2BJ8A

Nikr in closed conformation and nickel bound to high and low-affinity sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEIISSLHVHMDEHNCLEVIVVKGEAKKIKMIADKLLSLKGVKHGKLVMTSTGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NICKEL RESPONSIVE REGULATOR
publication title Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 37
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bj8A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2bj8A02
2Y3YA 2WVEA 3LGHA 3H87C 1U9PA 1NLAA 2BJ3A 1P94A 2K1OA 3FT7A 1BAZA 3GXQA 2PC6A 1BDVA 3FMTA 1B28A 3BKTA 2CA9A 4D8JA 2CAXA 2BNZA 3VEBA 1Q5VA 2AY0A 2BA3A 2BJ1A 4ME7E 1QTGA 3QSIA 2FGCA 2WVCA 2HZAA 2CPGA 3QOQA 1PARA 2WVDA 1MYKA 2GPEA 2JXHA 2JXGA 1IRQA 1ARQA 1MYLA 1X93A 2BNWA 2CADA 3BKUA 2H1OE 1Q5YA 2CAJA 2WVFA 4HV0A 1EA4A 1ARRA 2JXIA 3VEAA 2KELA 2WVBA 1MNTA 2RBFA 2HZVA 2NZCA 3OD2A 2BJ8A 2F1FA 1B01A 2BSQE 3VW4A 1BDTA 4FXEA 2K9IA 2K29A 3BKFA 2BJ9A 2BJ7A 3PHTA 2K5JA 2K6LA
chains in the Genus database with same CATH superfamily
4PYAA 1JJ4A 2FJVA 5A2QU 1Q8IA 3AJ2A 1VR6A 5B0CA 3MEGA 3V6HA 2QL7B 1HQ2A 2MSTA 3LP0A 2KKHA 3RUBL 1HPZB 2Y1IA 1FDDA 1QVGR 1IUJA 1RT7B 1NK9A 1TP7A 2O1PA 2H5IB 1GTHA 2XGPA 1U45A 2VBXA 1TMJA 3UDVA 1N33J 1RISA 3NWGA 2IYGA 5FLXY 2CQBA 2AP6A 3TX0A 1S76D 1G2EA 1RYRA 2Z56B 2W2PP 5KFUA 2KXHA 5I42A 3C14B 3LQVA 2CQ0A 3OUYA 2VF3A 3EZ5A 2MKYA 1IBKF 4ZPVR 3DLEA 4K4TA 1Y5LB 2DGSA 4JV5F 4PUOB 1HI1A 4IG0B 3JYTB 1Q7LB 1ICEB 4KH1B 1D0EA 1NJXA 1HNVB 1VK3A 4B3SF 1YJ7A 2O5DA 4QR1A 2V8HA 2P6SA 1Q53A 2P8IA 3NNHA 4YB6A 3DRRA 4M94A 4I1TA 2KRRA 2DGUA 2FTRA 1CG2A 2WHOA 2XS2A 3CDEA 1RWUA 1WC1A 1T02A 3RB3A 3D54A 3GFYA 1BY9A 2IVYA 2C42A 4P73A 2VODA 1FRXA 4J9KA 3QATA 2WAQD 1NJZA 2VG5B 4NASA 2XZTB 2MYFA 3GCXP 1TUVA 3R5GA 4Q8EA 1WOSA 3NEKA 3W5XA 3TQEA 4FZVA 3HSDA 2XB2D 4A4JA 1SL2A 3B4MA 4PYDA 1ZM2A 2AW0A 2CAJA 1JXVA 4L3NA 2GHWA 2ZNYA 1RA7A 2VB6A 3MAAA 1VQ5S 1FJGJ 1U8SA 2RRBA 4G1IA 2W9BB 2UXDF 2HZVA 5HSPA 1P27B 1HMVA 2QLJB 3JB9k 4TXSA 1A0OB 1VJWA 1N8RT 1FXLA 3VAJA 3R5AA 3NNEA 