2BNZA

Structural basis for cooperative binding of ribbon-helix-helix omega repressor to inverted dna heptad repeats
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
50
structure length
50
Chain Sequence
KDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Omega Repressors Bound to Direct and Inverted DNA Repeats Explain Modulation of Transcription.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Dna binding protein/dna
molecule keywords ORF OMEGA
total genus 15
structure length 50
sequence length 50
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bnzA00
2BA3A 1BDVA 1BDTA 2WVBA 1B28A 2JXGA 2JXHA 1QTGA 2KELA 1BAZA 2BJ7A 2WVFA 1Q5VA 3OD2A 1ARQA 2AY0A 2RBFA 2CAXA 1ARRA 3H87C 2CADA 2K6LA 2BJ8A 2K9IA 1PARA 4D8JA 1P94A 1NLAA 2H1OE 2WVDA 2HZVA 2WVCA 1EA4A 3FMTA 1U9PA 2BJ3A 2K1OA 1X93A 3LGHA 1B01A 2BSQE 3VW4A 3VEBA 1IRQA 2CA9A 2CPGA 2BNZA 2JXIA 1MYLA 3QOQA 2BJ1A 2K5JA 2BJ9A 3FT7A 2K29A 4ME7E 2HZAA 1MYKA 3GXQA 2BNWA 2CAJA 2GPEA 1MNTA 3VEAA 4FXEA 4HV0A 2WVEA
chains in the Genus database with same CATH superfamily
3H5YA 3QIDA 1BAZA 2BJ7A 3UQSA 3NO7A 2CADA 1PARA 2WVDA 1U9PA 1X93A 3H5XA 2UUTA 2CA9A 4QPXA 2JXIA 3SFUA 3BSOA 2K5JA 2BJ9A 4ME7E 4O4RA 3NAHA 1SH3A 3NAIA 3GXQA 2BNWA 2WVEA 1OG7A 3UR0A 4LQ3A 2A2BA 2JXHA 1QTGA 1ARQA 3OD2A 4NRUA 4AAIA 3G5OA 2RBFA 2KOEA 2CAXA 1SH2A 4D8JA 1NLAA 2H1OE 2HZVA 2WVCA 3FMTA 2BJ3A 3LGHA 2BNZA 2WK4A 4MJWA 2BJ1A 1SIWA 2JBVA 2B43A 2K29A 2H3AA 2CAJA 2GPEA 1MNTA 2ADLA 4FXEA 1BDTA 2WVBA 2AY0A 1ARRA 1SH0A 3H87C 2K6LA 2BJ8A 2CKWA 1EA4A 3LJPA 3IR7A 3UPFA 2BSQE 3VW4A 3VEBA 1IRQA 1MYLA 3QOQA 3FT7A 3BSNA 1MYKA 3VEAA 2AN7A 2BA3A 1BDVA 1OHNA 1B28A 2JXGA 2KELA 2WVFA 1Q5VA 3SFGA 2UUWA 4LQ9A 2K9IA 2KKEA 1P94A 2K1OA 3NNEA 1B01A 4NRTA 2CPGA 2Q2KA 1Q16A 2HZAA 4LRVA 4HV0A
chains in the Genus database with same CATH topology
2BA3A 1BDVA 1BDTA 2WVBA 1B28A 2JXGA 2JXHA 1QTGA 2KELA 1BAZA 2BJ7A 2WVFA 1Q5VA 3OD2A 1ARQA 2AY0A 2RBFA 2CAXA 1ARRA 3H87C 2CADA 2K6LA 2BJ8A 2K9IA 1PARA 4D8JA 1P94A 1NLAA 2H1OE 2WVDA 2HZVA 2WVCA 1EA4A 3FMTA 1U9PA 2BJ3A 2K1OA 1X93A 3LGHA 1B01A 2BSQE 3VW4A 3VEBA 1IRQA 2CA9A 2CPGA 2BNZA 2JXIA 1MYLA 3QOQA 2BJ1A 2K5JA 2BJ9A 3FT7A 2K29A 4ME7E 2HZAA 1MYKA 3GXQA 2BNWA 2CAJA 2GPEA 1MNTA 3VEAA 4FXEA 4HV0A 2WVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA3 A;  1BDV A;  1BDT A;  2WVB A;  1B28 A;  2JXG A;  2JXH A;  1QTG A;  2KEL A;  