 1NSKL 1FDAA 3QNWB 3IAM9 4WZQA 2KRRA 3KUEA 5DM6Q 3CCSS 1VK3A 1FD2A 3MEGB 1UJ6A 2KO1A 3UI3A 1M0SA 4FXEA 2CKWA 3AFGA 2GNKA 2QFIA 3M1VB 2BQ3A 4A8FA 3CJ3A 4ZVSB 3T19A 2V9WA 3NBPA 5KOWA 2PDAA 1HFEL 2VH7A 1P94A 2V2KA 4RW4B 5KFFA 2VG6A 3DM2A 4GKKJ 4OX6A 4NX9A 2F4FA 3PEJA 5CYMA 2KELA 5ETLA 5F41A 3OFEA 4JI3J 1FWLA 2QA4S 5D8HB 2Y8WA 4MKVA 4RUAA 2H3EB 4HACB 1TTHB 3H4BA 5AE1A 3H2VE 2O67A 5F9LA 2K5JA 3JTOA 3DLGB 1S1XA 3OTDA 3MPWA 3HT3A 2E5JA 2ZH4A 1T05B 4DUTA 4FKYA 1GTHA 1UZDA 2VFUA 1NJWA 2K1RA 2VBZA 1RWOB 4I1TA 3CD5A 1CJTB 1Q53A 3KK3A 3R5GA 1CC8A 2WSEC 2YPYA 3GFZA 3MCSA 2ZM6J 1R8HA 3MTJA 3K5LA 2NCKL 1K47A 3IP0A 3VVUA 3RJMB 4OI0A 3CCUS 3TYTA 1BQNA 4IH7A 4M5DB 2W2OP 2VQFF 4HV0A 2KXFA 1XMBA 5KFTA 3T1HF 1IR0A 2UUTA 3MMBA 2PFDA 3TVYA 5CXTA 1P1TA 2X3GA 2DHGA 1B3TA 4DG1A 2FVRA 3TAPA 5J2QB 3FT7A 1FX4A 2B7CB 5KG7A 4DS4A 1FNOA 4MKAA 3DOKA 3T1AA 4DS5A 3X1LB 2EWHA 4W4MA 2RSQA 1AW0A 4EI2A 4M63A 2WB4A 3FUYA 3HD1A 2GMJA 3SCKE 3DRPA 5E0OA 2X1BA 5CCMA 4DR3J 1ZBTA 3ZZOA 1UVKA 1TK5A 4AXJA 3W2WA 2XY5A 4K2JA 4DR3F 3PACA 2DNZA 3M6UA 1S6PB 4C3MA 3QGHA 3N9UC 1N52B 5B0BA 3NXZA 5GADI 4CO0A 3CDUA 2YNFA 4PABA 1U6BA 4UQTA 1DTTA 1QJHA 1RBAA 4DR4J 2HAIA 3UD3P 2ZVSA 2E1MC 5HP1A 4GRSA 4HLBA 1SIWB 2KHDA 2OPPA 4U8VA 2HWTA 2G2YA 4TNOA 1TK0A 3GSDA 3JXOA 1SC4B 3MPUB 3PDNA 2BM0A 3SCLE 2IJNA 4LFBJ 1HNIA 1T7PA 2MSTA 4NCBA 3QAUA 1EETB 4KB7A 2H1YA 3KWMA 4O44B 4KY3A 2ZFHA 3HVTB 4M1KA 4C8NA 3S6EA 3V6HA 1U1OA 1RKIA 1QDUB 2ZUGA 3T5LA 4NL5A 2AJQA 4EO6A 4KHMA 4USUA 4NLRA 1QTMA 2XY7A 1KS2A 4J9OA 3Q8YA 3TUZC 5T14A 3J7YI 1PJ7A 1MWQA 2D9OA 1VC6A 4PAAA 2HQCA 3GP9A 1VISA 1BY9A 2RVJA 3CULA 2XWYA 3PIPQ 2GJFA 3JAMY 1LWXA 2GFFA 4FDFA 3PYDA 3HCXA 3WZ0A 3M9MB 4WTYA 1C0UA 3W8GA 2AJ0A 4WE1B 3OLBA 5F8NA 1B7YB 1W7WA 1Q16A 2HW3A 2LFVA 1VQLS 2LQ8A 2CPZA 5HQMA 2RE1A 3W66A 4DR2F 1JLQA 2IM0A 3M4XA 2BQUA 3C6TB 4Y2CA 2R2UA 2HFVA 2HZCA 3ULHA 1TU0B 1LWCB 2ASDA 2ZH3A 1U48A 4GO5X 4DN0A 4PWUA 2VBWA 3CCRS 3IR5B 5K8MA 1U4BA 3OTOF 2BUNA 3QIPB 1WC3A 2UVUA 4DR6F 4I6YA 3AJDA 4MT1A 4EYHB 1DURA 1KBRA 3MEKA 4EEYA 4ZCIA 2B9XA 2UVRA 2M7SA 2GIRA 3K57A 3W9IA 1VQKS 5EX3A 2XI3A 3MFIA 3DGPA 3S01A 4MK8A 2DNPA 2N7CA 4CH7A 2M8DB 2HVHA 4M5NA 3CCJS 3I4HX 4C7QA 5K8PA 1NK6A 1J2VA 1IR2A 1X93A 4ZPVR 2H5EA 4X64F 4JI1F 4CLTA 2DO4A 1S0NA 1SIZA 2RMLA 2QMWA 5AXMA 2JBVA 1YBUA 4YN3B 2RDDA 4WBFA 2KT5A 3VCDA 4TYAA 2UUBF 4PYAA 5CAAA 4NA1A 1AUSL 3J80U 2KKHA 2HVIA 1N0UA 3T5JA 3LQVA 1KKHA 1OIAA 3GSIA 2UUAF 3NNHA 1KR4A 2FB0A 1IKWA 2M70A 2NUUG 2IRUA 2IYIA 4ETXA 5HATA 1TFYA 4AT1B 3GCWP 1YJTA 2NUHA 3D0GE 5ETOA 4F4XA 1H38A 3GJQB 1FK9B 1WKJA 2J9DA 5IM0A 1K0TA 3SSRA 1ARRA 2APOA 4O3OA 4E8UA 2BJ7A 3SDEB 3VEBA 4YB5A 3SXLA 1WOPA 1HYSA 4PG5A 3ETMA 2Y8YA 1RYSA 4DL3A 2XS5A 3J7A1 2KYZA 1TL5A 3W63A 1FRMA 3QLHA 3K0JA 4I7FA 1ZAXA 2QLXA 1KFDA 2R2TA 4FN5A 3BPDA 3P4UB 2V8GA 1RT3B 2BX6A 4Q43A 5BXIA 4O0IA 5D0HA 2IY5B 4CLWA 2VJVA 1RI7A 4OZNA 1ELOA 4TKTA 4F2SA 3PJXA 2ZHOA 2AGQA 3N01A 5HLFB 2CJAA 2J8SA 5KG1A 1EZZB 4OJGA 4ECXA 4JV5J 1C4CA 1IWAA 2G1DA 4OV1A 4FVCA 1FKPA 3PTWA 2IYGA 3ENAA 4DEZA 5GAGI 5E41A 3MWBA 4CLZA 3VAGA 3NWGA 1EAYC 4UOFA 2WB1D 4CLKA 3ZZYA 4U67Q 3EZ5A 1T9TA 2UP1A 2D3ZA 3GJSB 3CF5Q 3JSRA 4J9NA 2BXJA 2KN4A 2W9BB 3VAFA 1K44A 1RBLA 4WFBQ 3LWMA 2B8PA 1IBLJ 4DF8A 3U1MA 1M5VC 3Q2SC 2P2CB 2GAGC 4RW7A 4B3TJ 2HFZA 1LK7A 3AJ1A 4OYBA 1YZ6A 1QY7A 4M5MA 4C8YA 1Y3KA 3D6TB 3IBCB 2RU9A 5D0RA 3V6DA 1X4AA 3O44A 4NCAA 2CPFA 2HQ3A 2CPGA 4P71A 3K8VA 1NEEA 6AT1B 3ZZ0A 4S0MA 2CWXA 2GC8A 2XWXA 1N8RT 2FZKB 5LOQA 1MN9A 1T03B 1T9UA 2AX0A 2HKEA 3PY8A 3Q8QB 4OX8A 2Q79A 1GXUA 4Y2AA 4FF4A 4KT0C 1U1MA 4FXDA 2LDYA 4PYDA 4OQJA 3CMES 1BDTA 2EFVA 3C3LA 5FIIA 4Q0BA 1Q8IA 2P6SA 2ILZA 4F2RA 3S1TA 2VHGA 3IBFB 4HHHA 2KHCA 1M5OC 4HL9A 4ZLJA 2XB2D 5HROA 4LSNA 4WP9A 3THTA 3TEHB 1XK8A 2EK6A 4CLFA 4K50A 2EG1A 1JXEA 3CDEA 2LU2A 3IAS9 1SQEA 3EGZA 1YSJA 4Q8EA 2R7WA 3RB3A 3RTVA 4B3RJ 4CO2A 1L3TA 2XM3A 1JKHB 1UKUA 2QX0A 2O01C 2RKIB 1SQGA 1UFKA 1CVJA 3CCLS 4DCJB 4TU7A 4V19J 2QFJA 4WFYA 4DPOA 2EKYA 3QZ7A 3W8PA 1TR0A 1XJWB 3ETOA 3FQKA 1SVDA 2J8AA 1U0HB 1SH2A 1FNMA 1HW8A 3KDOA 5KFYA 1TKDA 2MHEA 1OYDA 1TL7B 2BKNA 3H40A 2XTJP 2A1BA 1V3SA 1YJUA 1PKUA 4LFCJ 2QA4G 1CBKA 4ZS6A 5K14A 2ZE2A 4J91A 4LR7A 3OSNA 1NZ8A 3W9JA 4LFCF 2GW8A 1OPIA 2IAJB 1F5BA 4LR9A 3SV3A 5KFMA 4XPEA 4GVBB 2POKA 3LP0B 1B70B 4KIAA 4RW6B 8RUCA 4A8QA 2NXEA 4PWDA 4G1IA 3W5XA 4ILMA 3CC2S 5J2NB 2GIFA 3BGLA 4NLVA 2N3LA 1X4GA 1KN6A 4EZ9A 3PO4A 2ZDPA 1QUVA 3MM5A 4ECQA 4WXOA 1KQSR 2O3DA 4R8UA 2AEMA 1RWVB 2DPJA 1VQ9S 1FWKA 3H0PA 5IS2A 3Q8VA 3KUHA 1NJZA 2KB2A 3LGNA 2W7PA 4IDKA 4DR5J 1FKOB 4ZCKA 3F41A 2VICA 2OFHX 3ISND 3O6QA 2ZHAA 5A0YB 4K0KJ 1MYLA 3T1YJ 4QU7A 3QRQA 5DZ7A 3HSJA 4K0KF 3M2UB 3H2LA 1OY9A 2AF6A 2RS8A 2R2RA 4CYUB 1VRTB 1OMSA 1VLOA 1FJGF 1U45A 3MM8B 3POTB 3R27A 2LXIA 3D2WA 3A1YG 3VTIA 2HG4A 2EEYA 3GCXP 4I0WA 2M4MA 3MM9B 3ZNUA 4N8NA 2MZSA 4IG0A 1LQ9A 1ZA2B 4KGMA 5FLXU 4LBIA 1MG7A 2HMIA 1VOMA 2FDNA 4BWMA 2LKZA 1NMEB 4OHZA 1XQIA 5CYQA 1JLEB 3M8PA 2F63A 3TAMB 3G2XA 3BKTA 3QZ8A 3G6YA 1RHKB 1Q79A 4EO8A 5G0RA 2J7KA 1EA4A 4IRDA 4CQ1A 1GMVA 3M8QA 2ACMA 3ILLA 3MECA 2DXFA 1NSQA 2QT7A 1J5OA 3CJQA 1LEOA 4HDGA 4CIOA 3W2VA 3H5SA 4KH0B 4Y2MA 4NOHA 3I0RB 1NM2A 3K2YA 2GO8A 3QGGA 3NMRA 3QYYA 4QYZK 2DHAA 2J0XA 5D4OA 1BWVA 3UQSA 1S12A 2RHQB 2BE2A 5IC4B 3WX8A 5RUBA 2BQRA 2CPDA 2ABYA 5JVHQ 4OJ3A 2YBVA 3A8KA 1U9PA 2G9OA 4N5SA 4MFBB 2DGUA 3OL8A 1XN9A 1VBYA 3BKFA 2BNZA 1FXDA 2ZJRQ 3ZZUA 3CDWA 1NB2A 2QSFA 2B4VA 1KHVA 4FPIA 2OEJA 3PW0A 3EGNA 5KT2A 3HFZB 4LT6A 1ZM3A 4ID8A 3MHYA 3MCMA 3MMJA 1EP4B 2HIQA 3ZO7A 3EXCX 4JI4J 2HHVA 3RAXA 2GMHA 3HF5A 1SL2A 5J2MA 5KG3A 5HJYA 4JI4F 2IC3A 2KRBA 3GR1A 2AJFE 1E6VA 3TNVA 5IV4A 5IT9Y 2CVIA 3S8SA 2L9NA 1RT4B 1IUJA 4F04B 1P8GA 3OUYB 1NLAA 3N6MA 3P49B 2R7XA 5IFMA 3RBDA 4Y3CA 1R31A 3KHGA 1GX6A 2P6TA 2Q2KA 1HNWJ 1UWBB 1DBDA 3CCES 3KK1A 2ZJPQ 2MY7A 1EQ0A 3D3BJ 4DV2F 1FRKA 1HR0J 3G6ES 2MJNA 2EW9A 4A48A 2BDPA 2OSQA 3KJVB 1HD0A 1L3VA 1RTDA 1SJFA 2FLOA 2DNGA 3R3TA 2HZVA 2MZTA 4MYTA 1U7LA 4LVOP 4OL8A 3W5YA 4U7UD 2RQMA 5SUHA 3TANA 3VR1A 4BWJA 2F8EX 4QWBA 7FD1A 4WCEQ 3FMTA 4RWWA 2MKJA 4V1Ak 2CDRB 2PIIA 1GXTA 2VG5A 3LAKA 1RHMB 3LO3A 3ZTSA 1WKLA 3LP2B 1HBMA 4K4TA 2RRBA 3GE9A 2AZ3A 3MD1A 2CQ3A 4P7VA 5I3QA 2MQ8A 1CSJA 4QW9A 3H87C 1TAUA 4QYZJ 1UAWA 1VFJA 3DI6A 1RXOB 4PG4A 5J1EB 2Z2LA 3QJPA 3PX4A 3MMAA 3C16B 1Q86T 3N5BA 4NZ0A 2B6AB 5C42B 3IWXA 5K9FA 5EWGA 2ZD1B 4C48A 3MCOA 2JEJA 3MEGA 4MMOA 4C8KA 4PXEA 1R8AA 2KM8C 3W62A 3NNCA 1HWJA 4OHYA 3I87A 2HFUA 4RBTA 3KFWX 3ZZZA 4OYIA 3K7RA 3M1VA 2YWFA 4UY8T 2XCPA 3DFEA 3ENVA 2DGTA 4C0BA 4F7VA 1RAGB 4X2BA 2XEXA 2X1AA 3WHIA 1PYTA 2VDHA 4RW4A 1DRZA 4DV6F 1SJ4P 1F9HA 3QT6A 4ECUA 5L9NA 4HACA 3WIUA 3SV4A 2DCUB 2GVDB 1N54B 3MM7B 2DGSA 4CO3A 3QPIA 2VA2A 3DLGA 5AE3A 1RWXB 2AY0A 3KDNA 3FSXA 1T05A 2RD5C 3BGOP 1NHKL 4DUZF 3G96A 1R3NA 1NXIA 4CLLA 2BOPA 1CJTA 2H48B 4DX6A 4L72B 3JYTB 4YP3A 2E9ZA 2RU3A 3M30A 2VZ9A 4KRWA 3PEHA 3M2VB 3CGIA 2NPFA 2WVFA 3AT1B 3FBBA 4CLPA 1G4CA 4M5DA 2XZTB 2OI2A 2ADLA 1SH0A 3OVAA 3MUMP 4L76A 4P52A 2RRAA 4N77A 5ADZA 5IT0A 5KG2A 2QL5B 2JJ4D 5L1LA 4NLWA 4Y6IA 4ILLA 1FJ7A 1D9FA 2V2ZA 1PGZA 2XS7A 1MROA 4KR0B 5K5MA 1TMJA 1SB6A 1IN0A 1HHQA 1S4EA 1V5IB 1XR6A 2IA0A 4UQGA 4I67A 3HHNB 1M5SA 5CD4A 4RU2A 3CE8A 3M8ZA 1RZMA 1FD8A 1LFPA 2DCLA 2JXHA 4EWTA 3EMTA 4DHVA 4A8YA 2AMCB 3DM2B 3EVWA 1SIWA 4OZ5A 2W9AA 3IGVA 4QIWD 1PC5A 2F65A 2J76E 4FS1A 2PFFB 2WSCC 1X4BA 1P9YA 2N7YA 1EETA 1M5HA 2JLGA 5KFJA 3VALA 2D41A 1VQMS 5GAEU 3EVMA 1S1UB 3HVTA 1FJEB 1D9AA 1UA0A 2UUCF 1DZ5A 2NQPA 2CQHA 4NLQA 4P75A 4F26A 3A8IA 4ANEA 2FC9A 1JXLA 3BBCA 2WAQD 2B9WA 1S97A 2XGPA 4NRUA 2C3PA 1WACA 4CNYA 4RBVA 4QJVA 1Q8LA 4WYLA 3DOMB 3KLFA 1LXJA 4OLOA 2I8EA 4DLEA 4YR2A 3FRYA 3UE2A 1G7CB 2UU9F 3EZOA 3I32A 1N32J 2E9TA 4IQXA 1BGXT 3KHHA 1F2GA 1BUXA 2YKPA 4DG1B 3C6UB 1F5AA 4MK7A 4B3SJ 3EGWB 1YJVA 5C25B 3V4IB 