1REVB 4ZPCA 2E9TA 1U6BA 4OJHA 2GJFA 4I64A 2OFGX 3TYTA 2K6LA 3H2UB 2AJ4A 4IFVB 1OSCA 4LR7A 3M2RA 2KKEA 2E1PA 2DB1A 1X9MA 1GMUA 4LF7J 4ECTA 5H9EK 5ETOA 1S6UA 4G1QA 1SQGA 1U4BA 4X4RA 4F36A 3DDNA 3HT0A 2OD6A 3MUMP 1S7HA 3MGJA 4PXDA 4QYZJ 2OUGA 4DOZA 4URQU 3HF5A 3W3SA 2ZWPA 3FEZA 3SZ2A 5AXKA 4U9RA 1UAWA 2CJ9A 2QGFB 2M9KA 2KM8B 3CO0P 2ZZTA 3MCMA 2FC8A 1N32F 3CCTA 3M6WA 1RBAA 3FSXA 1TUWA 2C3YA 3IR5B 3OL8A 4PRFA 2HIQA 1FHTA 1NU4A 1RKJA 2H3EB 2QV6A 2R8IA 2BUNA 1HQUA 3TJAA 4DF4A 5DM7Q 4KGXB 4B9SA 4A48A 2XSJA 3V6DA 3RBEA 1S5ZA 1R0AA 1ELOA 3CCJS 1VQLS 3FCHA 1J27A 2WCXA 3R7NB 3KXDA 3GR0A 1XEZA 4MAKA 3H98A 1CBKA 1N5SA 2Z2MA 4X84A 2H9ZA 2ZBCA 2RIJA 2CPFA 4JP8A 1IKVA 3BGRB 1FK9B 4JI8J 5IM0A 4I6YA 2MLXA 3S7RA 2Q79A 2HNYA 3MEEB 4LSNA 1YRTA 2GVDB 5HMXA 2MKJA 1MN9A 5C42A 1T9UA 3T41A 2IBOA 1R0CB 4LSZB 2DK2A 2ASLA 3TVZA 4OHZA 2UUAJ 4F0KA 1LWCA 3I32A 2GQ2A 2HHHF 1KHWA 1MYLA 4J9QA 1U1RA 2MQQA 3DLKB 1Q79A 4ZHRA 1KD1T 5E3QA 3CIZA 3SFUA 2BE9B 3HVTA 2OO4A 2A2DA 3G87A 5KTQA 8RUCA 1F0XA 4OX9J 3OHAA 4DV6J 4DDFA 4PCQA 2ZOFA 1T3OA 2G4BA 1SV5A 3EGVA 3UVJB 2UVUA 4IRDA 1VBKA 4MKVA 4DL6A 4QU6A 3NRBA 1UWAA 4QWDA 1U0SA 2H51B 1RTHA 4ZOSA 2OKQA 2K1OA 1TTHB 2JEGA 1PAEX 1XR7A 2UV8A 2EK1A 2PGCA 1SKWA 4WFXA 5HJYA 1R8AA 2R7VA 3I5AA 4CI0B 3PM9A 1DRZA 2AV5A 5DDPC 4QJVA 3PYFA 4UOFA 5CD4A 3RGIA 2HLUA 1NK4A 3OXGA 4F2RA 2WOMA 1N52B 4ZVFA 1QY7A 4AUKA 1GAOA 5K8OA 3GPAA 3X3UA 5ETNA 2MQPA 2NSCA 3C6TA 5KFZA 2W1BA 3KG1A 1RHRB 4ALZA 3F0NA 2KJWA 2GQQA 1K44A 1X31C 1XMQF 1UW9A 3E8OA 3EVOA 1LW2A 2BQRA 3EDRB 5DZ7A 3AHPA 3QGPA 4LMZA 4DU7A 4HACB 4HTIA 1F5AA 3G96A 2DNNA 2Y8YA 3Q8SB 1FRJA 4WWSA 4C8OA 3NGKA 2BX6A 4FF4A 1U0HA 5D8HB 1KLNA 1WTFA 3IG1B 2CZ4A 4HDHA 2YX7A 4E8UA 4Y2IA 2C3PA 3NGSA 4UOCA 5HLFA 1DFDA 3TZWA 2BNZA 1NDPA 4FNHA 5ADZA 4F67A 3PRBA 1YDLA 4ZDNA 4ZJLA 4WYWA 2M0GB 4L76A 1AXQA 2YNHB 3KLVA 4J9VA 2Z4PA 5B0FA 2B7BB 2JXGA 2D3ZA 4DV7F 4A8QA 5K8NA 1QUVA 2B8PA 4RW9A 1YQHA 4ZLLA 3BPDA 5DQHA 1KLMB 1TFWA 4Q43A 4ICLA 3KFWX 4DUZJ 3K5OA 2YQ1A 4IRKA 4KR0B 2E29A 4F4ZA 