1BAZ A;  2BJ7 A;  2WVF A;  1Q5V A;  3OD2 A;  1ARQ A;  2AY0 A;  2RBF A;  2CAX A;  1ARR A;  3H87 C;  2CAD A;  2K6L A;  2BJ8 A;  2K9I A;  1PAR A;  4D8J A;  1P94 A;  1NLA A;  2H1O E;  2WVD A;  2HZV A;  2WVC A;  1EA4 A;  3FMT A;  1U9P A;  2BJ3 A;  2K1O A;  1X93 A;  3LGH A;  1B01 A;  2BSQ E;  3VW4 A;  3VEB A;  1IRQ A;  2CA9 A;  2CPG A;  2BNZ A;  2JXI A;  1MYL A;  3QOQ A;  2BJ1 A;  2K5J A;  2BJ9 A;  3FT7 A;  2K29 A;  4ME7 E;  2HZA A;  1MYK A;  3GXQ A;  2BNW A;  2CAJ A;  2GPE A;  1MNT A;  3VEA A;  4FXE A;  4HV0 A;  2WVE A; 
#chains in the Genus database with same CATH topology
 3H5Y A;  3QID A;  1BAZ A;  2BJ7 A;  3UQS A;  3NO7 A;  2CAD A;  1PAR A;  2WVD A;  1U9P A;  1X93 A;  3H5X A;  2UUT A;  2CA9 A;  4QPX A;  2JXI A;  3SFU A;  3BSO A;  2K5J A;  2BJ9 A;  4ME7 E;  4O4R A;  3NAH A;  1SH3 A;  3NAI A;  3GXQ A;  2BNW A;  2WVE A;  1OG7 A;  3UR0 A;  4LQ3 A;  2A2B A;  2JXH A;  1QTG A;  1ARQ A;  3OD2 A;  4NRU A;  4AAI A;  3G5O A;  2RBF A;  2KOE A;  2CAX A;  1SH2 A;  4D8J A;  1NLA A;  2H1O E;  2HZV A;  2WVC A;  3FMT A;  2BJ3 A;  3LGH A;  2BNZ A;  2WK4 A;  4MJW A;  2BJ1 A;  1SIW A;  2JBV A;  2B43 A;  2K29 A;  2H3A A;  2CAJ A;  2GPE A;  1MNT A;  2ADL A;  4FXE A;  1BDT A;  2WVB A;  2AY0 A;  1ARR A;  1SH0 A;  3H87 C;  2K6L A;  2BJ8 A;  2CKW A;  1EA4 A;  3LJP A;  3IR7 A;  3UPF A;  2BSQ E;  3VW4 A;  3VEB A;  1IRQ A;  1MYL A;  3QOQ A;  3FT7 A;  3BSN A;  1MYK A;  3VEA A;  2AN7 A;  2BA3 A;  1BDV A;  1OHN A;  1B28 A;  2JXG A;  2KEL A;  2WVF A;  1Q5V A;  3SFG A;  2UUW A;  4LQ9 A;  2K9I A;  2KKE A;  1P94 A;  2K1O A;  3NNE A;  1B01 A;  4NRT A;  2CPG A;  2Q2K A;  1Q16 A;  2HZA A;  4LRV A;  4HV0 A; 
#chains in the Genus database with same CATH homology
 2BA3 A;  1BDV A;  1BDT A;  2WVB A;  1B28 A;  2JXG A;  2JXH A;  1QTG A;  2KEL A;  1BAZ A;  2BJ7 A;  2WVF A;  1Q5V A;  3OD2 A;  1ARQ A;  2AY0 A;  2RBF A;  2CAX A;  1ARR A;  3H87 C;  2CAD A;  2K6L A;  2BJ8 A;  2K9I A;  1PAR A;  4D8J A;  1P94 A;  1NLA A;  2H1O E;  2WVD A;  2HZV A;  2WVC A;  1EA4 A;  3FMT A;  1U9P A;  2BJ3 A;  2K1O A;  1X93 A;  3LGH A;  1B01 A;  2BSQ E;  3VW4 A;  3VEB A;  1IRQ A;  2CA9 A;  2CPG A;  2BNZ A;  2JXI A;  1MYL A;  3QOQ A;  2BJ1 A;  2K5J A;  2BJ9 A;  3FT7 A;  2K29 A;  4ME7 E;  2HZA A;  1MYK A;  3GXQ A;  2BNW A;  2CAJ A;  2GPE A;  1MNT A;  3VEA A;  4FXE A;  4HV0 A;  2WVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...