1VYAA 2C2DA 2AZ1A 4NLOA 1HA1A 2JL9A 2NXUA 1R7IA 1P6TA 3C6TA 4K8RA 4TQRA 1LWCA 5KFKA 3HK2A 2XLJA 2B51A 3UD5A 1SJ1A 4F0MA 4Q8FA 2YX7A 4WKRA 3CIMA 2PO4A 2N3OA 1T02A 2CPHA 3MAQA 2ADCA 1Q78A 2Z2YB 4K59A 4DFMA 2IMOA 1GTEA 4DSFA 2RNEA 2JEIA 2ZC3A 2ZITA 1WC4A 2C3YA 4DR1F 4LSZB 5AJ3F 1S1TA 2UXCF 4YB7A 3EM1A 1JNRB 1HNIB 2QLBB 2WONA 2MQOA 2XO6A 2B43A 4OZ0A 2FJBB 2HEKA 2LECA 5M2PA 4EYIB 2ZBCA 4ZCMA 1OS5A 4FYYB 1R6YA 2YWHA 3HFVA 2QC3A 1WEZA 4C0OC 4A8MP 5KFUA 1FHTA 2QGFB 3KLEB 3ZFVA 4Q2LA 4C8OA 4ZLNA 2CPJA 4ZVHA 1UMJA 4JI7F 1N5QA 2CQDA 3J7ZT 4KTQA 2VJUA 4DMZA 2WRMA 1X5TA 2CNLB 1X4EA 1NSAA 2G0JA 3GZ7A 1PBUA 4U8YA 3MDFA 3R6GB 3TAQA 1ZPVA 2EFNA 4O4RA 3HPOA 1HNXJ 3DGVA 3OFHA 4ZPCA 3PV8A 4JUZA 2A10A 4DSEA 1PAEX 4OX9F 4NA2A 3I31A 4TXSA 5DDOC 1KD1T 4RX6A 2NXNA 4C6AA 2KFNA 2E5LJ 1Q16B 4OYZA 3SDEA 3LJPA 1MW7A 3TZZA 3W64A 4C3KA 4LSLB 3Q2TC 5KFHA 3L7OA 3NCQA 2XG8A 1G3OA 4ECZA 2N4CA 2A6MA 3HHEA 3ITHB 5F9NA 2QTWA 3BR9A 1OYEA 3WQPA 5LMUJ 2J6UA 2ZBPA 3TARA 2DGXA 2CQ2A 4OI3A 1Y0HA 2BRKA 1NB7A 1KHWA 3NL0A 5HMZA 1CEZA 4EUVA 3Q83A 3OXLA 3Q8UA 4LBHA 4WU3A 1Q82T 2AJ2A 1FA0A 4KO0A 4JI2J 3HLUA 3IXQA 1N5YA 5HLFA 2UVVA 3E01B 1X8DA 3A12A 2U1AA 5DDQC 1OQ6A 2HSEB 1FO1A 5KT3A 2DITA 3JSYA 1TUWA 1XMOJ 2VBYA 1Q8BA 2O5DA 1XMOF 1R6VA 4X66F 2Q43A 4WXWA 4YDDB 2FHKA 4ED0A 1HWKA 1O5JA 1FT8A 4I2QB 5IQQA 2CPIA 3FDSA 1N36J 4HKQA 1HL6A 3TUIC 4OZ3A 2DNOA 1IKWB 2W9BA 1V6HA 5HK4A 1YBTA 2VDIA 3QGIA 5I3UB 5E3PA 3PVXA 1VC0A 2HHUA 3KNAA 2EI5A 3G86A 1Z1ZA 4NLTA 3QJLA 1XR5A 2JXIA 2ZEJA 3RAQA 5D15A 4QWEA 2CPYA 2OSRA 1RWNB 1ZAWA 4BBYA 2Q3PA 2DHSA 5C7PA 1HYSB 1CG2A 1Q81T 3CTRA 3K5OA 2ZNYA 2DH9A 3HXMA 1PIEA 4ZP6A 2M0GB 2J6TA 3GMGA 4ZOSA 3Q23A 2DY9A 1T03A 2CXEA 4OIXA 3D9BA 1R0AB 2CJ9A 4CDIA 5A8WB 4LF2A 4NXNF 4KHPJ 3JQJA 1NK5A 2XHCA 2MTLA 4IOAQ 1AUDA 1UVNA 1EARA 1H2VZ 2G13A 2M2BA 2BNWA 1U2FA 2WVDA 4YHHF 4Y00A 1SXLA 2V8HA 4KGVB 3UR0A 3VAJA 3DDKA 2KVQE 1IM4A 5B0EA 5DO2A 2V94A 4WFXA 1FKPB 1LW2A 3HT0A 4KJIA 2C1EB 2AYBA 3ZXWA 4TLQA 1RLDA 1VR6A 1VRUA 2QN6B 4F36A 4KGKA 4D8JA 1S6OA 4ETZA 1JKHA 1NKCA 2QMUB 2X1GA 1I3OB 4CM0A 2KTQA 3IR6B 4NLXA 2A3JA 3R8YA 1GFWB 4HH1A 2HFNA 3J81U 3V6JA 5KFWA 4QWCA 3ZTPA 1RAAB 4J9VA 4RLEA 3EDRB 1U0HA 2GPEA 1T9YA 2UZAA 3QT5A 1KTVA 2OD4A 3DN9A 2F4VF 1I6JA 2JLEA 5ETNA 4AL5A 5FDLB 4OI4A 1RWUA 3V6DB 1Z2ZA 2KYXA 1N6QB 5FJ4A 1YK9A 3WIVA 2W8KA 2IAJA 1UCNA 2XHWA 3VAKA 4ZVQB 4GVBA 4AD6A 3V81B 2XO7A 3LP0A 1EJ7L 3CWJA 4RW6A 2H5JB 1K9MT 5KG0A 4DSJA 2OH2A 4UUWA 2K1OA 3RB0A 3HVRA 3K17A 3OT9A 3MD3A 4LF5F 1UJ4A 1NU4A 4F67A 3M9NB 2VODA 4I2PA 5F8HA 1SUQA 1XNRJ 2NSCA 1PBAA 1IRQA 5F8MA 1XNRF 4DDFA 3OBIA 2YNGB 1P1LA 1FKOA 4O3SA 5HROB 1S6UA 4LSNB 2XSJA 4G1QB 5A0YA 1S1VA 2GCFA 3BDEA 2OO4A 4HH0A 2J0QD 1Y3JA 5CZXA 2FY8A 2E66A 2W2MP 1WSRA 3SBMA 4O4GB 1HWUA 3ISNC 4UF4A 4M5GA 4DL4A 1I51B 3GG1A 2L48A 2WVEA 2ZBQA 4QR2A 1AZSB 2YKOA 3DC2A 3HMJG 4IQMA 1QLNA 3JB9k 1URNA 3LH2S 5FD1A 2G4BA 1U1KA 4LRVA 2IVYA 2KJVA 4DPYA 3OXGA 1N56A 4P73A 3DLHA 4DV1J 2XZDB 3MCNA 4CNZA 2YNHB 2MZJA 2CYYA 1JLEA 2GZOA 2V2QA 3NNEA 1T9WA 3TAMA 4DV1F 1UVMA 3BREA 4FKXA 5MAOA 2XZWA 1PCAA 4URSA 5K14B 5KFZA 4JI5J 2EBGA 1KNZA 5DRKA 4K4ZA 4UOCA 1VI7A 1DAXA 5KG6A 4TVAB 3G71S 3LWLA 3KJNB 1A6LA 3KK2A 4IOCQ 2R7UA 1CJKB 5C5JA 1Y00A 1E6YB 2AQ4A 2Z0GA 3H25A 2ASJA 3HVAA 4BDPA 2XY6A 2YWGA 3HI9A 2HAFA 4DV7J 3VAIA 3SI8A 2DKOB 3MM5B 4DV7F 2WW4A 1HHTP 3U1NA 4DCPB 3TUJC 2C2MB 4R8UB 4AQYF 2IBKA 3PFOA 3FCVA 4A8KA 1LOUA 1S1WA 2P8IA 1HD1A 2JZ5A 2ZBRA 2YQ3A 1OWXA 1NK4A 1WTBA 3BJYA 3KOAA 1F6TA 3R7SB 4DV4F 1F0XA 4CRJA 4DWIA 3EXYA 2HVEA 2IVFB 5JVGQ 2FHJA 3CIZA 4NXMJ 1Y9OA 1XWLA 1ZETA 4U7CA 4WU2A 2HBZB 2YWEA 2B9YA 2QE5A 4XAKA 1EP4A 4N76A 1N88A 3MR6A 1X4DA 1JLBA 1FXRA 1JLAA 5KT6A 2VPYB 4MKBA 2FLLA 4AFFA 1V9OA 3QWUA 4RW9B 3OW2R 1NLKL 4PXDA 2HGMA 3UNGC 1UZHA 4C4WA 5HVHA 2HMIB 1RT4A 3SCJE 4X84A 5F8IA 3AA8A 3HHDA 2BABA 3WX4A 2ZDOA 1WI8A 1SJ3P 1MU2A 4DQQA 3EJMA 2WOMA 3MUTP 3R5JB 4W92B 1T3NA 1UWBA 3RYLA 1IBMJ 4E0DA 1VRQC 5KTQA 3SIPB 3DKDA 1MWZA 5HN0A 3PW5A 5IZHA 2NZCA 3ILOA 3M8QB 1TKTB 4L6V3 1B99A 3MECB 2HWIA 1J5OB 3EWGA 3D6FB 3L09A 1UA1A 1VGYA 5LXYA 4NLDA 3W2VB 2BKOA 2HQIA 2IBOA 4H4KC 1UJ5A 5HANA 3OSPA 2B56A 3KNGA 3MMCB 4ED2A 3HDSA 5SZTA 2JHEA 1REVA 3K8WA 2MDAA 5HMWA 3LP2A 1H7WA 2J7UA 4LRCA 1XC9A 3IA0A 3MGJA 3NEKA 3S7RA 4DU7A 4F8RA 5L38A 2HS3A 5MLCV 1U6FA 4B17A 3H4DA 4RUHA 5L9XA 2XMMA 4TY8B 3SMZA 4YY3J 5J1EA 2R8KA 1L3KA 1FX2A 1QM9A 5D6GA 2BJ3A 3C16A 1TL3A 3O1LA 2OD6A 1S99A 2B6AA 1OSDA 3H5XA 2XNQA 3F0NA 2HS4A 2ZD1A 1YTYA 5D0EA 3B54A 3BN4A 3NS6A 1RWPB 4M94A 2HNYA 1SL1A 1NJYA 4LBPA 2V68A 3ENWA 1X5SA 2HRYA 1NDKA 2IPOB 3IC1A 1ZA1B 2IC3B 2Y3YA 2UUWA 1VIXA 4RUBA 4ATNA 3M8YA 3DMJB 4F3MA 3FCHA 4DX5A 1NZAA 2H51B 2JX2A 3RBXA 2V9KA 4X4OA 3V4MA 1SC1B 4OJ1A 4LQ3A 1LV5A 5B08A 4BLGA 3G8SA 1U8SA 2WVCA 2AEFA 2MGZA 2PI4A 2UXDF 4CLYA 4P2MA 3KK1B 2NS1B 3FGVA 2GVDA
chains in the Genus database with same CATH topology
3BKTA 4ME7E 1ARRA 3VEAA 2BA3A 1EA4A 2WVBA 3LGHA 2BJ7A 2K6LA 3VEBA 2H1OE 2K9IA 2BJ8A 2WVEA 1MNTA 2JXIA 3FMTA 2BJ3A 1B28A 2FGCA 2F1FA 2CADA 1MYLA 2NZCA 2K1OA 1BDTA 1X93A 4FXEA 3OD2A 4D8JA 2HZAA 3VW4A 2BJ1A 1NLAA 2PC6A 2RBFA 3GXQA 3PHTA 2BSQE 2JXGA 2Y3YA 3QSIA 2K29A 4HV0A 1ARQA 3H87C 2AY0A 1IRQA 1P94A 1BAZA 1U9PA 1Q5YA 1MYKA 1BDVA 1Q5VA 2KELA 1B01A 1QTGA 3BKFA 2BNZA 2GPEA 2CA9A 3QOQA 3FT7A 2WVCA 2JXHA 2CPGA 1PARA 2BNWA 2CAJA 2BJ9A 2WVDA 2HZVA 3BKUA 2CAXA 2K5JA 2WVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BKT A;  4ME7 E;  1ARR A;  3VEA A;  2BA3 A;  1EA4 A;  2WVB A;  3LGH A;  2BJ7 A;  2K6L A;  3VEB A;  2H1O E;  2K9I A;  2BJ8 A;  2WVE A;  1MNT A;  2JXI A;  3FMT A;  2BJ3 A;  1B28 A;  2FGC A;  2F1F A;  2CAD A;  1MYL A;  2NZC A;  2K1O A;  1BDT A;  1X93 A;  4FXE A;  3OD2 A;  4D8J A;  2HZA A;  3VW4 A;  2BJ1 A;  1NLA A;  2PC6 A;  2RBF A;  3GXQ A;  3PHT A;  2BSQ E;  2JXG A;  2Y3Y A;  3QSI A;  2K29 A;  4HV0 A;  1ARQ A;  3H87 C;  2AY0 A;  1IRQ A;  1P94 A;  1BAZ A;  1U9P A;  1Q5Y A;  1MYK A;  1BDV A;  1Q5V A;  2KEL A;  1B01 A;  1QTG A;  3BKF A;  2BNZ A;  2GPE A;  2CA9 A;  3QOQ A;  3FT7 A;  2WVC A;  2JXH A;  2CPG A;  1PAR A;  2BNW A;  2CAJ A;  2BJ9 A;  2WVD A;  2HZV A;  3BKU A;  2CAX A;  2K5J A;  2WVF A; 
#chains in the Genus database with same CATH topology
 3MM7 A;  3DLK B;  2RDI A;  3C2P A;  1U2R A;  3AH6 A;  2JVO A;  3H42 A;  2MKS A;  4KV8 B;  3TZX A;  1KC8 T;  4A46 A;  1RA7 A;  2VFR A;  1OO0 B;  1TKZ B;  1ACM B;  2L9D A;  1X0F A;  4HVZ A;  4AYB D;  3JYT A;  1KVK A;  3RR8 A;  1DTQ A;  2BMB A;  1GXL A;  3M2V A;  2UXB J;  3M8R A;  2P9G A;  4YFU A;  4QWA A;  2LDI A;  3I0S B;  1PG5 B;  3H5U A;  2PD1 A;  2HQG A;  2FJW A;  5KFG A;  2W1B A;  4HI2 A;  9ATC B;  4IR1 A;  1U25 A;  2M9K A;  2YVS A;  4DV0 F;  3MMA B;  2IIH A;  4NEY A;  2PI5 A;  4DL2 A;  4GVL A;  4OI2 A;  1RAI B;  2AX1 A;  3VGU A;  4USJ C;  3BO3 A;  4B9V A;  3QO9 B;  5IV3 A;  1OY8 A;  2L9W A;  1WHV A;  4KBI A;  3T9Z A;  4OYA A;  2LMI A;  5DLG A;  4IO9 Q;  1YJ9 S;  1F9E B;  1GMW D;  2X1F A;  1QSL A;  2AWZ A;  5BR8 J;  2CAD A;  3VWS A;  3PW2 A;  4ELU A;  1DQ8 A;  5E33 A;  5BR8 F;  3UVJ A;  2QL7 B;  3AJ2 A;  4ZP9 A;  4ZPT R;  4DV5 J;  1NRK A;  2MLY A;  4GKK F;  3RGI A;  5A6P A;  3FC9 A;  5DDP C;  2FD2 A;  4JI3 F;  3PRB A;  3H8Y A;  3D0H E;  3OFG A;  3P5B P;  1S1U A;  1B01 A;  2J0W A;  4RPF A;  3OV7 A;  2W7O A;  2ZHB A;  1WC5 A;  1BE4 A;  2G1H A;  3GII A;  4WIQ A;  1FEE A;  3RBZ A;  1NDP A;  2K8G A;  3BGR A;  4PPD A;  4AUK A;  3Q8P B;  3SQG B;  1S7H A;  3DNC A;  3M6V A;  3M30 B;  2FLP A;  2R4F A;  3M8W A;  3DOM A;  2WSF C;  1WHX A;  2GIQ A;  2ZM6 F;  3AHP A;  1KDN A;  2HGL A;  1B28 A;  4F4Z A;  3FEY B;  4F3Q A;  2KJW A;  1UVJ A;  1HI1 A;  4FS2 A;  4WTO B;  2QRR A;  1IKY B;  5J1N A;  1IKV A;  2B9E A;  3C6U A;  4RZR A;  5KFO A;  3PW7 A;  2XLK A;  3NGD A;  3GV8 B;  3THP A;  5B0A A;  