2BA3A

Nmr structure of nika n-terminal fragment
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
SDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords NikA
publication title NMR Structure of NikA N-teminal Fragment
rcsb
source organism Plasmid r64
total genus 11
structure length 51
sequence length 51
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2ba3A01
2CA9A 2RBFA 2CAJA 4ME7E 1ARQA 2BJ9A 2K6LA 2HZAA 2BSQE 2WVCA 2HZVA 2K9IA 3GXQA 3VEBA 1IRQA 2BA3A 3VEAA 1EA4A 1ARRA 2JXIA 3QOQA 3OD2A 1BDVA 4FXEA 2KELA 2WVEA 1QTGA 2CADA 3H87C 1X93A 2K29A 2WVBA 2JXHA 2CAXA 2H1OE 2WVDA 2BJ3A 1Q5VA 4HV0A 3VW4A 2BNZA 2GPEA 3LGHA 1NLAA 1U9PA 1B01A 1P94A 2BJ8A 1B28A 1MYKA 2BJ7A 2BJ1A 2WVFA 1PARA 1MNTA 3FMTA 2AY0A 2JXGA 2BNWA 3FT7A 2K1OA 1BAZA 2K5JA 4D8JA 2CPGA 1BDTA 1MYLA
chains in the Genus database with same CATH superfamily
4ME7E 1ARQA 2BJ9A 2K6LA 2WVCA 2HZVA 2UUTA 1IRQA 2JXIA 4FXEA 2CADA 2A2BA 2K29A 2WVBA 4HV0A 3NO7A 1B01A 1P94A 1Q16A 2BNWA 2Q2KA 3NAHA 1SIWA 3NNEA 4AAIA 2KKEA 2JBVA 4LQ9A 3VEBA 1SH3A 3BSNA 1ARRA 3QOQA 3OD2A 2KELA 2CAXA 3UPFA 2H1OE 2WVDA 2BJ3A 4MJWA 2H3AA 4LQ3A 2BNZA 2GPEA 1NLAA 2ADLA 1MYKA 3QIDA 2WVFA 1MNTA 2UUWA 3LJPA 3FT7A 2B43A 3UQSA 3G5OA 4D8JA 2CPGA 2RBFA 2HZAA 2BSQE 3VEAA 3NAIA 1BDVA 3UR0A 1QTGA 3H5YA 3H87C 3BSOA 1Q5VA 3VW4A 4NRUA 2BJ8A 2BJ7A 2BJ1A 1SH0A 1BAZA 2K5JA 3IR7A 1MYLA 1OHNA 2CA9A 2CAJA 2K9IA 3GXQA 3H5XA 2AN7A 4O4RA 2BA3A 1EA4A 2WVEA 1X93A 4QPXA 4LRVA 2JXHA 1SH2A 2WK4A 3LGHA 2CKWA 3SFUA 1B28A 1PARA 3FMTA 2AY0A 2JXGA 3SFGA 2K1OA 2KOEA 1OG7A 4NRTA 1BDTA 1U9PA
chains in the Genus database with same CATH topology
2CA9A 2RBFA 2CAJA 4ME7E 1ARQA 2BJ9A 2K6LA 2HZAA 2BSQE 2WVCA 2HZVA 2K9IA 3GXQA 3VEBA 1IRQA 2BA3A 3VEAA 1EA4A 1ARRA 2JXIA 3QOQA 3OD2A 1BDVA 4FXEA 2KELA 2WVEA 1QTGA 2CADA 3H87C 1X93A 2K29A 2WVBA 2JXHA 2CAXA 2H1OE 2WVDA 2BJ3A 1Q5VA 4HV0A 3VW4A 2BNZA 2GPEA 3LGHA 1NLAA 1U9PA 1B01A 1P94A 2BJ8A 1B28A 1MYKA 2BJ7A 2BJ1A 2WVFA 1PARA 1MNTA 3FMTA 2AY0A 2JXGA 2BNWA 3FT7A 2K1OA 1BAZA 2K5JA 4D8JA 2CPGA 1BDTA 1MYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CA9 A;  2RBF A;  2CAJ A;  4ME7 E;  1ARQ A;  2BJ9 A;  2K6L A;  2HZA A;  2BSQ E;  2WVC A;  2HZV A;  2K9I A;  3GXQ A;  3VEB A;  1IRQ A;  2BA3 A;  3VEA A;  1EA4 A;  1ARR A;  2JXI A;  3QOQ A;  3OD2 A;  1BDV A;  4FXE A;  2KEL A;  2WVE A;  1QTG A;  2CAD A;  3H87 C;  1X93 A;  2K29 A;  2WVB A;  2JXH A;  2CAX A;  2H1O E;  2WVD A;  2BJ3 A;  1Q5V A;  4HV0 A;  3VW4 A;  2BNZ A;  2GPE A;  3LGH A;  1NLA A;  1U9P A;  1B01 A;  1P94 A;  2BJ8 A;  1B28 A;  1MYK A;  2BJ7 A;  2BJ1 A;  2WVF A;  1PAR A;  1MNT A;  3FMT A;  2AY0 A;  2JXG A;  2BNW A;  3FT7 A;  2K1O A;  1BAZ A;  2K5J A;  4D8J A;  2CPG A;  1BDT A;  1MYL A; 
#chains in the Genus database with same CATH topology
 4ME7 E;  1ARQ A;  2BJ9 A;  2K6L A;  2WVC A;  2HZV A;  2UUT A;  1IRQ A;  2JXI A;  4FXE A;  2CAD A;  2A2B A;  2K29 A;  2WVB A;  4HV0 A;  3NO7 A;  1B01 A;  1P94 A;  1Q16 A;  2BNW A;  2Q2K A;  3NAH A;  1SIW A;  3NNE A;  4AAI A;  2KKE A;  2JBV A;  4LQ9 A;  3VEB A;  1SH3 A;  3BSN A;  1ARR A;  3QOQ A;  3OD2 A;  2KEL A;  2CAX A;  3UPF A;  2H1O E;  2WVD A;  2BJ3 A;  4MJW A;  2H3A A;  4LQ3 A;  2BNZ A;  2GPE A;  1NLA A;  2ADL A;  1MYK A;  3QID A;  2WVF A;  1MNT A;  2UUW A;  3LJP A;  3FT7 A;  2B43 A;  3UQS A;  3G5O A;  4D8J A;  2CPG A;  2RBF A;  2HZA A;  2BSQ E;  3VEA A;  3NAI A;  1BDV A;  3UR0 A;  1QTG A;  3H5Y A;  3H87 C;  3BSO A;  1Q5V A;  3VW4 A;  4NRU A;  2BJ8 A;  2BJ7 A;  2BJ1 A;  1SH0 A;  1BAZ A;  2K5J A;  3IR7 A;  1MYL A;  1OHN A;  2CA9 A;  2CAJ A;  2K9I A;  3GXQ A;  3H5X A;  2AN7 A;  4O4R A;  2BA3 A;  1EA4 A;  2WVE A;  1X93 A;  4QPX A;  4LRV A;  2JXH A;  1SH2 A;  2WK4 A;  3LGH A;  2CKW A;  3SFU A;  1B28 A;  1PAR A;  3FMT A;  2AY0 A;  2JXG A;  3SFG A;  2K1O A;  2KOE A;  1OG7 A;  4NRT A;  1BDT A;  1U9P A; 
#chains in the Genus database with same CATH homology
 2CA9 A;  2RBF A;  2CAJ A;  4ME7 E;  1ARQ A;  2BJ9 A;  2K6L A;  2HZA A;  2BSQ E;  2WVC A;  2HZV A;  2K9I A;  3GXQ A;  3VEB A;  1IRQ A;  2BA3 A;  3VEA A;  1EA4 A;  1ARR A;  2JXI A;  3QOQ A;  3OD2 A;  1BDV A;  4FXE A;  2KEL A;  2WVE A;  1QTG A;  2CAD A;  3H87 C;  1X93 A;  2K29 A;  2WVB A;  2JXH A;  2CAX A;  2H1O E;  2WVD A;  2BJ3 A;  1Q5V A;  4HV0 A;  3VW4 A;  2BNZ A;  2GPE A;  3LGH A;  1NLA A;  1U9P A;  1B01 A;  1P94 A;  2BJ8 A;  1B28 A;  1MYK A;  2BJ7 A;  2BJ1 A;  2WVF A;  1PAR A;  1MNT A;  3FMT A;  2AY0 A;  2JXG A;  2BNW A;  3FT7 A;  2K1O A;  1BAZ A;  2K5J A;  4D8J A;  2CPG A;  1BDT A;  1MYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...