2JL9A 3IWLA 3CO9A 2AJ1A 2VH7A 4Z37A 3M8QB 3ADAC 4ZJQA 3ZZUA 2VG6B 2K29A 4FN5A 1DTQA 4CO3A 4YS2A 4ILLA 4IRCA 1SIWA 4U67Q 3M2UB 5A8RA 2Z57B 5IQQA 1NPKA 2B9WA 1Y4ZB 3ONQA 3NAIA 3KDOA 3D7SB 2CA9A 2LCWA 4KYZA 3TJ9A 4Z2XA 2HHUA 4U7UK 1RB0A 2HK3A 2MQ8A 1TKZA 2RHSB 1BQNB 3P5TL 2ZKUA 1LXNA 2OHDA 2DH8A 2WVCA 9ATCB 4AE5A 2C2NA 1SUQA 2FZGB 4CLLA 5HBMB 4OHXA 1TKXA 1FO1A 4M5GA 2G2OA 5EWGA 5DLGA 1HL6A 1LQ9A 2WVFA 3VR1A 2GIFA 1X4DA 2BE2B 3OHBA 3VGVA 4M95A 2F1FA 4E98A 4O44B 4ETZA 4NLRA 3PY8A 1REGX 2EFQA 5J2NB 1YJ9S 3SV4A 5KFDA 3SV3A 4YQWA 2ZZNA 1IJEB 4PKDB 4OZ2A 4PG6A 2Q6CA 2FIUA 1L3SA 3KK2B 2R7RA 3M30B 3GYGA 1PJ7A 3R6GB 3RAQA 4Y2MA 5FDLB 2J5AA 1V5VA 4R0EA 5U47A 4BLGA 4UF4A 4R0JA 3FEYB 5LJ3Y 3L3CA 1PIEA 3IR7A 2XWYA 1VIOA 3CT9A 1U1QA 4I2QB 2B6AA 5F0UA 1OIAA 4MIWA 3DGPB 1P9YA 1PYSB 1VC6A 3SDEB 1GXLA 2V2VA 2V2KA 2MZRA 3K8VA 4X62F 4P75A 2X3GA 5KT5A 4AD6A 5HK4A 7FD1A 4C8NA 4P7TA 1I6JA 2LFVA 4LSLB 3I87A 3VWSA 3H42A 5AE1A 2VFUA 2R7SA 1WUUA 2I5JA 2K5JA 2V50A 1L3UA 2BJ3A 2VBYA 1S1UA 2E9RX 3G6ES 2VJUA 3TA1A 5GAGI 3CC4S 1RWWB 2LYVA 2XI3A 3Q24A 1JQGA 2RJZA 3VEBA 3BREA 2R2UA 2Z30B 3S1TA 5I3QA 2FJAB 2BANB 4M5DB 2P6TA 2FY1A 3QLHB 2ZE2A 4NI2B 3UDEA 4Q5VA 5F8LA 3CJ0A 4G3IA 4ZVGA 1YIJS 3U1MA 4ZVEA 2PO4A 3KWMA 4KIAA 1IRQA 2CJBA 1JXEA 1LW0A 1QM9A 1MN7A 4MJWA 2B4UA 3A3OB 3PX6A 3V6JA 1C1CB 2NXJA 3I6PA 5KFWA 4U7UD 5JVHQ 2RKIA 2DIVA 4IOCQ 3C6UA 4LF8J 2BM0A 3MMBB 2PEHA 5E33A 1H73A 1RAGB 2XM3A 3ZZOA 3ZZPA 3BYRA 1N48A 5GMEA 4OZLA 1Q86T 5D15A 1OYDA 4QYZK 3HDSA 1PBUA 1U48A 1BDVA 5AE2A 2VU5A 3D2WA 4ECYA 4EO6A 1F5BA 2W7PA 4V1Ak 4LRAA 3IR6B 4DN0A 3BQ0A 3GLJA 3I4PA 4JB8B 2R7UA 1LWXA 5JJBA 2IDEA 3CCLS 3OR1B 2ZVIA 4TKTA 4WK3A 1VBXA 3D4JA 3CGIA 5LT5A 2MLZA 1IQTA 4ID5B 1XWLA 4HEA9 3T1YJ 1RHKB 2DNZA 3C46A 2HHVA 3JAMU 2WBRA 2R7XA 2D9PA 3MM7B 3POTA 1FKOB 1ZAXA 2H4YB 5BR8J 1SBRA 1F3FA 3QAUA 4PQUB 3J7ZT 2EFNA 1CJUB 1WC3A 3JS9A 5LXYA 3VAFA 3MR6A 2J0WA 3T6BA 1VBYA 1S1VA 2L9DA 3PR4A 4NWBA 5ETLA 4K2JA 3HJVA 2OFHX 2YWWA 3Q22A 4NRUA 2RMLA 5KFOA 4EK2A 2YNFA 3GG0A 1NUEA 