4FYW B;  5C25 A;  5D3G B;  1RAJ A;  2E1C A;  3V4I A;  1WHY A;  5DET A;  1U24 A;  1X60 A;  1KON A;  1MRO B;  2LLZ A;  2M8H A;  3V6K A;  2DD8 S;  1QTG A;  1KTQ A;  2FYX A;  5AT1 B;  4ES3 A;  4QIG A;  4R0E A;  2HHS A;  2PA3 A;  1NK9 A;  4K7Q A;  3K5M A;  4AND A;  2OPS B;  4EBD A;  4J9L A;  4M5H A;  2L3M A;  3T6B A;  3MPY A;  3D54 A;  2DR5 A;  2HBQ B;  2K6L A;  1EKS A;  5BYQ A;  3VGV A;  1D8Y A;  4DR4 F;  2FVP A;  1MNT A;  1X0P A;  1GH8 A;  4QQB A;  1UEK A;  1YI2 S;  2DR6 A;  3CB4 A;  3D4J A;  4PWW A;  3R7N B;  4U96 A;  3AOC A;  2DIS A;  4DI6 A;  5GAD U;  4X4Q A;  2E7V A;  3R97 A;  4YDX A;  4V19 X;  4LFB F;  4DBQ A;  1MML A;  7FDR A;  3E2E A;  5C24 B;  1JLF B;  5KFS A;  3AQO A;  4RW8 B;  1Q4R A;  1DHM A;  5H9E J;  2RRN A;  4N47 A;  4Y65 A;  3DDI A;  3NOG A;  3KLE A;  4R0J A;  2XYP B;  4ZPB A;  1BAZ A;  4K4S A;  2ZKT A;  2OUG A;  4L74 A;  3G6V A;  3RRG A;  1Q95 G;  1VBZ A;  5AXN A;  2DNH A;  5K20 B;  3BF4 A;  2KZM A;  1PJ6 A;  1FJC A;  3OFF A;  2R2S A;  3KLF B;  5EWF A;  3QOQ A;  2GML A;  3NGS A;  2NYI A;  2AYM A;  1WJ9 A;  1QVG R;  1X5O A;  4DR7 J;  1T3O A;  3SSS A;  3AY0 A;  4IH6 A;  2R8G A;  1FFG B;  1FRJ A;  4DR7 F;  5CHC B;  3VGT A;  3N6N A;  2CG8 A;  2BZ2 A;  4FF3 A;  2CVE A;  4OZL A;  2DEI A;  3J7Y U;  5A2Q U;  3W60 A;  1RT1 B;  3QJJ A;  1C0T B;  2VG7 A;  3FRZ A;  1F60 B;  4BS2 A;  3ZTQ A;  4ZLL A;  2Z2Z A;  1HQ2 A;  2PA8 D;  4LSL A;  4IG3 B;  1YG0 A;  1XNQ J;  5B0D A;  4M5L A;  2DHX A;  1X4C A;  4XDD A;  4ALZ A;  2AD9 A;  3TA1 A;  3CCW A;  3R1L A;  3FKB A;  1JXV A;  1V3R A;  1F3V A;  2EFP A;  2NLW A;  4DPW A;  3ITH A;  5DQH A;  2NYH A;  1CLF A;  4J9M A;  4JP8 A;  3J80 Y;  2ZH1 A;  3HHK A;  2OAU A;  1VJW A;  1NKB A;  4ES1 A;  4QYR A;  3BB5 A;  4Z37 A;  4LRE A;  3IR7 B;  4ZVO B;  2AYG A;  4YEA A;  1R0B G;  3AD8 C;  4U9R A;  5E3Q A;  3PM9 A;  3BR8 A;  3DXS X;  2BW2 A;  1LNQ A;  1T0T V;  4LIW A;  5JJB A;  1S1T B;  1JJH A;  4FXV A;  4C97 A;  4U7U K;  3Q22 A;  1TUV A;  3E01 A;  4RNM A;  2WON B;  4NML A;  1X9M A;  2AN7 A;  2YX4 A;  1UEV A;  4R25 A;  1WOS A;  2V2V A;  3NRB A;  3R7B B;  1X4H A;  3R5A A;  2JDJ A;  1YGY A;  1TKX B;  3M2R A;  4LF4 J;  3PYF A;  3AD7 C;  2F1F A;  3MR2 A;  1H2U X;  2ZOF A;  4I56 A;  1HHS A;  2E7W A;  4I2Q A;  1IBK J;  2H3A A;  1RTH A;  4FF2 A;  3I96 A;  3DOL B;  5LMN J;  2AGP A;  4JV0 A;  2L08 A;  4URG A;  1BMQ B;  1JJC B;  2YQ1 A;  5LMN F;  1NPK A;  1ZZF A;  2DGQ A;  3P6Y C;  3I5C A;  1KEK A;  5I3U A;  3KHR A;  1HBN B;  4RNN A;  5B09 A;  5IC6 B;  1RAD B;  2B5J B;  1C2P A;  1BDV A;  4DV3 J;  2A2B A;  1NHV A;  3VQS A;  1ZZN A;  4B9M A;  3V5R A;  3QWP A;  2LEA A;  3TR5 A;  4WZM A;  1I94 J;  3VAM A;  1J27 A;  2MKK A;  1APS A;  2CAJ A;  2BJE A;  5L1K A;  1G6B A;  1BC6 A;  3NAH A;  2JNJ A;  4ZDN A;  4ZIW A;  5D4N A;  2IHR 1;  3HHL D;  2HRT A;  5C2C A;  2XQC A;  2YKM B;  3HKW A;  2HPU A;  4Q7A A;  1R0A A;  2R8J A;  2MSS A;  4O3P A;  3KLI B;  1C4A A;  1WD6 A;  5A8W A;  3TO8 A;  3U27 A;  2GAH C;  2EVZ A;  2XMA A;  2DYA A;  2ZH9 A;  2Z57 B;  1AA1 B;  3G8Q A;  2PEH A;  1FVS A;  4URQ U;  1H6K X;  3GFY A;  2VC1 A;  3KLG A;  1TVR B;  5KT7 A;  3OTC A;  4KO0 B;  2CPX A;  1Y5N B;  3GU0 A;  5KFL A;  2HHH J;  1N5Y B;  2R7R A;  4ZVG A;  3DHW C;  1YHQ S;  3HSG A;  1M5K C;  4JI8 J;  3CJK B;  4ITS A;  3NP5 A;  2V34 A;  1BD6 A;  2R3V A;  3T3F A;  4LF9 J;  3UR3 C;  1EX8 A;  4JI8 F;  3R1H A;  4JV5 F;  3Q89 A;  3UCZ P;  1X4F A;  3UN2 A;  2AKW B;  4OYP A;  2IMW P;  2MJU A;  3B4M A;  1TL4 A;  2V4Q A;  1NJX A;  1VQO S;  4WK3 A;  1RBO B;  2H4Y B;  1R0C B;  5KFX A;  1PSD A;  4HYK A;  3NMA A;  4HT5 A;  3MUR P;  5U47 A;  2Z58 B;  1ZTW A;  5GAG U;  3BQ0 A;  2QZ8 A;  2CWK A;  3MOZ A;  1RGV A;  4H4M B;  1WI6 A;  4ZIV A;  4I4B A;  2VKZ G;  3B6B A;  1QVF R;  3CCM S;  5JUM A;  4NYO A;  3KJF B;  2DR7 A;  2FJE B;  1I1G A;  2C2K B;  1HQE A;  1IBL F;  2PT0 A;  4B3T F;  5FDL A;  2YX1 A;  3GPA A;  1ITP A;  3PR4 A;  3QSY B;  1N6Q A;  4WKY A;  1N5V A;  3MR7 A;  5LM7 E;  4ZJO A;  1ZM4 A;  2KT3 A;  2FGO A;  2F3J A;  4KKO B;  4JB8 B;  1B4S A;  3FZ2 A;  3V81 A;  1AYE A;  2DGO A;  4OHV A;  4QIE A;  4FNI A;  4ECY A;  1WC6 A;  4P6Q A;  2R8H A;  2G2Z A;  3BSA A;  1SC3 B;  5EWE A;  3NY0 A;  2EPI A;  3GON A;  3QT8 A;  4B3M J;  5A8R B;  1SV5 B;  4C3L A;  1Y4Z B;  4M8L A;  2FVQ A;  2LU1 A;  4B3M F;  1ZS6 A;  2AYE A;  3NGU A;  4Q5V A;  3CCZ A;  3BYR A;  3VHQ A;  2VB6 A;  2X7I A;  1L3U A;  2AV5 A;  2YNG A;  2BBE A;  5IWA J;  2R42 A;  4G1Q A;  5H9F K;  4BC9 A;  3IM9 A;  1LWF A;  1LW2 B;  2HNZ B;  2Y0B B;  2BJ1 A;  4PKD B;  4NLP A;  4JBC A;  2GGP B;  3PR5 B;  2RBF A;  4WFA Q;  2HK3 A;  4TQS A;  2NRE A;  3D5M A;  4O4G A;  1VRU B;  2LEB A;  5D77 A;  4JI0 J;  4ZK7 M;  4WP8 A;  5F0W A;  1NJI T;  4ELT A;  3BEG B;  3BQ2 A;  2CZ9 A;  2W7A A;  4B3R F;  4RNF A;  1JNZ B;  1U09 A;  1AZS A;  4Q2M A;  1U1N A;  1O6X A;  3EUN A;  3N28 A;  3SCI E;  1YBA A;  4EBC A;  5B0C A;  2JRS A;  2MYF A;  3PXG a;  1KVI A;  3VF0 B;  3EDQ B;  4IFY B;  4NMX A;  3QT7 A;  5HMY A;  2YNH A;  3CJ4 A;  2V67 A;  4LQ9 A;  1AFJ A;  3TUP A;  1X31 C;  1RLC L;  2F7V A;  4IH5 A;  2DNL A;  1TEL A;  1SCJ B;  1R8B A;  2AP6 A;  5ETK A;  1VQ7 S;  4KE5 A;  4F0H A;  2SXL A;  4IRK A;  1XBW A;  3CJ0 A;  4LUB A;  3TJ9 A;  4K5S A;  4JV1 A;  2M88 A;  4USM A;  5L46 A;  1B0V A;  2HHP A;  4L3N A;  1UTA A;  3J7A N;  1FRH A;  3CJS A;  3I9V 9;  2J6S A;  1RA6 A;  1CJK A;  1LW0 A;  2EG2 A;  3NCR A;  1E6Y A;  5E5N A;  3TWZ A;  1X5P A;  4ERD A;  2E5G A;  3PO5 A;  3NG8 A;  3A3O B;  5FLX Y;  4O23 A;  2VIH A;  5EHH A;  4DUY J;  1S9G A;  2VFT A;  1PAU B;  2I38 A;  1K73 T;  4DUY F;  4FYD A;  4X65 J;  4I2P B;  4ZA1 A;  1SUQ B;  1S9E B;  2AU0 A;  3IRX B;  4X65 F;  1PYO B;  3M32 B;  4DSL A;  3GYN A;  1KOH A;  1XR7 A;  4KGZ B;  2KFZ A;  2HRU A;  2XSJ B;  1JMT A;  3BKU A;  1S1V B;  1P27 B;  1FDB A;  3Q8R B;  4DR5 F;  2HBR B;  2FZC B;  1SBR A;  4DZ6 A;  3T1Y F;  2ROP A;  4R5P B;  3CVK A;  3SFG A;  1WDT A;  3IG1 A;  4XO0 A;  3G82 B;  4IYQ A;  1WUU A;  4CCH A;  1A0O B;  1R43 A;  1FCA A;  2OMO A;  2LCW A;  2MEW A;  4C98 A;  2VPZ B;  4EBE A;  4LF7 J;  1IXK A;  2EC0 A;  4RW9 A;  1X9W A;  2Y1L B;  4H4K A;  2J0S D;  1F5C A;  2E5H A;  2I6W A;  1WHW A;  4PPZ A;  2ATC B;  5H9F J;  3EPI A;  3EYZ A;  2VU5 A;  4Q44 A;  1Q7L B;  2K29 A;  3JQM A;  4Q45 A;  1GK8 A;  3EZU A;  3RB4 A;  2H4W B;  5HSP A;  3K58 A;  1IR1 A;  1WNE A;  3GIR A;  2PEB A;  1WG4 A;  5G4D A;  2LQB A;  2W2P P;  4JYA J;  4X4S A;  2FJX A;  3MPV A;  1DFD A;  2I2Y A;  3ONQ A;  2YXL A;  3I82 A;  4PQA A;  4JYA F;  3ZC4 A;  1CJU B;  1TKT A;  3M7V A;  1DY3 A;  4KH1 B;  1FEH A;  4LF6 J;  4FNH A;  1XER A;  1JLG A;  2RQK A;  4PR6 A;  1FWP A;  1EHW A;  4I68 A;  3I5A A;  2XC9 A;  2GQQ A;  2B4O A;  1Q0N A;  4HTI A;  4PUO B;  3KK2 B;  4DFK A;  2YQ0 A;  3DYA B;  3PCO B;  4ECW A;  4QPX A;  5LT5 A;  4IRC A;  3NLC A;  4WYW A;  1NKE A;  1K8A T;  1GNK A;  3MMC A;  2BYC A;  1S0O A;  3FFI A;  1IJE B;  4N7T A;  2VAS A;  2UV8 A;  2E7X A;  3CC4 S;  3CCT A;  3D66 A;  2X51 A;  4LF8 J;  3L4B C;  4A8S A;  1GAO A;  5EX0 A;  4GKJ J;  3PHT A;  5THW A;  1S1W B;  5M2R A;  2XUL A;  4EMD A;  4HR2 A;  4LF8 F;  4HI1 A;  4GKJ F;  1NPP A;  2FUG 9;  4TLR A;  4TY8 A;  1AFI A;  4X4T A;  4USI A;  4DX8 H;  3PRV A;  2DVI A;  2VUG A;  3GJT B;  3LA0 A;  3OHA A;  2V4R A;  4QOT A;  4M5J A;  1JLB B;  2ZWP A;  1JLA B;  3FQL A;  3DU5 A;  3R2D J;  5ETQ A;  4EU0 A;  2KT2 A;  1TP7 A;  3FBF A;  2DH8 A;  3DMJ A;  2XS2 A;  2G2O A;  5LSL A;  1JLC B;  2ZH8 A;  2QO3 A;  3NGR A;  2HND B;  1ZH5 A;  2K06 A;  2QLW A;  1AB8 A;  3P5T L;  3FSY A;  2C2R A;  3A8E A;  1MU2 B;  2VV5 A;  2WOM B;  3MUV P;  2HQD A;  2OEM A;  4O3Q A;  4MIA A;  2J7W A;  3OR1 A;  3GTY X;  1HNW F;  5F3T A;  2ZOG A;  1IJF B;  3PX6 