2JXGA

Solution structure of the dna binding domain of proline utilization a (puta)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
45
structure length
45
Chain Sequence
MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Pseudomonas putida protein PpPutA45 and its DNA complex
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords Proline dehydrogenase
total genus 12
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2jxgA01
1ARRA 2WVBA 2BSQE 2HZVA 1Q5VA 2AY0A 4HV0A 2BA3A 1MYKA 2BJ8A 1BDTA 2CPGA 3FT7A 1BAZA 2WVCA 3QOQA 1U9PA 2BJ7A 2K29A 2CAXA 2WVEA 4ME7E 1PARA 2CAJA 2BNZA 1NLAA 2K1OA 2BJ1A 4FXEA 2K5JA 2BNWA 3VEBA 1P94A 2K9IA 2CA9A 2WVFA 3VW4A 1X93A 3LGHA 3H87C 1IRQA 2JXGA 1MYLA 2CADA 1B01A 1BDVA 2KELA 3OD2A 1QTGA 2JXHA 2GPEA 2RBFA 2HZAA 1MNTA 4D8JA 1EA4A 2BJ3A 2WVDA 3VEAA 2JXIA 1ARQA 3GXQA 2BJ9A 3FMTA 2K6LA 2H1OE 1B28A
chains in the Genus database with same CATH superfamily
1SH3A 3NO7A 2WVCA 3QOQA 2CAJA 2KKEA 1P94A 4LRVA 1OG7A 4QPXA 4NRTA 1MYLA 1BDVA 2KELA 3OD2A 1MNTA 3H5YA 4D8JA 3SFGA 2WVDA 1EA4A 1ARQA 2BJ9A 3UQSA 2AY0A 4LQ3A 2BA3A 4O4RA 3IR7A 3SFUA 2BJ7A 4MJWA 2A2BA 4ME7E 2Q2KA 1PARA 3UPFA 2K5JA 2BNWA 3VW4A 2CA9A 1X93A 3H87C 2CADA 2CKWA 3NAIA 1B01A 3G5OA 4LQ9A 2JXHA 2HZAA 3VEAA 2K6LA 3NNEA 4NRUA 2WVBA 1SIWA 2HZVA 1Q5VA 4HV0A 1BDTA 1SH2A 2BJ8A 2AN7A 3FT7A 1BAZA 3UR0A 2KOEA 2CAXA 2K29A 2WK4A 3BSNA 2BNZA 3H5XA 2UUTA 3VEBA 2K9IA 1IRQA 2UUWA 1QTGA 4AAIA 2JBVA 2GPEA 2BJ3A 3FMTA 1B28A 1ARRA 2BSQE 3BSOA 1MYKA 2ADLA 1SH0A 2CPGA 1U9PA 2WVEA 2H3AA 1NLAA 3QIDA 2K1OA 2BJ1A 4FXEA 1Q16A 2WVFA 3LGHA 2B43A 2JXGA 3NAHA 2RBFA 1OHNA 2JXIA 3GXQA 3LJPA 2H1OE
chains in the Genus database with same CATH topology
1ARRA 2WVBA 2BSQE 2HZVA 1Q5VA 2AY0A 4HV0A 2BA3A 1MYKA 2BJ8A 1BDTA 2CPGA 3FT7A 1BAZA 2WVCA 3QOQA 1U9PA 2BJ7A 2K29A 2CAXA 2WVEA 4ME7E 1PARA 2CAJA 2BNZA 1NLAA 2K1OA 2BJ1A 4FXEA 2K5JA 2BNWA 3VEBA 1P94A 2K9IA 2CA9A 2WVFA 3VW4A 1X93A 3LGHA 3H87C 1IRQA 2JXGA 1MYLA 2CADA 1B01A 1BDVA 2KELA 3OD2A 1QTGA 2JXHA 2GPEA 2RBFA 2HZAA 1MNTA 4D8JA 1EA4A 2BJ3A 2WVDA 3VEAA 2JXIA 1ARQA 3GXQA 2BJ9A 3FMTA 2K6LA 2H1OE 1B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARR A;  2WVB A;  2BSQ E;  2HZV A;  1Q5V A;  2AY0 A;  4HV0 A;  2BA3 A;  1MYK A;  2BJ8 A;  1BDT A;  2CPG A;  3FT7 A;  1BAZ A;  2WVC A;  3QOQ A;  1U9P A;  2BJ7 A;  2K29 A;  2CAX A;  2WVE A;  4ME7 E;  1PAR A;  2CAJ A;  2BNZ A;  1NLA A;  2K1O A;  2BJ1 A;  4FXE A;  2K5J A;  2BNW A;  3VEB A;  1P94 A;  2K9I A;  2CA9 A;  2WVF A;  3VW4 A;  1X93 A;  3LGH A;  3H87 C;  1IRQ A;  2JXG A;  1MYL A;  2CAD A;  1B01 A;  1BDV A;  2KEL A;  3OD2 A;  1QTG A;  2JXH A;  2GPE A;  2RBF A;  2HZA A;  1MNT A;  4D8J A;  1EA4 A;  2BJ3 A;  2WVD A;  3VEA A;  2JXI A;  1ARQ A;  3GXQ A;  2BJ9 A;  3FMT A;  2K6L A;  2H1O E;  1B28 A; 
#chains in the Genus database with same CATH topology
 1SH3 A;  3NO7 A;  2WVC A;  3QOQ A;  2CAJ A;  2KKE A;  1P94 A;  4LRV A;  1OG7 A;  4QPX A;  4NRT A;  1MYL A;  1BDV A;  2KEL A;  3OD2 A;  1MNT A;  3H5Y A;  4D8J A;  3SFG A;  2WVD A;  1EA4 A;  1ARQ A;  2BJ9 A;  3UQS A;  2AY0 A;  4LQ3 A;  2BA3 A;  4O4R A;  3IR7 A;  3SFU A;  2BJ7 A;  4MJW A;  2A2B A;  4ME7 E;  2Q2K A;  1PAR A;  3UPF A;  2K5J A;  2BNW A;  3VW4 A;  2CA9 A;  1X93 A;  3H87 C;  2CAD A;  2CKW A;  3NAI A;  1B01 A;  3G5O A;  4LQ9 A;  2JXH A;  2HZA A;  3VEA A;  2K6L A;  3NNE A;  4NRU A;  2WVB A;  1SIW A;  2HZV A;  1Q5V A;  4HV0 A;  1BDT A;  1SH2 A;  2BJ8 A;  2AN7 A;  3FT7 A;  1BAZ A;  3UR0 A;  2KOE A;  2CAX A;  2K29 A;  2WK4 A;  3BSN A;  2BNZ A;  3H5X A;  2UUT A;  3VEB A;  2K9I A;  1IRQ A;  2UUW A;  1QTG A;  4AAI A;  2JBV A;  2GPE A;  2BJ3 A;  3FMT A;  1B28 A;  1ARR A;  2BSQ E;  3BSO A;  1MYK A;  2ADL A;  1SH0 A;  2CPG A;  1U9P A;  2WVE A;  2H3A A;  1NLA A;  3QID A;  2K1O A;  2BJ1 A;  4FXE A;  1Q16 A;  2WVF A;  3LGH A;  2B43 A;  2JXG A;  3NAH A;  2RBF A;  1OHN A;  2JXI A;  3GXQ A;  3LJP A;  2H1O E; 
#chains in the Genus database with same CATH homology
 1ARR A;  2WVB A;  2BSQ E;  2HZV A;  1Q5V A;  2AY0 A;  4HV0 A;  2BA3 A;  1MYK A;  2BJ8 A;  1BDT A;  2CPG A;  3FT7 A;  1BAZ A;  2WVC A;  3QOQ A;  1U9P A;  2BJ7 A;  2K29 A;  2CAX A;  2WVE A;  4ME7 E;  1PAR A;  2CAJ A;  2BNZ A;  1NLA A;  2K1O A;  2BJ1 A;  4FXE A;  2K5J A;  2BNW A;  3VEB A;  1P94 A;  2K9I A;  2CA9 A;  2WVF A;  3VW4 A;  1X93 A;  3LGH A;  3H87 C;  1IRQ A;  2JXG A;  1MYL A;  2CAD A;  1B01 A;  1BDV A;  2KEL A;  3OD2 A;  1QTG A;  2JXH A;  2GPE A;  2RBF A;  2HZA A;  1MNT A;  4D8J A;  1EA4 A;  2BJ3 A;  2WVD A;  3VEA A;  2JXI A;  1ARQ A;  3GXQ A;  2BJ9 A;  3FMT A;  2K6L A;  2H1O E;  1B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...