2ASDA 5DQGA 1I51B 4Y3CA 4ED7A 4DV0J 2DXEA 5KT3A 3OSNA 3ETMA 1X9WA 5IOLA 1PJ6A 2DNRA 1RQ0A 4JV1A 4DUYF 1IWGA 4QZVB 3H4BA 3UR3C 3ILOA 4OYXA 1KQFB 2RF2B 4F25A 2PD1A 3NNCA 2RRNA 1HNXF 3MR5A 4NLSA 4DPTA 1SCJB 3OFFA 3K58A 4WIIA 2IC3A 5B0DA 4EYIB 3O2IA 2HNDB 2YPYA 5AJ3J 2VPYB 2Y1JA 4LF1A 2ROGA 4BC9A 1R8BA 1D09B 1T9YA 1LV5A 1VRTA 1KNZA 3DRXA 5JXSA 4CYUB 5A6WA 3IWNC 3M8RA 4FF2A 3CD0A 4OZJA 2A6MA 3D0HE 3QGHA 1AZSB 3AOAA 4KKOA 2DO0A 3SI8A 3A8KA 2JX2A 4Q45A 1T03B 4P7VA 4NXNF 4H4OA 3BSNA 3HHNB 2KT5A 1RTIA 4NLPA 2LDYA 3Q2TC 1FXDA 4ZVTB 4ERDA 2DNPA 4IR1A 1HYSB 1IN0A 2HBRB 1MMDA 2P9EA 1X9SA 1DJ0A 1XQIA 2HBQB 4UY85 2GV1A 4OZ5A 2JXHA 1KDNA 1F60B 1DTTA 1GK8A 2DHGA 1VRQC 2GO8A 2RQCA 2UVWA 2FJWA 3MEGB 1RAHB 3G82A 1ARRA 4OFZA 1N36J 4QR0A 4NZ6A 3LP0B 1WKKA 4EU0A 1LK7A 3OVBA 1ZBTA 2W01A 5L46A 4I7FB 2WK4A 1HWLA 4DR6J 1HR0F 1JJHA 2BE7D 3MPDA 3UD4P 2XZWA 4K4UA 1KOHA 1D8YA 1PKUA 5I42B 2ABYA 3NG8A 4DSEA 3CD5A 2FJDB 3OUYB 2UUBJ 4KTQA 3DLEB 4QQBA 2B9EA 1H6KX 2JDJA 4PG8A 2DEIA 1UL3A 4ILMA 3IGVA 1F1BB 3O44A 2K3KA 1RUSA 1LWFA 3LPEA 4B9UA 1MMLA 4LRFA 3DCAA 3D1QA 5EWFA 2ZM6J 1FFGB 5IT9U 4MYTA 1TL7A 3TA2A 5I3UA 3KJVA 3WX4A 3DRRB 3VAKA 2CQHA 2KU7A 3RYLA 2DRBA 1CS4A 3DLGA 2IA6A 4EZ6A 4LQ3A 1JJCB 3EGNA 4MKAA 7AT1B 3ZO7A 2JSXA 3KYLA 1G7CB 1RWKB 2WVBA 3P45B 2V94A 5KT7A 1NZ8A 3CPWR 4P2SA 1S6OA 4MT1A 2JEJA 3NXZA 4ZA1A 5KFGA 3W5ZA 1UWBA 4PPDA 4HYKA 4A8YA 2F65A 2KHDA 1UA0A 2VICA 2UZAA 4AYBD 2KJVA 4WE1A 2LQJA 4Z7YA 2ZJQQ 1Q8KA 1HWJA 3A8EA 4CO0A 1BMQB 2E1CA 2ZZMA 2RE1A 3MAAB 3DRYA 1YK9A 2RQMA 3KJNB 2CG8A 3V5RA 1ROFA 5BJRA 1HMVB 2BJ1A 5A0YA 1B99A 4F0MA 3THVA 3OVSA 3KUHA 3V4IA 1ZOTA 5B0GA 2DR6A 2R2SA 3CJ4A 3GJSB 5CYJA 4JI6F 1BGXT 4GKKJ 1NH7A 2K7JA 3K8WA 2MQMA 1AUDA 1KTQA 2XQCA 1MG7A 3M2RB 2ZDOA 2YX1A 3DDIA 4DV4F 4G1QB 2M88A 3NCRA 3N79A 1WF0A 2B8QA 4K4WA 3AXMA 2JVRA 1QSLA 4HR2A 1XR6A 3W9IA 3PX4A 4UOGA 3K5NA 1YJVA 5AXLA 2YKQA 4CM0A 2D3O1 2WVEA 1FF2A 4WKYA 2V2ZA 2YNGA 2QMUB 2UVVA 2FHMA 3DHXA 3R5DA 2OEMA 4OI3A 3BH7B 4C9DA 2XY5A 1Q78A 5L1LA 5AE3A 1Y7PA 