A;  3DLK A;  1DLO A;  1VMB A;  2RUS A;  4JV2 A;  1NAQ A;  4KV8 A;  1HQU A;  2RHS B;  1HR0 F;  2COL A;  4ECR A;  5EGY A;  2VQF J;  2CJB A;  2BOA A;  2ERR A;  2HHW A;  3T1H J;  2Q1L A;  1TV6 A;  4ZCL A;  4DU8 A;  2KH9 A;  5ETM A;  5GME A;  1TKZ A;  3UFC X;  2V5H G;  3QAT A;  4BC7 A;  1NK8 A;  2ZH6 A;  2KM8 B;  3C19 A;  1REV B;  4E2F B;  1F3F A;  3JQK A;  3B4D A;  6FD1 A;  5KFV A;  2JVR A;  1YRX A;  3IMQ J;  1VQ6 S;  4P7T A;  5KFR A;  1SC6 A;  4EK2 A;  4YB1 P;  4LRA A;  1R89 A;  4PQU B;  1Z2L A;  5DLF A;  3I0S A;  1CC7 A;  1S79 A;  4K4U A;  5F8L A;  4DPT A;  1NHU A;  3K89 A;  9RUB A;  1NDL A;  3JTN A;  3HJF A;  1TL3 B;  3UO0 A;  3O3L A;  2JFK A;  2Y1R I;  3UD4 P;  3QO9 A;  5CH7 B;  2H65 B;  4UUX A;  2HNY B;  1S7I A;  4PZV A;  1RKJ A;  3UDV A;  3GV5 B;  3HSD A;  2FIU A;  4C8L A;  4CO4 A;  2HFS A;  1FES A;  2RJZ A;  4RL1 A;  1ZTT A;  5BJR A;  3TQE A;  3B8H A;  8AT1 B;  3LAN A;  2ILY A;  4OZJ A;  4USK A;  3EVO A;  2NSB A;  3ENQ A;  4F25 A;  2RF2 A;  2RT3 A;  4AE5 A;  3T6J A;  2MGZ B;  5HVF A;  3MF5 A;  3VVT A;  1T9X A;  3BV8 A;  1WG1 A;  5KFQ A;  2DY1 A;  2CNO B;  1VQP S;  2K3K A;  4Y2K A;  1BWE A;  3BBB A;  4O0N A;  1T11 A;  1FDN A;  3RAM A;  2C2Z B;  2VA3 A;  2RIJ A;  2UV8 G;  1VHI A;  2W25 A;  4DN9 A;  4L3K A;  2OP5 A;  3BM7 A;  4DQI A;  2IDE A;  3D1O A;  4WII A;  3BO2 A;  3M6X A;  5I3P A;  2W4P A;  2VON A;  5EN1 A;  3UW1 A;  5LXR A;  2QG9 B;  3SQG A;  1D8Z A;  3C14 B;  3L95 X;  1DTQ B;  2CZV C;  2XYG B;  4USH A;  3I6P A;  3T41 A;  2CQG A;  4DR2 J;  3BSC A;  3TJA A;  4LIR A;  4OJH A;  1KRP A;  1N34 J;  3A3P B;  2B0G A;  1U1L A;  1A7G E;  3RR7 A;  3EIC A;  1N34 F;  3D0I E;  2GJI A;  1RAO A;  2CJK A;  3OTO J;  4ZN3 A;  3L7U A;  1IKY A;  1HI8 A;  1CJV B;  4OYM A;  1D0E A;  4DR6 J;  3ICL A;  1S6Q B;  2R8I A;  2Y1J A;  2BJ8 A;  5D3G A;  4ZJQ A;  1NDC A;  3X3U A;  2DNY A;  4NLU A;  4FBU A;  4WP3 A;  5A6W A;  1RT2 B;  1LFW A;  2AW0 A;  4ZN1 A;  2F9D A;  3JSM B;  3MED B;  2OJ3 A;  4QW8 A;  3JAM U;  3MAA B;  2OPS A;  5F8J A;  1LXN A;  5L1I A;  4X64 J;  3UVJ B;  4JI1 J;  2YKN A;  3K59 A;  4K2X A;  3V2U C;  1OQ3 A;  3CO9 A;  3FMB A;  4KHR A;  1PO6 A;  1K0V A;  5E3C A;  2UUB J;  3AQP A;  2O66 A;  4RUC A;  2RAQ A;  4F4W A;  3W1Y C;  2OPR B;  3MM6 B;  2UUA J;  4CH1 A;  4YR3 A;  2ZWO A;  2EC2 A;  1FF2 A;  3TVZ A;  1WF2 A;  3JTP A;  3N4W A;  2CQP A;  2HQF A;  2XI2 A;  5C24 A;  2MZQ A;  1JLF A;  3H90 A;  4RW8 A;  2U2F A;  1IKX B;  1ZAV A;  4Y2I A;  2FPH X;  1DJ0 A;  2P9E A;  4E98 A;  3BGR B;  3AOD A;  1CUL B;  2FTR A;  3Q8S B;  4MJW A;  3OR2 A;  2Z4P A;  1LK5 A;  1KLM A;  2OML A;  1C1B B;  1C1C A;  5E2Q A;  3BZQ A;  1TAQ A;  2WZ1 A;  3OD2 A;  2L41 A;  3E8O A;  3OJU A;  1Z4U A;  1XIQ A;  4X4R A;  2NZ4 A;  4NI2 A;  1HLW A;  4C9D A;  3KLH B;  3GXQ A;  3BH7 B;  4I6A A;  4CTA B;  2MLX A;  2VF3 A;  3WDO A;  3BPS P;  3IO1 A;  3UCU P;  1OJ4 A;  1N32 F;  1RT1 A;  2F8H A;  1IKV B;  1C0T A;  3GIJ A;  2HHQ A;  1HPZ A;  1NK7 A;  4ZMM A;  3EPG A;  4DQP A;  4IG3 A;  3DU6 A;  1L3S A;  4B3S F;  2R7O A;  4QBU A;  4A4J A;  2CNK B;  4IFV B;  1PAR A;  2DJW A;  4BHQ A;  3VV2 B;  5HO4 A;  2BV3 A;  2VFV A;  3OHB A;  3Q0A A;  4MIW A;  2W24 A;  2KL8 A;  3US5 A;  2OTL S;  1FRI A;  2BKP A;  2QJ3 A;  2D74 B;  1NSP A;  3KG4 A;  3NOC A;  3IR7 A;  4IKA A;  2ZJQ Q;  3PIO Q;  2DPI A;  2QLJ B;  4MKY A;  3QFH A;  1UPP A;  1M1G A;  3GLJ A;  4XK8 C;  2YKA A;  3VW4 A;  2X3D A;  1FFS B;  2D1C A;  3OTE A;  1QSS A;  3ET6 B;  1RT5 A;  3ISZ A;  1PC4 A;  1YJW S;  2P5V A;  3PYG A;  1X7V A;  2KXN B;  5L8R C;  5HQ8 A;  2CG4 A;  2JWN A;  1M5P C;  1TKX A;  5J2P B;  1SH3 A;  1MYK A;  1S76 D;  3ZZT A;  3W5Z A;  2FQQ B;  1SKW A;  4ZLP A;  3F44 A;  1TL1 A;  4N56 A;  2EKN A;  3DLB A;  2C2O B;  3GV7 B;  2IVM A;  1UW9 A;  3DOL A;  2D69 A;  4NLS A;  5E3A A;  3TZY A;  2M52 A;  4M5I A;  3RW6 A;  4PXB A;  1W2I A;  4P74 A;  3HX9 A;  2J5A A;  2V8P A;  5KFB A;  2H1O E;  4ELV A;  1RWW B;  4U95 A;  3C15 B;  3L9Z A;  3HHL B;  2I9S A;  5D0G A;  2ZZM A;  1HBN A;  1YDL A;  1HNX F;  5ETT A;  4C2M A;  1ZYQ A;  4DL0 C;  2R7S A;  2B5J A;  4LRD A;  1WSV A;  2ZH5 A;  3IFE A;  1HIY A;  5HVG A;  3FMW A;  4KYZ A;  3Q24 A;  4X4U A;  2BAN B;  2LYV A;  3LAM A;  2VG7 B;  2AJ4 A;  1WEL A;  1MLA A;  2RQC A;  1VCT A;  1TQL A;  3HVW A;  2E5L F;  4DLG A;  2P9C A;  3F73 A;  4ANC A;  5D4L A;  2O1P A;  4RWX A;  1RUS A;  4B9N A;  5E3R A;  1NBE B;  4F3O A;  3CDA A;  2YKM A;  1RTI B;  4AL7 A;  3BN7 A;  3GYX B;  1CS4 B;  2GX8 A;  3D7S B;  2BRL A;  5CA5 A;  3KLI A;  2QMX A;  3DLE B;  4ED6 A;  1QAY A;  1QAI A;  3HHL C;  4QWD A;  3OVB A;  2DIV A;  5LMU F;  2C22 A;  4HHJ A;  3ILI A;  3FK4 A;  4QIV A;  2DIU A;  3WBZ A;  1IM6 A;  1FNX H;  4CI0 B;  1M1H A;  4ICL A;  4ZJL A;  4J9R A;  1U1Q A;  2LA6 A;  2QEX S;  1TVR A;  2DH7 A;  4ME7 E;  3W9H A;  3DRS B;  2MQQ A;  2ZBI A;  4B3O A;  3TW0 A;  3KMQ A;  4JI2 F;  5A76 A;  4OFZ A;  3CJK A;  5C2G A;  1FDD A;  2AT1 B;  3P8B B;  2DNQ A;  3RRH A;  2DB1 A;  2QYG A;  4NA3 A;  4TN2 A;  1XEZ A;  4Y0F A;  5DG8 A;  1VDH A;  3M2R B;  2FZG B;  4ED8 A;  4EZ6 A;  2Z30 B;  2GHW A;  1U1R A;  4TU8 A;  2N4D A;  4ZPA A;  3QGP A;  2BSQ E;  1RTH B;  3DRX A;  3HFK A;  1JWW A;  2DHH A;  5EUH A;  2V50 A;  2WBM A;  5D78 A;  5CD4 H;  2OPQ B;  5DGB A;  4ZVE A;  3A8J A;  1WTF A;  4YOE A;  2MQM A;  4H4M A;  1OPZ A;  1N36 F;  4ED5 A;  2ASY A;  3U1L A;  1OY6 A;  1YLX A;  4ZVU B;  1ICE B;  2C2E A;  1NO8 A;  4ZVP B;  2RH3 A;  4UT4 A;  1S59 A;  4DX7 A;  3B82 A;  5HBM B;  5DM7 Q;  1G1X A;  2MXY A;  3UCG A;  4QU6 A;  2AEJ A;  3AOB A;  2VQE J;  4NEZ A;  2RUG A;  4OX7 A;  2VQE F;  3LPE A;  2VPX B;  2LQ5 A;  3CDB A;  3IGN A;  1HNV B;  1OHN A;  4KKO A;  3PHE A;  1JX4 A;  1F2H A;  1YJR A;  3E3X A;  1LKZ A;  2CQI A;  4NCG A;  4LJM A;  3L7P A;  1RSC A;  3TX8 A;  4P72 A;  4W90 B;  2WTF A;  3HKZ D;  1S49 A;  2MQN A;  3PNI A;  2FVS A;  5A8R A;  4LFA J;  1SV5 A;  3EGV A;  3J81 Y;  3MEE A;  1AT1 B;  1RHR B;  4ZVT B;  4KHP F;  4LFA F;  4O3R A;  2N82 B;  5I42 B;  2BEF A;  3KKF A;  3KLG B;  4ZVF A;  1PIL A;  2CQ4 A;  1FJG J;  1FER A;  3TVK A;  4QR1 A;  2Z2M A;  3TA2 A;  3CD7 A;  3GIL A;  3A13 A;  3W3S A;  4TYB A;  2HNZ A;  4CM2 A;  3LP1 A;  1WF1 A;  2GGP A;  1GEH A;  4Z7Y A;  4GC7 A;  1ARO P;  3CMQ A;  3HZG A;  3RZA A;  3D28 A;  2R9L A;  4FYV B;  3HP6 A;  2GQC A;  4ZP8 A;  1HNZ J;  2MQP A;  1R27 B;  1CPZ A;  5HL7 Q;  1UFW A;  2KG0 A;  2E29 A;  3OL6 A;  4N41 A;  2BJD A;  1HNZ F;  1UFL A;  1V5V A;  3TZW A;  2CUY A;  3N6L A;  3TRG A;  1U26 A;  4AXI A;  3PRD A;  1RT6 B;  3JSB A;  4IFY A;  2CDQ A;  2XMK A;  4L73 A;  3T5K A;  1K1S A;  5D4P A;  5T7L A;  3AXM A;  2YNI B;  1S57 A;  2MZ1 A;  1HQE B;  3AB4 B;  4N8O A;  4Z7C A;  2B3T B;  4ID5 A;  4FYX B;  3PJW A;  4C8Z A;  2E44 A;  4OHX A;  1TK8 A;  4C11 B;  1UP1 A;  3KMS A;  3CPW R;  1RT7 A;  3U02 A;  1U8W A;  2W4C A;  2EFG A;  2E1R A;  1D9D A;  4ILR A;  1URR A;  3LOU A;  4I64 A;  1W2B R;  4F02 A;  4OI1 A;  4MIB A;  1W25 A;  2KVI A;  2QSW A;  5CZV A;  3OPK A;  2OTJ S;  2QYC A;  1JK9 B;  1YZ7 A;  3LF0 A;  2HYI B;  3W7B A;  4XDC A;  4X4N A;  1S9E A;  4NWB A;  3MZI A;  3IRX A;  4IUF A;  3SFU A;  5B0F A;  2QIF A;  3ELH A;  3DRR B;  3T9N A;  3M32 A;  4RR5 A;  3KXD A;  3I55 S;  2JXG A;  5KFE A;  3D6M B;  3RUB L;  2CJX B;  4O3N A;  5GVQ A;  1LWF B;  1RWK B;  1JQG A;  3WC2 A;  3D3C J;  2IDL A;  4R5P A;  3G82 A;  4KFB A;  1VC5 A;  3W65 A;  4DFP A;  1Y11 A;  1UWA A;  4H4O B;  4PG8 A;  3CXC R;  2QLF B;  3BBF A;  1B64 A;  4USW A;  2H54 B;  4Y28 C;  2ZH2 A;  5IQ6 A;  2ASL A;  5DZ6 A;  4DL7 A;  3OL7 A;  4DV2 J;  2BE9 B;  2EFO A;  3UDC A;  3HD2 A;  3IS9 B;  4ZHR B;  3FZB A;  5A8K B;  1QE1 A;  1UL3 A;  4W98 A;  1UPM B;  3FBC A;  2DR8 A;  3PKY A;  1OG7 A;  3SSQ A;  3HSZ A;  2GHV C;  1YIT S;  5LJ3 Y;  2W9C B;  4NLG A;  4OLP A;  3M8S A;  4ED1 A;  3AXK A;  2HZA A;  3FNN A;  2C28 A;  5KG5 A;  4HTJ A;  1KQK A;  1CJU A;  3OTB A;  2W2N P;  4KC5 A;  4B9U A;  1HMV A;  5AXK A;  2K7J A;  4JI5 F;  4LMZ A;  5IT9 U;  5ETR A;  1KQF B;  3H2U B;  1R8P A;  1HBO A;  2YH0 A;  4DQR A;  1WDD A;  3CSK A;  4PUO A;  2CQC A;  1AXQ A;  2FLN A;  1T9V A;  3MAH A;  4P2S A;  3GYG A;  3DYA A;  2MZR A;  1LW0 B;  2GVZ B;  2IRY A;  3J81 j;  2HLU A;  2DRA A;  1S9G B;  1HBU B;  1RTJ B;  3TEG A;  4FPR A;  1UVI A;  3QRR A;  3FEX B;  2V4J B;  3UN3 A;  2KFY A;  3MXH P;  2XMU A;  2MMY A;  2R7Q A;  2BM1 A;  3MR5 A;  4D3G A;  4DOZ A;  1D1U A;  2BA3 A;  1G2E A;  1S0V A;  3A3N B;  4IOB A;  5CYJ A;  1RAE B;  3KG1 A;  1BLU A;  1EIY B;  5B7W A;  1BQM B;  5IOL A;  1YQH A;  2RQ4 A;  2RIL A;  1SI9 A;  2FJV A;  1FRX A;  3NGK A;  2LXF A;  1KVJ A;  2IJF A;  3O5T B;  3CJ8 A;  3FVY A;  3IG1 B;  4EFA C;  2OIH A;  4NXM F;  2B8Q A;  3CJ5 A;  4K4W A;  2WK4 A;  3O2I A;  2I5J B;  3FEZ A;  3IRW P;  1RQ0 A;  4DV6 J;  2EFQ A;  1QAJ A;  1YX2 A;  3ZTR A;  4MYU A;  2R7T A;  4QCL A;  2CQ1 A;  3NWR A;  1JLC A;  2HIY A;  4G6V B;  2BA9 A;  2ZZN A;  2HND A;  1WG5 A;  1FXL A;  1H3D A;  1FE0 A;  3KG0 A;  1ZM2 A;  4DUZ J;  1N0V C;  2V6A A;  4OZ1 A;  3NKY A;  2BJ9 A;  4PG7 A;  2MKH A;  1NUE A;  4NPO A;  4DQS A;  1IBM F;  2EBE A;  2HK2 A;  3R9L A;  1Y7P A;  4ED4 A;  1JLG B;  2MLZ A;  3UPF A;  2YKQ A;  1N4L A;  1Y5I B;  4CO5 A;  2VBX A;  4CLS A;  4RU9 A;  4WWS A;  3BGF A;  3F56 A;  4PCQ A;  1WKK A;  1RAB B;  1YRT A;  2ROE A;  1QAX A;  1K1Q A;  1JB0 C;  5KFD A;  4OV6 A;  3W61 A;  3H98 A;  3FFI B;  3CCQ S;  1LWE B;  4LVN P;  3OJS A;  3IWN C;  5KT5 A;  5HI7 A;  5J2Q A;  2KXH A;  3GR0 A;  1KOO A;  3D67 A;  1Q5Y A;  1B7F A;  2K7K A;  4PQU A;  2QV6 A;  2YY3 A;  4UY8 5;  1FE4 A;  1YVF A;  1GMW A;  4RJV A;  5KFN A;  2R7V A;  3ZNJ 1;  4ED3 A;  5KAK A;  2Y9H A;  1S6P A;  3CED A;  2DXE A;  4YY3 F;  4B9L A;  3NBP B;  4QIF A;  2J9C A;  2ADB A;  1YIJ S;  1NND A;  4FBT A;  4WFZ A;  4ZPD A;  2MB0 B;  3BSN A;  1FTC A;  2HS0 A;  4QZV B;  5GAH I;  4DFJ A;  2XGQ A;  5GAE I;  2XLI A;  4HDH A;  3N0V A;  4M5K A;  2VG6 B;  3CMA S;  3BSO A;  1SJR A;  2PE8 A;  5CYM B;  2XNR A;  3G5O A;  2DBB A;  1H0H B;  4D3H A;  5F3Z A;  4K5R A;  3FJ2 A;  4CLU A;  4ZP7 A;  1HKA A;  3SQO P;  2I1R A;  4YB6 A;  1KFS A;  1IQZ A;  4FZV A;  1N48 A;  5KFA A;  5GAH U;  4O44 A;  2UUC J;  2HVZ A;  1D09 B;  1I5O B;  2J9E A;  2HBY B;  2A2D A;  1DQ9 A;  2B4P A;  1S1X B;  2HHT A;  4KSE B;  3DXB A;  4LR8 A;  5ETV A;  2K1R B;  3OR1 B;  1VQY A;  3CJ2 A;  3DCA A;  1S10 A;  4NAS A;  4B08 A;  3MFH A;  2YWK A;  1MMD A;  3TX0 A;  5CAB A;  2A0F B;  3KJQ B;  3KK3 B;  2YPZ A;  3LUY A;  4MJK A;  5K8N A;  4X4V A;  1X9S A;  1U2C A;  1DLO B;  3O8W A;  1NH8 A;  1S77 D;  1MNE A;  1FTR A;  1NPR A;  1HQU B;  4F0K A;  1KP6 A;  3DLJ A;  2UU9 J;  3PYE A;  1R8C A;  5DG9 A;  1BQN B;  3ZZR A;  1TV6 B;  3ZZP A;  2YH1 A;  4NRT A;  3VEA A;  1WEY A;  1O0P A;  3VGS A;  1U02 A;  2AHO B;  3MMB B;  3JS9 A;  1MSW D;  1SL0 A;  4OMF G;  3C14 A;  3HO1 A;  4WE1 A;  1U1P A;  1PYS B;  3IBW A;  4ZPW R;  4ZIT A;  1H98 A;  4JI6 J;  2CQB A;  4B9S A;  2XSF A;  4DZD A;  3G6X A;  2GA7 A;  3AA9 A;  2D3U A;  4HHU A;  4JI6 F;  2JC0 A;  3GIM A;  3DOK B;  2UXB F;  2VOP A;  4RNH A;  2CJY B;  2D3O R;  2AGO A;  2ALY B;  4DF4 A;  3DRP B;  2C3U A;  1XMQ J;  1CJV A;  2DNM A;  2JH3 A;  4NZ7 A;  3E51 A;  1M90 T;  3R6L B;  3W2W B;  1EQM A;  1XMQ F;  1S6Q A;  3QIP A;  4ED7 A;  1IVZ A;  1VQS A;  3CD6 S;  4OYW A;  4MAK A;  4FXW A;  2Q66 A;  2JSX A;  1H7X A;  2YNF B;  1DTT B;  4DR1 J;  3PG9 A;  5AJ3 J;  3QQC D;  3GB0 A;  3MI7 X;  1RT2 A;  3M9O B;  5HP1 B;  3JSM A;  2UXC J;  3MED A;  2CPE A;  3ZTO A;  2OPP B;  4Z2X A;  2G0I A;  5DS7 A;  4ECS A;  2E9R X;  3MAA A;  4I69 A;  3HZE A;  1M1K T;  4C8M A;  1EKR A;  5J1P A;  2XMT A;  1NK0 A;  5H1S V;  5H9E K;  2RF2 B;  2VKR A;  1VJQ A;  5DJB A;  5BYS A;  2JEF A;  4J7C A;  1WEX A;  2A18 A;  2MKC A;  3M05 A;  3NNA A;  2YWW A;  4JI7 J;  2JFD A;  3VZI A;  3I56 S;  4DV5 F;  4OZ2 A;  3CJT A;  3I4P A;  2OPR A;  3QFW A;  2IJR A;  3MM6 A;  3TOQ A;  1IQT A;  2PC6 A;  3H7H B;  4DCO B;  2GO9 A;  3N79 A;  1UEU A;  3MOJ B;  3A4T A;  1RJJ A;  4DL6 A;  8ATC B;  3BO4 A;  2ZNZ A;  3MTK A;  1IKX A;  1B0T A;  1VLY A;  4OX9 J;  3RBE A;  1FKA F;  1CUL A;  5DG7 A;  1FK9 A;  1C0U B;  1WC0 A;  2GHP A;  1C1B A;  1RIS A;  1NH7 A;  2OFG X;  4CT9 A;  3QRP A;  4WF9 Q;  4DL5 A;  4U6P A;  3DRY A;  3FCW A;  1VQ8 S;  3NCP A;  1JLQ B;  3KLH A;  2DNR A;  3UNY A;  2OHD A;  2FY1 A;  2LQJ A;  4XTT A;  3LGH A;  5F0U A;  5LSR A;  4CTA A;  1GQE A;  1XTZ A;  2NR0 A;  2FJD B;  4KPC A;  3KTQ A;  3QBC A;  4RO0 A;  3TJ8 A;  4HEA 9;  2KU7 A;  3CT9 A;  3LAL A;  3D1Q A;  1TFW A;  1U0S A;  2JEG A;  2ZKU A;  1KWM A;  4CT8 A;  2HLT A;  4C0H A;  2IM3 A;  4X4P A;  1RT3 A;  5F8G A;  4CZC A;  2V8V A;  1CQN A;  2MY8 A;  4IFV A;  2HHX A;  4JOU A;  3AAW B;  3IN5 A;  4PG6 A;  1JJ4 A;  2F5G A;  1KQG B;  2B7B B;  3RRK A;  1DAR A;  2V0N A;  1FFW B;  3CCV S;  5KT4 A;  3DGP B;  4YR0 A;  3EE3 A;  4H54 A;  4CO1 A;  2V69 A;  5KFC A;  2FJA B;  2E1A A;  2YKN B;  3C66 A;  1ROF A;  4X66 J;  2CA9 A;  3UDE A;  3DDN A;  4B02 A;  3P3D A;  4NYP A;  4G1P A;  3HJV A;  4K4X A;  4J37 A;  3J7Z 5;  1YKW A;  5A2Q Y;  2KZZ A;  2QA1 A;  1VQ5 S;  3TP2 A;  5LJ5 Y;  3MPD A;  2ACY A;  1FI4 A;  1KLN A;  3OQ2 A;  3ET6 A;  1REG X;  5JXS A;  4F4Y A;  1U47 A;  4J5O A;  3BGU A;  4ZVR B;  5ETP A;  5J2P A;  2FGC A;  4UZC A;  2DTJ A;  3T5H A;  2K2P A;  4L75 A;  2WHO A;  3NGT A;  4ECT A;  2XYH B;  2WCX A;  3GG0 A;  3AOA A;  4ES2 A;  2XBP A;  3KYL A;  3OR2 B;  2D9P A;  5IM0 B;  1KLM B;  2DEJ A;  1RB0 A;  1C1C B;  2W2Q P;  2CRL A;  5BYR A;  1N5S A;  2G0C A;  4ZKA A;  2ATL A;  3D6H B;  4TU9 A;  4NI2 B;  4EGL A;  4M95 A;  2CNN B;  4MTP A;  1GX5 A;  1RTZ A;  3C15 A;  3I9Z A;  3HHL A;  2Y1I A;  3TI0 A;  2KOE A;  4RBU A;  1SJQ A;  2KDO A;  4CP5 A;  4P2X A;  4NYZ A;  1H72 C;  2WBR A;  1WOO A;  2HVD A;  3QLH B;  1S9F A;  1EB0 A;  5DQI A;  2BAN A;  2Q6B A;  3VZH A;  4J9K A;  4I7F B;  4NXN J;  1HPZ B;  2C3M A;  4DSI A;  1P9Q C;  3BQ1 A;  5L1J A;  3PX0 A;  4HT7 A;  2VD3 A;  1XNQ F;  2IFX A;  3CUN A;  4YHH J;  3RG6 A;  2BR0 A;  3NAI A;  2ZUA A;  4G65 A;  1RTI A;  1CS4 A;  4J9P A;  2H9Z A;  2OLW A;  3DLE A;  2MKI A;  3G4S S;  2BVZ A;  1SKS A;  4UZB A;  1SQF A;  2CZ4 A;  3UN5 A;  1RAF B;  1FVQ A;  3PFE A;  1RU2 A;  2GJ2 A;  3DRS A;  3G8T A;  2EXU A;  4FF1 A;  3D68 A;  1RU1 A;  5CCL A;  2KI2 A;  4MK9 A;  2RKI A;  1RT5 B;  4OHW A;  1YJN S;  3CO0 P;  3H59 A;  1BHN A;  5HJX A;  1ZPW X;  2Z56 B;  2XCA A;  5IXU A;  2DR9 A;  2Z8Q A;  3PKM A;  2XMV A;  2W4D A;  2CAX A;  1U49 A;  1V3Z A;  4LF4 F;  1TL1 B;  2F4V J;  2DNK A;  4OI6 A;  5HMX A;  2UVW A;  2Y0S D;  1T94 A;  4RW7 B;  4DSK A;  1RYR A;  1TL7 A;  1HI0 P;  1IBK F;  4KGX B;  2DK2 A;  2DO0 A;  2OPQ A;  1KSP A;  4GO7 X;  1DQA A;  4UW2 A;  1F1B B;  3UDL A;  3OL9 A;  4IO1 A;  5L39 A;  4PRF A;  3SZ2 A;  1ZOT A;  1VHF A;  2KKE A;  1A9N B;  3HM9 A;  2LQ9 A;  3ILJ A;  3FSI A;  2W8L A;  5HBM A;  1QUP A;  3VAH A;  4LF5 J;  2MQL A;  1O8B A;  2CIM A;  3BS9 A;  4DV3 F;  2JC1 A;  5J2N A;  2PMW A;  5T41 A;  5AE2 A;  4UTG A;  1I94 F;  1HNV A;  2LXU A;  5GMK a;  3P96 A;  3LTO A;  4F50 A;  3FBE A;  4YQW A;  2E1P A;  3BH6 B;  4Q0B B;  3HUL A;  2A6O A;  2LEP A;  2DXD A;  2FVC A;  4YUD A;  2NXC A;  3SEO A;  4ER8 A;  2XMW A;  3B78 A;  3GWC A;  4ICL B;  3M2U A;  5I42 A;  4ECV A;  1RDR A;  3N5F A;  2HFO A;  7AT1 B;  2HGN A;  1VQN S;  4CYU A;  1VRT A;  4G3I A;  1S5Z A;  4A8X A;  3QID A;  4GC6 A;  3MM8 A;  3POT A;  4B3O B;  1H73 A;  3KLV A;  2NPI A;  2HHH F;  3MM9 A;  2E5I A;  2BAC A;  1D3W A;  