4DL7A 2V0NA 4QYRA 1IKYA 3J81Y 4FYWB 3TA0A 1HQUB 5GVQA 2YWGA 1KFSA 1IBKJ 3K59A 2V8VA 2XSJB 3V6DB 1R0AB 2IRUA 4ZPBA 5KT6A 4OV6A 3A8IA 3GSIA 5HATA 2ZWOA 2V9WA 1OS5A 2J7KA 4B3SJ 5F8GA 1SH3A 2QLFB 3PHEA 4BHQA 2JJ4D 1M0SA 1Z4UA 3DDKA 1IKVB 1TFYA 2A6OA 3KK3A 5IM0B 5CQGA 1C1BA 3PFEA 3SMZA 1UFWA 2KVQE 4RNHA 2HNYB 4LSNB 1TV6A 2AMCB 1LNQA 5C42B 3MHYA 5FJ4A 4F7VA 1B3TA 2QYCA 2RH3A 2L9WA 2M7SA 1UCNA 2KZMA 8ATCB 1NB7A 4CCHA 5K14A 1LWCB 4LFBF 4HI1A 2FD2A 1JK9B 5F8JA 2E1AA 2EG2A 3TI0A 4LRDA 3T19A 2Y8WA 4ZHRB 5J2MA 2MKCA 2MZSA 3HHLD 3HVTB 3UD5A 3D3CJ 1FE0A 3D1OA 2V68A 5DRKA 4FYDA 4R8UA 4DV2F 4O4RA 1SV5B 4U8YA 5AT1B 2BYCA 4NZ7A 1FJEB 4KGVB 4BWJA 4ZITA 4OZ0A 3V6KA 4J9OA 2A18A 2CNOB 4UT4A 2UXDJ 2WTFA 1BQXA 5GAEU 2DPJA 2MKHA 1RTHB 2OH2A 3G8SA 2FB0A 1SH2A 2E7WA 3AOBA 4AT1B 3W65A 4C3LA 3N01A 2VD3A 3KLGA 2AYMA 2JNJA 2XSFA 2BBEA 1WOOA 1NPPA 4DR2F 1AW0A 3KHLA 1U1PA 1RE1B 4ZN1A 1UZHA 2OTLS 3OJSA 5HROA 2J0XA 1O8BA 2WOMB 1WDDA 3NAHA 2D3UA 4K4XA 3NWRA 1KP6A 2HHSA 4ED0A 4G65A 4ECQA 1XNQF 3GIJA 1ZZFA 4USTA 3U1LA 1RWPB 1T3NA 4TLRA 3ZXWA 2RVJA 1N32J 3CE8A 1YRUA 1RAIB 4NMXA 1WNEA 1LW2B 3BO3A 2FHOB 5C7PA 2FVRA 3PEHA 5M2RA 2LXIA 5C25A 1ZAWA 4LIRA 1KQSR 2ZNZA 3C8YA 2MZ1A 4GVBA 4PXEA 3KLIA 4DSLA 3TAPA 1U0HB 7FDRA 4EO8A 1C0TA 1BUXA 1T9VA 3CDBA 1D9FA 1U8WA 2DNLA 5HLFB 2ACYA 1X5PA 4URSA 2KT3A 4NZ0A 1ZAVA 4DI6A 2QZ8A 3IBWA 3ZTPA 5ETVA 4L73A 3NLCA 3CNQP 2F9DA 1G4CA 2F8MA 2DHHA 3T5HA 4IOBA 1DQ8A 1X8DA 5DLFA 5ETQA 2HWHA 3AB4B 3LA0A 2ZVSA 1RAOA 2U1AA 2AGQA 2AEJA 3P5BP 4RW9B 5SZTA 1WHWA 5L9XA 1FVSA 4E0DA 2DISA 1JLBA 3MXHP 5CA5A 4N41A 1C2PA 3BV8A 4OI2A 2HHHJ 1KVJA 4ICLB 2IJFA 2FHJA 1KC8T 4JI7F 2NXNA 1FRHA 2R4FA 3OFGA 3W63A 4Y2KA 2QFJA 4NXMJ 3R9LA 3PXGa 1DTQB 2F5GA 2HFNA 4H4KC 1SIWB 5KFFA 5A8RB 3QIPA 1UW4A 3WDOA 3PW2A 3B78A 1RZMA 3UCUP 3FBBA 3HT3A 4USIA 3MR3A 3CJSA 1TKZB 2KN4A 1HFEL 5LM7E 1ITPA 4ECXA 4EBDA 2A2BA 1VISA 1QJHA 2KZZA 5IS2A 4CP5A 2K3IA 3F44A 2I2YA 1SUQB 4DQRA 5D3GA 2BXJA 3ZZTA 1NDKA 2JC1A 1TKXB 3WHIA 4QIEA 3BM7A 2IA0A 1ZPWX 4NLGA 1T9XA 