1Q1K A;  3EX7 B;  4KQZ A;  1RK8 A;  3SYZ A;  1RE1 B;  4YME A;  4LF9 F;  1ARQ A;  2CFX A;  4WK1 A;  4PEO A;  1RP5 A;  5KOX A;  4J9U E;  4USV A;  2J9D E;  3LW5 C;  2VOO A;  2M5Y A;  3PJ9 A;  5B0G A;  4CH0 S;  2OGU A;  5KG4 A;  2Q6C A;  3QMQ A;  1Q5V A;  2QL9 B;  1UET A;  1H74 A;  2FHO B;  1CQM A;  5ITH A;  3LPY A;  3Q86 A;  1QSY A;  5GMD A;  4P2F A;  4TY9 A;  2ZE2 B;  2JLF A;  4RKU C;  1RT6 A;  1S4F A;  2DRB A;  3K5N A;  4UST A;  2ZZT A;  2NXJ A;  1J5E J;  1MWY A;  2H5I B;  2YNI A;  4A8O A;  3I0R A;  1YWX A;  1J5E F;  1IWG A;  1RCX B;  1OSC A;  1VS3 A;  3I5B A;  4J9Q A;  4YS2 A;  4PWD B;  4GMK A;  4A47 A;  1ZM9 A;  5HQL A;  2W01 A;  3KUG A;  4C11 A;  2MKY A;  4OYX A;  3KHL A;  3K5P A;  2D7S A;  4KAI A;  4AQY J;  2AJ1 A;  2LVW A;  1GMU A;  5E7O B;  1TMM A;  1ULR A;  1VBK A;  2V63 A;  4MFB A;  2F9J A;  4NCG B;  2IM1 A;  3QSI A;  4NE9 C;  5JMN A;  3WC0 A;  4DV4 J;  4BCA A;  3GFX A;  2RS2 A;  3C46 A;  4IDK B;  3R2C J;  1RHJ B;  2GQ2 A;  4MH8 A;  2A2C A;  6FDR A;  3D1H A;  3MEE B;  4XPC A;  2K3I A;  3OXF A;  2VPW B;  2VC0 A;  3CNQ P;  2ALZ A;  4AAI A;  4UOH A;  3DRR A;  4Y34 A;  5M2U A;  3GQC A;  2ZC4 A;  3H20 A;  5IWA F;  2F40 A;  2V8D A;  5HAO A;  2PMZ D;  4IG0 B;  2K9I A;  2VFS A;  4J9S A;  1WWH A;  4RNO A;  5K8O A;  1BQX A;  1N33 J;  3LP1 B;  3TA0 A;  1W26 A;  3UWT A;  5KFI A;  3OUY A;  2DRD A;  4K4V A;  1N33 F;  4H4O A;  1H2T Z;  1TZ0 A;  4P9S A;  1IBC B;  4NZ6 A;  5CYQ B;  1Y5L B;  3DLL Q;  2LP4 A;  4AL6 A;  4JI0 F;  2OEK A;  1SKR A;  3H5Y A;  1QTN B;  2YTC A;  3M8P B;  2FHM A;  1HWI A;  2MHN A;  2OEL A;  3GJR B;  3DHX A;  4WJB A;  5G0R B;  1YRU A;  3IS9 A;  4ZHR A;  3G87 A;  1S0M A;  3RU0 A;  1S72 S;  5A8K A;  4QPT A;  3IM8 A;  2JOQ A;  5IT4 A;  3KJV A;  1PJ5 A;  2QA2 A;  5T7L B;  1WC1 A;  3NS5 A;  3CJR A;  3BYP A;  4F4A A;  2LA4 A;  1U6Z A;  1FRL A;  2W9C A;  3CD0 A;  2DNN A;  4ID5 B;  5I4M A;  1VK8 A;  4PXC A;  1GT8 A;  2BE2 B;  1N5T A;  1B0P A;  1RT7 B;  1S48 A;  2WVB A;  5DQG A;  2EK1 A;  1VBX A;  3CW2 C;  2CQ0 A;  1MN7 A;  1RHU B;  2ZVI A;  3CC7 S;  2GVZ A;  4XIU A;  1WOR A;  1O51 A;  2I0X A;  3NO7 A;  3U7J A;  2IRX A;  1MMN A;  1RCO B;  2ZH7 A;  1HBU A;  1RTJ A;  2DGW A;  1HWL A;  2B4U A;  2HUR A;  3TQ1 A;  2V4J A;  4B9T A;  2VL1 A;  4UOG A;  3MR3 A;  4WFN Q;  4LRB A;  4QR0 A;  5C42 A;  1UW4 A;  1RHQ B;  3OLA A;  2DT9 A;  1RAC B;  4I6W A;  2FC8 A;  5EDW A;  1RWM B;  2GV1 A;  1F9F A;  3L3C A;  1BQM A;  2C3O A;  1JIH A;  5J2M B;  2C2N A;  5DDR C;  4DXL A;  4CWB A;  4DPX A;  2BW7 A;  2WW8 A;  1E6V B;  1QD1 A;  4K4Y A;  3OVS A;  1VIO A;  2GS8 A;  5ETS A;  4IR9 A;  1T95 A;  4FP9 A;  2FHJ D;  4KFB B;  1SKU B;  4X62 J;  2IM2 A;  2I5J A;  3R5C A;  5LSO A;  3NS7 B;  1Q8K A;  3BDP A;  1HAR A;  3LGM A;  4X62 F;  2UXD J;  2IA6 A;  1T8E A;  2OKQ A;  3ADA C;  3RW7 A;  4LF7 F;  2AIR B;  2PMH A;  2C42 A;  3R5D A;  2PN6 A;  4DPU A;  2M3D A;  1L5U A;  1QE1 B;  4DJB A;  3C8Y A;  5KFP A;  4KPY A;  3GIK A;  4P10 A;  4F4K A;  4A8W A;  3G9C A;  4ENO A;  2RDJ A;  1RTD B;  4OYO A;  5LL6 d;  1YJ7 A;  1Y10 A;  1VQ4 S;  3QAE A;  4NLY A;  4J90 A;  3THV A;  5CQG A;  4FVM A;  2D3O 1;  1UVL A;  3PZP A;  2RB7 A;  3AD9 C;  1SPB P;  1WF0 A;  2HWH A;  1HMV B;  1Q7Y T;  2VG5 B;  3M6W A;  3RB6 A;  2F8M A;  4WPA A;  1HBO B;  4LF6 F;  3R5B A;  1HBM B;  2PSZ A;  1NCL A;  3GFH A;  5AXL A;  4LRF A;  1TUG B;  2BE7 D;  2DGV A;  2ZOM A;  2PGC A;  2ROG A;  1HW9 A;  2XMJ A;  4DV0 J;  1BXN A;  2KG1 A;  5DGA A;  3PW4 A;  3VQT A;  1JJ2 R;  3AB2 B;  3DI6 B;  2MPU A;  1LWE A;  1RAH B;  2CJQ A;  3IWL A;  3P45 B;  4LF1 A;  1NSK L;  1FDA A;  3QNW B;  3IAM 9;  4WZQ A;  2KRR A;  3KUE A;  5DM6 Q;  3CCS S;  1VK3 A;  1FD2 A;  3MEG B;  1UJ6 A;  2KO1 A;  3UI3 A;  1M0S A;  4FXE A;  2CKW A;  3AFG A;  2GNK A;  2QFI A;  3M1V B;  2BQ3 A;  4A8F A;  3CJ3 A;  4ZVS B;  3T19 A;  2V9W A;  3NBP A;  5KOW A;  2PDA A;  1HFE L;  2VH7 A;  1P94 A;  2V2K A;  4RW4 B;  5KFF A;  2VG6 A;  3DM2 A;  4GKK J;  4OX6 A;  4NX9 A;  2F4F A;  3PEJ A;  5CYM A;  2KEL A;  5ETL A;  5F41 A;  3OFE A;  4JI3 J;  1FWL A;  2QA4 S;  5D8H B;  2Y8W A;  4MKV A;  4RUA A;  2H3E B;  4HAC B;  1TTH B;  3H4B A;  5AE1 A;  3H2V E;  2O67 A;  5F9L A;  2K5J A;  3JTO A;  3DLG B;  1S1X A;  3OTD A;  3MPW A;  3HT3 A;  2E5J A;  2ZH4 A;  1T05 B;  4DUT A;  4FKY A;  1GTH A;  1UZD A;  2VFU A;  1NJW A;  2K1R A;  2VBZ A;  1RWO B;  4I1T A;  3CD5 A;  1CJT B;  1Q53 A;  3KK3 A;  3R5G A;  1CC8 A;  2WSE C;  2YPY A;  3GFZ A;  3MCS A;  2ZM6 J;  1R8H A;  3MTJ A;  3K5L A;  2NCK L;  1K47 A;  3IP0 A;  3VVU A;  3RJM B;  4OI0 A;  3CCU S;  3TYT A;  1BQN A;  4IH7 A;  4M5D B;  2W2O P;  2VQF F;  4HV0 A;  2KXF A;  1XMB A;  5KFT A;  3T1H F;  1IR0 A;  2UUT A;  3MMB A;  2PFD A;  3TVY A;  5CXT A;  1P1T A;  2X3G A;  2DHG A;  1B3T A;  4DG1 A;  2FVR A;  3TAP A;  5J2Q B;  3FT7 A;  1FX4 A;  2B7C B;  5KG7 A;  4DS4 A;  1FNO A;  4MKA A;  3DOK A;  3T1A A;  4DS5 A;  3X1L B;  2EWH A;  4W4M A;  2RSQ A;  1AW0 A;  4EI2 A;  4M63 A;  2WB4 A;  3FUY A;  3HD1 A;  2GMJ A;  3SCK E;  3DRP A;  5E0O A;  2X1B A;  5CCM A;  4DR3 J;  1ZBT A;  3ZZO A;  1UVK A;  1TK5 A;  4AXJ A;  3W2W A;  2XY5 A;  4K2J A;  4DR3 F;  3PAC A;  2DNZ A;  3M6U A;  1S6P B;  4C3M A;  3QGH A;  3N9U C;  1N52 B;  5B0B A;  3NXZ A;  5GAD I;  4CO0 A;  3CDU A;  2YNF A;  4PAB A;  1U6B A;  4UQT A;  1DTT A;  1QJH A;  1RBA A;  4DR4 J;  2HAI A;  3UD3 P;  2ZVS A;  2E1M C;  5HP1 A;  4GRS A;  4HLB A;  1SIW B;  2KHD A;  2OPP A;  4U8V A;  2HWT A;  2G2Y A;  4TNO A;  1TK0 A;  3GSD A;  3JXO A;  1SC4 B;  3MPU B;  3PDN A;  2BM0 A;  3SCL E;  2IJN A;  4LFB J;  1HNI A;  1T7P A;  2MST A;  4NCB A;  3QAU A;  1EET B;  4KB7 A;  2H1Y A;  3KWM A;  4O44 B;  4KY3 A;  2ZFH A;  3HVT B;  4M1K A;  4C8N A;  3S6E A;  3V6H A;  1U1O A;  1RKI A;  1QDU B;  2ZUG A;  3T5L A;  4NL5 A;  2AJQ A;  4EO6 A;  4KHM A;  4USU A;  4NLR A;  1QTM A;  2XY7 A;  1KS2 A;  4J9O A;  3Q8Y A;  3TUZ C;  5T14 A;  3J7Y I;  1PJ7 A;  1MWQ A;  2D9O A;  1VC6 A;  4PAA A;  2HQC A;  3GP9 A;  1VIS A;  1BY9 A;  2RVJ A;  3CUL A;  2XWY A;  3PIP Q;  2GJF A;  3JAM Y;  1LWX A;  2GFF A;  4FDF A;  3PYD A;  3HCX A;  3WZ0 A;  3M9M B;  4WTY A;  1C0U A;  3W8G A;  2AJ0 A;  4WE1 B;  3OLB A;  5F8N A;  1B7Y B;  1W7W A;  1Q16 A;  2HW3 A;  2LFV A;  1VQL S;  2LQ8 A;  2CPZ A;  5HQM A;  2RE1 A;  3W66 A;  4DR2 F;  1JLQ A;  2IM0 A;  3M4X A;  2BQU A;  3C6T B;  4Y2C A;  2R2U A;  2HFV A;  2HZC A;  3ULH A;  1TU0 B;  1LWC B;  2ASD A;  2ZH3 A;  1U48 A;  4GO5 X;  4DN0 A;  4PWU A;  2VBW A;  3CCR S;  3IR5 B;  5K8M A;  1U4B A;  3OTO F;  2BUN A;  3QIP B;  1WC3 A;  2UVU A;  4DR6 F;  4I6Y A;  3AJD A;  4MT1 A;  4EYH B;  1DUR A;  1KBR A;  3MEK A;  4EEY A;  4ZCI A;  2B9X A;  2UVR A;  2M7S A;  2GIR A;  3K57 A;  3W9I A;  1VQK S;  5EX3 A;  2XI3 A;  3MFI A;  3DGP A;  3S01 A;  4MK8 A;  2DNP A;  2N7C A;  4CH7 A;  2M8D B;  2HVH A;  4M5N A;  3CCJ S;  3I4H X;  4C7Q A;  5K8P A;  1NK6 A;  1J2V A;  1IR2 A;  1X93 A;  4ZPV R;  2H5E A;  4X64 F;  4JI1 F;  4CLT A;  2DO4 A;  1S0N A;  1SIZ A;  2RML A;  2QMW A;  5AXM A;  2JBV A;  1YBU A;  4YN3 B;  2RDD A;  4WBF A;  2KT5 A;  3VCD A;  4TYA A;  2UUB F;  4PYA A;  5CAA A;  4NA1 A;  1AUS L;  3J80 U;  2KKH A;  2HVI A;  1N0U A;  3T5J A;  3LQV A;  1KKH A;  1OIA A;  3GSI A;  2UUA F;  3NNH A;  1KR4 A;  2FB0 A;  1IKW A;  2M70 A;  2NUU G;  2IRU A;  2IYI A;  4ETX A;  5HAT A;  1TFY A;  4AT1 B;  3GCW P;  1YJT A;  2NUH A;  3D0G E;  5ETO A;  4F4X A;  1H38 A;  3GJQ B;  1FK9 B;  1WKJ A;  2J9D A;  5IM0 A;  1K0T A;  3SSR A;  1ARR A;  2APO A;  4O3O A;  4E8U A;  2BJ7 A;  3SDE B;  3VEB A;  4YB5 A;  3SXL A;  1WOP A;  1HYS A;  4PG5 A;  3ETM A;  2Y8Y A;  1RYS A;  4DL3 A;  2XS5 A;  3J7A 1;  2KYZ A;  1TL5 A;  3W63 A;  1FRM A;  3QLH A;  3K0J A;  4I7F A;  1ZAX A;  2QLX A;  1KFD A;  2R2T