2EWHA 5M2PA 1R8CA 2VG7A 3BF4A 2M70A 2AZ1A 1Y5NB 2XS5A 4BWMA 2NXUA 3THTA 4B9TA 3MEEA 4FNIA 1XMQJ 4B3RJ 4ZLJA 5E5NA 2MY8A 3JSRA 2I8EA 1S0MA 4B08A 1LWEA 3ENVA 2J0QD 5A8WA 5ETRA 2HNZA 2VC0A 1JX4A 4HKQA 1L3KA 2CUYA 1F9FA 3BB5A 3DYAA 3VQSA 3A13A 2PSZA 2HGMA 1Y9OA 4ZVPB 3US5A 4LQ9A 5HVHA 3LWMA 1Q16A 3JTOA 2GW8A 2HMIA 2YH0A 3KUEA 1UVKA 3FT7A 1KQGB 1URRA 1IM4A 1SJ3P 5DJBA 3IR7B 1VFJA 2E5HA 4A47A 1IKXA 2OGUA 2HEKA 3LANA 4UTGA 3SQGA 4USMA 2KFZA 4DV7J 2QSFA 1CPZA 3Q0AA 2XLIA 3LJPA 2RUSA 1SJQA 3QBCA 3TZXA 2D74B 2GPEA 1CQNA 1EAYC 2I5JB 1JLGA 1S9EA 4HI2A 3FBFA 3BGOP 5KG5A 2BNWA 2VONA 1UA1A 1JNZB 3PJ9A 5DDRC 2DHSA 3D6MB 3LGMA 1S1UB 2C28A 2GIRA 3GONA 1N4LA 1EP4A 1K1SA 3DRPA 2DY9A 1KTVA 3R3TA 1HNIA 2GHVC 1VMBA 1Y00A 2G0CA 3KHRA 5HVFA 1HWUA 2IAJA 2G2ZA 2ZE2B 3W2VA 2ROEA 1XIQA 4WKRA 2OIHA 3FEXB 3V4MA 3CMES 1U2RA 4B17A 1P6TA 3GXQA 3HULA 1H98A 5F41A 3BN7A 1OPZA 2JEIA 1VCTA 2ZH8A 1LFWA 2RKIB 5F9NA 1G1XA 5E2QA 4Y28C 1NEEA 3C6UB 4F4WA 1HHSA 3LWLA 3D5MA 1NK0A 5LMNJ 2NXCA 3CW2C 5BYRA 4UOHA 2COLA 1UEVA 2DR5A 4N5SA 3GSDA 4QOTA 4DPUA 1NH8A 2ASJA 3I56S 2B7CB 4RU2A 3D6TB 2E66A 2PA3A 5KFKA 4ATNA 1B7YB 2K06A 2N7CA 2BA9A 3R5BA 3OT9A 3RZAA 4JI4F 2DRDA 3BBCA 4ZKAA 2WZ1A 2HWTA 2C1EB 3DOMA 3AD9C 2ZBPA 1NRKA 4DF8A 4DBQA 3FSIA 4K5SA 1VBZA 5JMNA 3POTB 5L1IA 2ZH4A 2E44A 2X1AA 4NLUA 5KFHA 1PG5B 3NGUA 4O4GA 2MDAA 2E5JA 1HNZJ 3BSCA 1YHQS 4ME7E 2VBZA 2ZBRA 3T6JA 2RHQB 3AB2B 1S1VB 4C0BA 3KNGA 1SQEA 3B82A 5KG2A 3A1YG 2DYAA 3PJXA 3OVAA 4X62J 3P4UB 3G5OA 1XERA 2YWHA 3TUIC 2YNFB 2E1RA 2C2RA 4AXIA 1TQLA 5GAHU 2W2OP 3BYPA 2P9GA 2C3MA 1VQOS 4PWWA 4PG7A 4NLXA 2MJUA 3DN9A 2AYGA 1RU2A 4QPXA 1XTZA 3CF5Q 3RW7A 3HD1A 2CIMA 4MKBA 3NCPA 5KFTA 3MMAA 2XNRA 2FC9A 5L9NA 2VQFF 2MHEA 3MF5A 4JI3F 2J9DA 2C2KB 1V3ZA 1VDHA 4ELVA 3H2VE 2OPRA 2IC3B 3BKTA 3BQ1A 2FY8A 1HLWA 5E0OA 4FXVA 4OZ3A 2AGOA 1SL0A 1UJ4A 2N7YA 3H5XA 1S0NA 4K4ZA 2F63A 2HBYB 4A8MP 1VRTB 3AAWB 4F4YA 2UUCF 4CRJA 1D8ZA 2M3DA 4MFBA 2DH7A 1N5QA 2DHXA 4KKOB 4ZP8A 2FJXA 2DGVA 3MAQA 2IRYA 2X1GA 2R2TA 4H4OB 1RT1A 4F50A 5EDWA 1RTIB 3GFHA 3E01A 2VZ9A 4KPYA 1RACB 2OD4A 3IM8A 3T3FA 1NJIT 3E3XA 4J9MA 3G6YA 3I4HX 1VHFA 2FUG9 3IFEA 3EICA 4OX6A 3FZ2A 4FYVB 1S99A 3BO2A 3G6XA 1DTTB 3DXSX 5B0AA 1WC0A 3G82B 2XMMA 2R8GA 1RDRA 1TK0A 3UDLA 4C98A 5AXMA 2DVIA 4ID8A 1U7LA 2ZH6A 4FXDA 4HHJA 1X5TA 4YMEA 1RWMB 5ETSA 3AH6A 3M2VA 3GR1A 2RT3A 3C2PA 2ZHOA 2ADBA 5E7OB 2VJVA 1UVNA 4N76A 1CC7A 1HQEA 1PO6A 3VGTA 1J5OA 4J9NA 3H5SA 2JEFA 5DO2A 1MLAA 3I9V9 3SIPB 4DCPB 3CMQA 2PA8D 1ZA2B 3D0IE 1BD6A 5FD1A 2MKSA 1RWNB 3DGVA 3GQCA 1LWFB 4LF6F 4N47A 2ZEJA 1U49A 5J1NA 4JOUA 2EC0A 4WIQA 2ILZA 2XZDB 1R6VA 1TL7B 5C24A 5I3UB 3KJVB 1R27B 4KSEB 3CCSS 5EWEA 1CS4B 2HK2A 3DLGB 5F9LA 2M2BA 4F4AA 2V8PA 2Q3PA 4ZP9A 3NKYA 1HNXJ 2VL1A 2MGZA 3VVUA 2GC8A 2KI2A 1I3OB 1FD8A 4TY9A 4ANDA 3QYYA 1RGVA 1PARA 5LSOA 5A6PA 1EQMA 2HBZB 2JBVA 3R1LA 5IV3A 3H90A 2VV5A 2VA2A 2DIUA 1UWBB 3BGUA 2RRAA 3O1LA 2A1BA 1OSDA 3HJFA 1RKIA 1SIZA 2LA4A 2H1YA 4WE1B 4QWCA 1IM6A 2VDHA 4P6QA 4LIWA 3EVMA 1R8HA 4B3OA 3QO9B 4LF4F 5A0YB 4ZCKA 1LEOA 4C11A 4NXNJ 1M5HA 4I67A 3V4IB 1VQKS 2GAHC 3Q8RB 2RDDA 2QIFA 2LQ5A 1NLKL 2VA3A 1GTEA 3K5MA 3THPA 1N5YA 2X3DA 2JFDA 2CVEA 2J76E 1M5VC 2CAXA 1GXTA 4DL5A 2V4QA 3SCIE 4CLFA 1YBAA 2BV3A 2J6UA 4M5LA 5HAOA 2R7TA 2BA3A 2LEAA 1KS2A 3F73A 2IM3A 4I69A 4LRCA 2FPHX 2HHQA 5DG9A 4KQZA 1VC0A 4QW8A 2DY1A 3D6HB 3MR2A 3PO4A 1YITS 3RRHA 3RB4A 1WEZA 2YNGB 4IH7A 5J1PA 1IBCB 1HR0J 3FJ2A 4I56A 3IA0A 1FD2A 2HFOA 1F9EB 1RT4A 3EWGA 2F8HA 2NZCA 1IKYB 4LF5F 3QNWB 4WCEQ 1H7WA 2OPQA 1PJ5A 5EX3A 1S6PA 2K9IA 1OPIA 2ZBQA 4X64F 1HBMA 1NZAA 5HMYA 1AA1B 1NLAA 3DNCA 5E3CA 5KG6A 2ZJPQ 4KGMA 1K0TA 3QWUA 3PIOQ 3HP6A 2OEKA 2VKZG 1AZSA 4RW6A 2HPUA 2C2MB 3VVTA 4CO5A 3KK3B 1RU1A 1C1BB 3MFHA 3M8ZA 3BPSP 4MYUA 2WSFC 1WC4A 2FJBB 2POKA 1TV6B 3RAXA 2GMJA 1FDAA 4TN2A 5IQ6A 1UEUA 3AQPA 5LOQA 4DQPA 1APSA 5DG7A 3MM8A 3AJ1A 4TQSA 3BBFA 3W5YA 4DX8H 2CADA 3I31A 5K14B 3GILA 3MAHA 3VF0B 4DV1F 3A12A 1NJYA 1N0UA 5J2MB 1L3VA 1B7FA 5HO4A 3AXKA 4IYQA 3PACA 3OD2A 1U26A 5D0GA 3M9OB 2I6WA 1S4EA 3SQOP 4M5NA 1RT2A 1MWQA 3M6VA 