A;  4FN5 A;  3BPD A;  3P4U B;  2V8G A;  1RT3 B;  2BX6 A;  4Q43 A;  5BXI A;  4O0I A;  5D0H A;  2IY5 B;  4CLW A;  2VJV A;  1RI7 A;  4OZN A;  1ELO A;  4TKT A;  4F2S A;  3PJX A;  2ZHO A;  2AGQ A;  3N01 A;  5HLF B;  2CJA A;  2J8S A;  5KG1 A;  1EZZ B;  4OJG A;  4ECX A;  4JV5 J;  1C4C A;  1IWA A;  2G1D A;  4OV1 A;  4FVC A;  1FKP A;  3PTW A;  2IYG A;  3ENA A;  4DEZ A;  5GAG I;  5E41 A;  3MWB A;  4CLZ A;  3VAG A;  3NWG A;  1EAY C;  4UOF A;  2WB1 D;  4CLK A;  3ZZY A;  4U67 Q;  3EZ5 A;  1T9T A;  2UP1 A;  2D3Z A;  3GJS B;  3CF5 Q;  3JSR A;  4J9N A;  2BXJ A;  2KN4 A;  2W9B B;  3VAF A;  1K44 A;  1RBL A;  4WFB Q;  3LWM A;  2B8P A;  1IBL J;  4DF8 A;  3U1M A;  1M5V C;  3Q2S C;  2P2C B;  2GAG C;  4RW7 A;  4B3T J;  2HFZ A;  1LK7 A;  3AJ1 A;  4OYB A;  1YZ6 A;  1QY7 A;  4M5M A;  4C8Y A;  1Y3K A;  3D6T B;  3IBC B;  2RU9 A;  5D0R A;  3V6D A;  1X4A A;  3O44 A;  4NCA A;  2CPF A;  2HQ3 A;  2CPG A;  4P71 A;  3K8V A;  1NEE A;  6AT1 B;  3ZZ0 A;  4S0M A;  2CWX A;  2GC8 A;  2XWX A;  1N8R T;  2FZK B;  5LOQ A;  1MN9 A;  1T03 B;  1T9U A;  2AX0 A;  2HKE A;  3PY8 A;  3Q8Q B;  4OX8 A;  2Q79 A;  1GXU A;  4Y2A A;  4FF4 A;  4KT0 C;  1U1M A;  4FXD A;  2LDY A;  4PYD A;  4OQJ A;  3CME S;  1BDT A;  2EFV A;  3C3L A;  5FII A;  4Q0B A;  1Q8I A;  2P6S A;  2ILZ A;  4F2R A;  3S1T A;  2VHG A;  3IBF B;  4HHH A;  2KHC A;  1M5O C;  4HL9 A;  4ZLJ A;  2XB2 D;  5HRO A;  4LSN A;  4WP9 A;  3THT A;  3TEH B;  1XK8 A;  2EK6 A;  4CLF A;  4K50 A;  2EG1 A;  1JXE A;  3CDE A;  2LU2 A;  3IAS 9;  1SQE A;  3EGZ A;  1YSJ A;  4Q8E A;  2R7W A;  3RB3 A;  3RTV A;  4B3R J;  4CO2 A;  1L3T A;  2XM3 A;  1JKH B;  1UKU A;  2QX0 A;  2O01 C;  2RKI B;  1SQG A;  1UFK A;  1CVJ A;  3CCL S;  4DCJ B;  4TU7 A;  4V19 J;  2QFJ A;  4WFY A;  4DPO A;  2EKY A;  3QZ7 A;  3W8P A;  1TR0 A;  1XJW B;  3ETO A;  3FQK A;  1SVD A;  2J8A A;  1U0H B;  1SH2 A;  1FNM A;  1HW8 A;  3KDO A;  5KFY A;  1TKD A;  2MHE A;  1OYD A;  1TL7 B;  2BKN A;  3H40 A;  2XTJ P;  2A1B A;  1V3S A;  1YJU A;  1PKU A;  4LFC J;  2QA4 G;  1CBK A;  4ZS6 A;  5K14 A;  2ZE2 A;  4J91 A;  4LR7 A;  3OSN A;  1NZ8 A;  3W9J A;  4LFC F;  2GW8 A;  1OPI A;  2IAJ B;  1F5B A;  4LR9 A;  3SV3 A;  5KFM A;  4XPE A;  4GVB B;  2POK A;  3LP0 B;  1B70 B;  4KIA A;  4RW6 B;  8RUC A;  4A8Q A;  2NXE A;  4PWD A;  4G1I A;  3W5X A;  4ILM A;  3CC2 S;  5J2N B;  2GIF A;  3BGL A;  4NLV A;  2N3L A;  1X4G A;  1KN6 A;  4EZ9 A;  3PO4 A;  2ZDP A;  1QUV A;  3MM5 A;  4ECQ A;  4WXO A;  1KQS R;  2O3D A;  4R8U A;  2AEM A;  1RWV B;  2DPJ A;  1VQ9 S;  1FWK A;  3H0P A;  5IS2 A;  3Q8V A;  3KUH A;  1NJZ A;  2KB2 A;  3LGN A;  2W7P A;  4IDK A;  4DR5 J;  1FKO B;  4ZCK A;  3F41 A;  2VIC A;  2OFH X;  3ISN D;  3O6Q A;  2ZHA A;  5A0Y B;  4K0K J;  1MYL A;  3T1Y J;  4QU7 A;  3QRQ A;  5DZ7 A;  3HSJ A;  4K0K F;  3M2U B;  3H2L A;  1OY9 A;  2AF6 A;  2RS8 A;  2R2R A;  4CYU B;  1VRT B;  1OMS A;  1VLO A;  1FJG F;  1U45 A;  3MM8 B;  3POT B;  3R27 A;  2LXI A;  3D2W A;  3A1Y G;  3VTI A;  2HG4 A;  2EEY A;  3GCX P;  4I0W A;  2M4M A;  3MM9 B;  3ZNU A;  4N8N A;  2MZS A;  4IG0 A;  1LQ9 A;  1ZA2 B;  4KGM A;  5FLX U;  4LBI A;  1MG7 A;  2HMI A;  1VOM A;  2FDN A;  4BWM A;  2LKZ A;  1NME B;  4OHZ A;  1XQI A;  5CYQ A;  1JLE B;  3M8P A;  2F63 A;  3TAM B;  3G2X A;  3BKT A;  3QZ8 A;  3G6Y A;  1RHK B;  1Q79 A;  4EO8 A;  5G0R A;  2J7K A;  1EA4 A;  4IRD A;  4CQ1 A;  1GMV A;  3M8Q A;  2ACM A;  3ILL A;  3MEC A;  2DXF A;  1NSQ A;  2QT7 A;  1J5O A;  3CJQ A;  1LEO A;  4HDG A;  4CIO A;  3W2V A;  3H5S A;  4KH0 B;  4Y2M A;  4NOH A;  3I0R B;  1NM2 A;  3K2Y A;  2GO8 A;  3QGG A;  3NMR A;  3QYY A;  4QYZ K;  2DHA A;  2J0X A;  5D4O A;  1BWV A;  3UQS A;  1S12 A;  2RHQ B;  2BE2 A;  5IC4 B;  3WX8 A;  5RUB A;  2BQR A;  2CPD A;  2ABY A;  5JVH Q;  4OJ3 A;  2YBV A;  3A8K A;  1U9P A;  2G9O A;  4N5S A;  4MFB B;  2DGU A;  3OL8 A;  1XN9 A;  1VBY A;  3BKF A;  2BNZ A;  1FXD A;  2ZJR Q;  3ZZU A;  3CDW A;  1NB2 A;  2QSF A;  2B4V A;  1KHV A;  4FPI A;  2OEJ A;  3PW0 A;  3EGN A;  5KT2 A;  3HFZ B;  4LT6 A;  1ZM3 A;  4ID8 A;  3MHY A;  3MCM A;  3MMJ A;  1EP4 B;  2HIQ A;  3ZO7 A;  3EXC X;  4JI4 J;  2HHV A;  3RAX A;  2GMH A;  3HF5 A;  1SL2 A;  5J2M A;  5KG3 A;  5HJY A;  4JI4 F;  2IC3 A;  2KRB A;  3GR1 A;  2AJF E;  1E6V A;  3TNV A;  5IV4 A;  5IT9 Y;  2CVI A;  3S8S A;  2L9N A;  1RT4 B;  1IUJ A;  4F04 B;  1P8G A;  3OUY B;  1NLA A;  3N6M A;  3P49 B;  2R7X A;  5IFM A;  3RBD A;  4Y3C A;  1R31 A;  3KHG A;  1GX6 A;  2P6T A;  2Q2K A;  1HNW J;  1UWB B;  1DBD A;  3CCE S;  3KK1 A;  2ZJP Q;  2MY7 A;  1EQ0 A;  3D3B J;  4DV2 F;  1FRK A;  1HR0 J;  3G6E S;  2MJN A;  2EW9 A;  4A48 A;  2BDP A;  2OSQ A;  3KJV B;  1HD0 A;  1L3V A;  1RTD A;  1SJF A;  2FLO A;  2DNG A;  3R3T A;  2HZV A;  2MZT A;  4MYT A;  1U7L A;  4LVO P;  4OL8 A;  3W5Y A;  4U7U D;  2RQM A;  5SUH A;  3TAN A;  3VR1 A;  4BWJ A;  2F8E X;  4QWB A;  7FD1 A;  4WCE Q;  3FMT A;  4RWW A;  2MKJ A;  4V1A k;  2CDR B;  2PII A;  1GXT A;  2VG5 A;  3LAK A;  1RHM B;  3LO3 A;  3ZTS A;  1WKL A;  3LP2 B;  1HBM A;  4K4T A;  2RRB A;  3GE9 A;  2AZ3 A;  3MD1 A;  2CQ3 A;  4P7V A;  5I3Q A;  2MQ8 A;  1CSJ A;  4QW9 A;  3H87 C;  1TAU A;  4QYZ J;  1UAW A;  1VFJ A;  3DI6 A;  1RXO B;  4PG4 A;  5J1E B;  2Z2L A;  3QJP A;  3PX4 A;  3MMA A;  3C16 B;  1Q86 T;  3N5B A;  4NZ0 A;  2B6A B;  5C42 B;  3IWX A;  5K9F A;  5EWG A;  2ZD1 B;  4C48 A;  3MCO A;  2JEJ A;  3MEG A;  4MMO A;  4C8K A;  4PXE A;  1R8A A;  2KM8 C;  3W62 A;  3NNC A;  1HWJ A;  4OHY A;  3I87 A;  2HFU A;  4RBT A;  3KFW X;  3ZZZ A;  4OYI A;  3K7R A;  3M1V A;  2YWF A;  4UY8 T;  2XCP A;  3DFE A;  3ENV A;  2DGT A;  4C0B A;  4F7V A;  1RAG B;  4X2B A;  2XEX A;  2X1A A;  3WHI A;  1PYT A;  2VDH A;  4RW4 A;  1DRZ A;  4DV6 F;  1SJ4 P;  1F9H A;  3QT6 A;  4ECU A;  5L9N A;  4HAC A;  3WIU A;  3SV4 A;  2DCU B;  2GVD B;  1N54 B;  3MM7 B;  2DGS A;  4CO3 A;  3QPI A;  2VA2 A;  3DLG A;  5AE3 A;  1RWX B;  2AY0 A;  3KDN A;  3FSX A;  1T05 A;  2RD5 C;  3BGO P;  1NHK L;  4DUZ F;  3G96 A;  1R3N A;  1NXI A;  4CLL A;  2BOP A;  1CJT A;  2H48 B;  4DX6 A;  4L72 B;  3JYT B;  4YP3 A;  2E9Z A;  2RU3 A;  3M30 A;  2VZ9 A;  4KRW A;  3PEH A;  3M2V B;  3CGI A;  2NPF A;  2WVF A;  3AT1 B;  3FBB A;  4CLP A;  1G4C A;  4M5D A;  2XZT B;  2OI2 A;  2ADL A;  1SH0 A;  3OVA A;  3MUM P;  4L76 A;  4P52 A;  2RRA A;  4N77 A;  5ADZ A;  5IT0 A;  5KG2 A;  2QL5 B;  2JJ4 D;  5L1L A;  4NLW A;  4Y6I A;  4ILL A;  1FJ7 A;  1D9F A;  2V2Z A;  1PGZ A;  2XS7 A;  1MRO A;  4KR0 B;  5K5M A;  1TMJ A;  1SB6 A;  1IN0 A;  1HHQ A;  1S4E A;  1V5I B;  1XR6 A;  2IA0 A;  4UQG A;  4I67 A;  3HHN B;  1M5S A;  5CD4 A;  4RU2 A;  3CE8 A;  3M8Z A;  1RZM A;  1FD8 A;  1LFP A;  2DCL A;  2JXH A;  4EWT A;  3EMT A;  4DHV A;  4A8Y A;  2AMC B;  3DM2 B;  3EVW A;  1SIW A;  4OZ5 A;  2W9A A;  3IGV A;  4QIW D;  1PC5 A;  2F65 A;  2J76 E;  4FS1 A;  2PFF B;  2WSC C;  1X4B A;  1P9Y A;  2N7Y A;  1EET A;  1M5H A;  2JLG A;  5KFJ A;  3VAL A;  2D41 A;  1VQM S;  5GAE U;  3EVM A;  1S1U B;  3HVT A;  1FJE B;  1D9A A;  1UA0 A;  2UUC F;  1DZ5 A;  2NQP A;  2CQH A;  4NLQ A;  4P75 A;  4F26 A;  3A8I A;  4ANE A;  2FC9 A;  1JXL A;  3BBC A;  2WAQ D;  2B9W A;  1S97 A;  2XGP A;  4NRU A;  2C3P A;  1WAC A;  4CNY A;  4RBV A;  4QJV A;  1Q8L A;  4WYL A;  3DOM B;  3KLF A;  1LXJ A;  4OLO A;  2I8E A;  4DLE A;  4YR2 A;  3FRY A;  3UE2 A;  1G7C B;  2UU9 F;  3EZO A;  3I32 A;  1N32 J;  2E9T A;  4IQX A;  1BGX T;  3KHH A;  1F2G A;  1BUX A;  2YKP A;  4DG1 B;  3C6U B;  1F5A A;  4MK7 A;  4B3S J;  3EGW B;  1YJV A;  5C25 B;  3V4I B;  1VYA A;  2C2D A;  2AZ1 A;  4NLO A;  1HA1 A;  2JL9 A;  2NXU A;  1R7I A;  1P6T A;  3C6T A;  4K8R A;  4TQR A;  1LWC A;  5KFK A;  3HK2 A;  2XLJ A;  2B51 A;  3UD5 A;  1SJ1 A;  4F0M A;  4Q8F A;  2YX7 A;  4WKR A;  3CIM A;  2PO4 A;  2N3O A;  1T02 A;  2CPH A;  3MAQ A;  2ADC A;  1Q78 A;  2Z2Y B;  4K59 A;  4DFM A;  2IMO A;  1GTE A;  4DSF A;  2RNE A;  2JEI A;  2ZC3 A;  2ZIT A;  1WC4 A;  2C3Y A;  4DR1 F;  4LSZ B;  5AJ3 F;  1S1T A;  2UXC F;  4YB7 A;  3EM1 A;  1JNR B;  1HNI B;  2QLB B;  2WON A;  2MQO A;  2XO6 A;  2B43 A;  4OZ0 A;  2FJB B;  2HEK A;  2LEC A;  5M2P A;  4EYI B;  2ZBC A;  4ZCM A;  1OS5 A;  4FYY B;  1R6Y A;  2YWH A;  3HFV A;  2QC3 A;  1WEZ A;  4C0O C;  4A8M P;  5KFU A;  1FHT A;  2QGF B;  3KLE B;  3ZFV A;  4Q2L A;  4C8O A;  4ZLN A;  2CPJ A;  4ZVH A;  1UMJ A;  4JI7 F;  1N5Q A;  2CQD A;  3J7Z T;  4KTQ A;  2VJU A;  4DMZ A;  2WRM A;  1X5T A;  2CNL B;  1X4E A;  1NSA A;  2G0J A;  3GZ7 A;  1PBU A;  4U8Y A;  3MDF A;  3R6G B;  3TAQ A;  1ZPV A;  2EFN A;  4O4R A;  3HPO A;  1HNX J;  3DGV A;  3OFH A;  4ZPC A;  3PV8 A;  4JUZ A;  2A10 A;  4DSE A;  1PAE X;  4OX9 F;  4NA2 A;  3I31 A;  4TXS A;  5DDO C;  1KD1 T;  4RX6 A;  2NXN A;  4C6A A;  2KFN A;  2E5L J;  1Q16 B;  4OYZ A;  3SDE A;  3LJP A;  1MW7 A;  3TZZ A;  3W64 A;  4C3K A;  4LSL B;  3Q2T C;  5KFH A;  3L7O A;  3NCQ A;  2XG8 A;  1G3O A;  4ECZ A;  2N4C A;  2A6M A;  3HHE A;  3ITH B;  5F9N A;  2QTW A;  3BR9 A;  1OYE A;  3WQP A;  5LMU J;  2J6U A;  2ZBP A;  3TAR A;  2DGX A;  2CQ2 A;  4OI3 A;  1Y0H A;  2BRK A;  1NB7 A;  1KHW A;  3NL0 A;  5HMZ A;  1CEZ A;  4EUV A;  3Q83 A;  3OXL A;  3Q8U A;  4LBH A;  4WU3 A;  1Q82 T;  2AJ2 A;  1FA0 A;  4KO0 A;  4JI2 J;  3HLU A;  3IXQ A;  1N5Y A;  5HLF A;  2UVV A;  3E01 B;  1X8D A;  3A12 A;  2U1A A;  5DDQ C;  1OQ6 A;  2HSE B;  1FO1 A;  5KT3 A;  2DIT A;  3JSY A;  1TUW A;  1XMO J;  2VBY A;  1Q8B A;  2O5D A;  1XMO F;  1R6V A;  4X66 F;  2Q43 A;  4WXW A;  4YDD B;  2FHK A;  4ED0 A;  1HWK A;  1O5J A;  1FT8 A;  4I2Q B;  5IQQ A;  2CPI A;  3FDS A;  1N36 J;  4HKQ A;  1HL6 A;  3TUI C;  4OZ3 A;  2DNO A;  1IKW B;  2W9B A;  1V6H A;  5HK4 A;  1YBT A;  2VDI A;  3QGI A;  5I3U B;  5E3P A;  3PVX A;  1VC0 A;  2HHU A;  3KNA A;  2EI5 A;  3G86 A;  1Z1Z A;  4NLT A;  3QJL A;  1XR5 A;  2JXI A;  2ZEJ A;  3RAQ A;  5D15 A;  4QWE A;  2CPY A;  2OSR A;  1RWN B;  1ZAW A;  4BBY A;  2Q3P A;  2DHS A;  5C7P A;  1HYS B;  1CG2 A;  1Q81 T;  3CTR A;  3K5O A;  2ZNY A;  2DH9 A;  3HXM A;  1PIE A;  4ZP6 A;  2M0G B;  2J6T A;  3GMG A;  4ZOS A;  3Q23 A;  2DY9 A;  1T03 A;  2CXE A;  4OIX A;  3D9B A;  1R0A B;  2CJ9 A;  4CDI A;  5A8W B;  4LF2 A;  4NXN F;  4KHP J;  3JQJ A;  1NK5 A;  2XHC A;  2MTL A;  4IOA Q;  1AUD A;  1UVN A;  1EAR A;  1H2V Z;  2G13 A;  2M2B A;  2BNW A;  1U2F A;  2WVD A;  4YHH F;  4Y00 A;  1SXL A;  2V8H A;  4KGV B;  3UR0 A;  3VAJ A;  3DDK A;  2KVQ E;  1IM4 A;  5B0E A;  5DO2 A;  2V94 A;  4WFX A;  1FKP B;  1LW2 A;  3HT0 A;  4KJI A;  2C1E B;  2AYB A;  3ZXW A;  4TLQ A;  1RLD A;  1VR6 A;  1VRU A;  2QN6 B;  4F36 A;  4KGK A;  4D8J A;  1S6O A;  4ETZ A;  1JKH A;  1NKC A;  2QMU B;  2X1G A;  1I3O B;  4CM0 A;  2KTQ A;  3IR6 B;  4NLX A;  2A3J A;  3R8Y A;  1GFW B;  4HH1 A;  2HFN A;  3J81 U;  3V6J A;  5KFW A;  4QWC A;  3ZTP A;  1RAA B;  4J9V A;  4RLE A;  3EDR B;  1U0H A;  2GPE A;  1T9Y A;  2UZA A;  3QT5 A;  1KTV A;  2OD4 A;  3DN9 A;  2F4V F;  1I6J A;  2JLE A;  5ETN A;  4AL5 A;  5FDL B;  4OI4 A;  1RWU A;  3V6D B;  1Z2Z A;  2KYX A;  1N6Q B;  5FJ4 A;  1YK9 A;  3WIV A;  2W8K A;  2IAJ A;  1UCN A;  2XHW A;  3VAK A;  4ZVQ B;  4GVB A;  4AD6 A;  3V81 B;  2XO7 A;  3LP0 A;  1EJ7 L;  3CWJ A;  4RW6 A;  2H5J B;  1K9M T;  5KG0 A;  4DSJ A;  2OH2 A;  4UUW A;  2K1O A;  3RB0 A;  3HVR A;  3K17 A;  3OT9 A;  3MD3 A;  4LF5 F;  1UJ4 A;  1NU4 A;  4F67 A;  3M9N B;  2VOD A;  4I2P A;  5F8H A;  1SUQ A;  1XNR J;  2NSC A;  1PBA A;  1IRQ A;  5F8M A;  1XNR F;  4DDF A;  3OBI A;  2YNG B;  1P1L A;  1FKO A;  4O3S A;  5HRO B;  1S6U A;  4LSN B;  2XSJ A;  4G1Q B;  5A0Y A;  1S1V A;  2GCF A;  3BDE A;  2OO4 A;  4HH0 A;  2J0Q D;  1Y3J A;  5CZX A;  2FY8 A;  2E66 A;  2W2M P;  1WSR A;  3SBM A;  4O4G B;  1HWU A;  3ISN C;  4UF4 A;  4M5G A;  4DL4 A;  1I51 B;  3GG1 A;  2L48 A;  2WVE A;  2ZBQ A;  4QR2 A;  1AZS B;  2YKO A;  3DC2 A;  3HMJ G;  4IQM A;  1QLN A;  3JB9 k;  1URN A;  3LH2 S;  5FD1 A;  2G4B A;  1U1K A;  4LRV A;  2IVY A;  2KJV A;  4DPY A;  3OXG A;  1N56 A;  4P73 A;  3DLH A;  4DV1 J;  2XZD B;  3MCN A;  4CNZ A;  2YNH B;  2MZJ A;  2CYY A;  1JLE A;  2GZO A;  2V2Q A;  3NNE A;  1T9W A;  3TAM A;  4DV1 F;  1UVM A;  3BRE A;  4FKX A;  5MAO A;  2XZW A;  1PCA A;  4URS A;  5K14 B;  5KFZ A;  4JI5 J;  2EBG A;  1KNZ A;  5DRK A;  4K4Z A;  4UOC A;  1VI7 A;  1DAX A;  5KG6 A;  4TVA B;  3G71 S;  3LWL A;  3KJN B;  1A6L A;  3KK2 A;  4IOC Q;  2R7U A;  1CJK B;  5C5J A;  1Y00 A;  1E6Y B;  2AQ4 A;  2Z0G A;  3H25 A;  2ASJ A;  3HVA A;  4BDP A;  2XY6 A;  2YWG A;  3HI9 A;  2HAF A;  4DV7 J;  3VAI A;  3SI8 A;  2DKO B;  3MM5 B;  4DV7 F;  2WW4 A;  1HHT P;  3U1N A;  4DCP B;  3TUJ C;  2C2M B;  4R8U B;  4AQY F;  2IBK A;  3PFO A;  3FCV A;  4A8K A;  1LOU A;  1S1W A;  2P8I A;  1HD1 A;  2JZ5 A;  2ZBR A;  2YQ3 A;  1OWX A;  1NK4 A;  1WTB A;  3BJY A;  3KOA A;  1F6T A;  3R7S B;  4DV4 F;  1F0X A;  4CRJ A;  4DWI A;  3EXY A;  2HVE A;  2IVF B;  5JVG Q;  2FHJ A;  3CIZ A;  4NXM J;  1Y9O A;  1XWL A;  1ZET A;  4U7C A;  4WU2 A;  2HBZ B;  2YWE A;  2B9Y A;  2QE5 A;  4XAK A;  1EP4 A;  4N76 A;  1N88 A;  3MR6 A;  1X4D A;  1JLB A;  1FXR A;  1JLA A;  5KT6 A;  2VPY B;  4MKB A;  2FLL A;  4AFF A;  1V9O A;  3QWU A;  4RW9 B;  3OW2 R;  1NLK L;  4PXD A;  2HGM A;  3UNG C;  1UZH A;  4C4W A;  5HVH A;  2HMI B;  1RT4 A;  3SCJ E;  4X84 A;  5F8I A;  3AA8 A;  3HHD A;  2BAB A;  3WX4 A;  2ZDO A;  1WI8 A;  1SJ3 P;  1MU2 A;  4DQQ A;  3EJM A;  2WOM A;  3MUT P;  3R5J B;  4W92 B;  1T3N A;  1UWB A;  3RYL A;  1IBM J;  4E0D A;  1VRQ C;  5KTQ A;  3SIP B;  3DKD A;  1MWZ A;  5HN0 A;  3PW5 A;  5IZH A;  2NZC A;  3ILO A;  3M8Q B;  1TKT B;  4L6V 3;  1B99 A;  3MEC B;  2HWI A;  1J5O B;  3EWG A;  3D6F B;  3L09 A;  1UA1 A;  1VGY A;  5LXY A;  4NLD A;  3W2V B;  2BKO A;  2HQI A;  2IBO A;  4H4K C;  1UJ5 A;  5HAN A;  3OSP A;  2B56 A;  3KNG A;  3MMC B;  4ED2 A;  3HDS A;  5SZT A;  2JHE A;  1REV A;  3K8W A;  2MDA A;  5HMW A;  3LP2 A;  1H7W A;  2J7U A;  4LRC A;  1XC9 A;  3IA0 A;  3MGJ A;  3NEK A;  3S7R A;  4DU7 A;  4F8R A;  5L38 A;  2HS3 A;  5MLC V;  1U6F A;  4B17 A;  3H4D A;  4RUH A;  5L9X A;  2XMM A;  4TY8 B;  3SMZ A;  4YY3 J;  5J1E A;  2R8K A;  1L3K A;  1FX2 A;  1QM9 A;  5D6G A;  2BJ3 A;  3C16 A;  1TL3 A;  3O1L A;  2OD6 A;  1S99 A;  2B6A A;  1OSD A;  3H5X A;  2XNQ A;  3F0N A;  2HS4 A;  2ZD1 A;  1YTY A;  5D0E A;  3B54 A;  3BN4 A;  3NS6 A;  1RWP B;  4M94 A;  2HNY A;  1SL1 A;  1NJY A;  4LBP A;  2V68 A;  3ENW A;  1X5S A;  2HRY A;  1NDK A;  2IPO B;  3IC1 A;  1ZA1 B;  2IC3 B;  2Y3Y A;  2UUW A;  1VIX A;  4RUB A;  4ATN A;  3M8Y A;  3DMJ B;  4F3M A;  3FCH A;  4DX5 A;  1NZA A;  2H51 B;  2JX2 A;  3RBX A;  2V9K A;  4X4O A;  3V4M A;  1SC1 B;  4OJ1 A;  4LQ3 A;  1LV5 A;  5B08 A;  4BLG A;  3G8S A;  1U8S A;  2WVC A;  2AEF A;  2MGZ A;  2PI4 A;  2UXD F;  4CLY A;  4P2M A;  3KK1 B;  2NS1 B;  3FGV A;  2GVD A; 
#chains in the Genus database with same CATH homology
 3BKT A;  4ME7 E;  1ARR A;  3VEA A;  2BA3 A;  1EA4 A;  2WVB A;  3LGH A;  2BJ7 A;  2K6L A;  3VEB A;  2H1O E;  2K9I A;  2BJ8 A;  2WVE A;  1MNT A;  2JXI A;  3FMT A;  2BJ3 A;  1B28 A;  2FGC A;  2F1F A;  2CAD A;  1MYL A;  2NZC A;  2K1O A;  1BDT A;  1X93 A;  4FXE A;  3OD2 A;  4D8J A;  2HZA A;  3VW4 A;  2BJ1 A;  1NLA A;  2PC6 A;  2RBF A;  3GXQ A;  3PHT A;  2BSQ E;  2JXG A;  2Y3Y A;  3QSI A;  2K29 A;  4HV0 A;  1ARQ A;  3H87 C;  2AY0 A;  1IRQ A;  1P94 A;  1BAZ A;  1U9P A;  1Q5Y A;  1MYK A;  1BDV A;  1Q5V A;  2KEL A;  1B01 A;  1QTG A;  3BKF A;  2BNZ A;  2GPE A;  2CA9 A;  3QOQ A;  3FT7 A;  2WVC A;  2JXH A;  2CPG A;  1PAR A;  2BNW A;  2CAJ A;  2BJ9 A;  2WVD A;  2HZV A;  3BKU A;  2CAX A;  2K5J A;  2WVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...