3G86A 4R8UB 3E51A 3T1HJ 1WG5A 3Q86A 1IQZA 4CO4A 2MPUA 1X4GA 2R8JA 2PE8A 2ATCB 3BO4A 3IBFB 3QZ8A 4I7FA 2CJAA 4USVA 3IN5A 3C66A 3OSPA 5CXTA 3SCKE 3B8HA 5F8HA 3UQSA 3NNAA 5EN1A 1UMJA 4JI6J 1BHNA 2Y1LB 3TWZA 4DV6F 3N6MA 4F8RA 1TK8A 2AZ3A 3KLGB 1D3WA 3GZ7A 4DV4J 5RUBA 5HROB 1XMOF 4RW4A 2AWZA 3M05A 2DNHA 1Q5YA 3EUNA 4X4OA 2OSRA 3DM2A 1ZZNA 4EBEA 3MR7A 4YOEA 4DPXA 5IT4A 1NDLA 3GIRA 3HPOA 4H4KA 3QT7A 1MW7A 2YX4A 2FQQB 2LDIA 3Q83A 2V6AA 1PILA 3T1AA 4YB5A 3QFWA 3KG4A 3VGSA 4JBCA 4RU9A 2D69A 2ILYA 5C25B 1SC4B 4DV5F 3BS9A 4X66F 2DNKA 2UP1A 2AF6A 4GVBB 3HHLA 5GMKa 5IFMA 1YJNS 3KLIB 4OHYA 4C8YA 1T9TA 2VFSA 2CYYA 4HLBA 4NLOA 4D3HA 3UPFA 1C0TB 4OQJA 1UVIA 4QU7A 2Q66A 4G6VB 1U47A 4J7CA 5E3PA 2AIRB 3RW6A 4L3KA 3VQTA 1JLFA 2HVHA 3LP2A 5EX0A 2KFNA 2CPDA 3FC9A 3CC2S 3J80Y 3JSMA 2AX1A 3LUYA 4LVOP 1DARA 4KBIA 2CKWA 2CNNB 2N4DA 1DURA 2CPXA 1JWWA 3VEAA 4OIXA 5JVGQ 2K1RA 2UU9F 1JLBB 1FX2A 3U27A 4UY8T 4LFBJ 3BBBA 5KFAA 4RPFA 1ACMB 2DGWA 4JI5F 2CQCA 2VFTA 4LREA 3UN5A 1HKAA 2VQEJ 2NXEA 3J7YU 2QA2A 4OJ3A 2VUGA 1PC4A 3PEJA 3CCZA 1EKSA 4DV2J 3QIPB 1TKTA 4JI2F 3UW1A 3OR2A 3ZNUA 2QTWA 2EI5A 1Q82T 4OX7A 2MB0B 4ZPDA 4DUZF 3OFEA 4YR3A 4UZBA 2L3MA 1WHVA 2ZDPA 3QT5A 3VCDA 4ELTA 3QSYB 3SYZA 3TEHB 1NPRA 4NA2A 3HFVA 1KKHA 4I6AA 8AT1B 4RUBA 4CNZA 2XYHB 3WIUA 1IKWA 1IBLF 1NBEB 1GMWA 3HKWA 2RU9A 5D3GB 4TY8A 3J7Z5 4JI0J 4DR2J 1MU2A 3IAS9 2QT7A 4FVMA 4GRSA 5CYMA 2HS0A 3DFEA 2XTJP 1DAXA 2QJ3A 4C2MA 1M5OC 1RK8A 2VG7B 1VQSA 2HRUA 1XNQJ 3R5JB 4B3TJ 1X60A 2HG4A 1JXLA 1S49A 3CJ2A 1NDCA 4YDXA 2DH9A 3M6UA 4QIGA 4ILRA 2H5JB 1LWEB 1OHNA 4KPCA 3DMJA 3DLBA 2CQDA 5A8WB 2HNZB 4HL9A 1G3OA 4NLVA 4MIBA 4PG4A 3H8YA 3TVKA 3EMTA 4LRVA 4PXCA 3NOGA 3DYAB 1SC1B 3QPIA 1FWLA 5K5MA 1O51A 1QAYA 1QVFR 3LF0A 1JKHA 3IS9A 2IVFB 4W4MA 1Q16B 3I5BA 3RRKA 2HMIB 5CCLA 3SCJE 2DT9A 4CLZA 2Q43A 3AOCA 1RLDA 2CJXB 3PIPQ 3CJRA 3H5YA 1IKXB 1Q0NA 4ECSA 3QFHA 3SQGB 3FQKA 4MK7A 3FCVA 4WF9Q 1VJQA 1BDTA 1L5UA 3RBXA 2BJ7A 1UPMB 1BC6A 1UVMA 5MAOA 2GHPA 3DOKA 1W7WA 3X1LB 3R8YA 1JLGB 2JLEA 3R5CA 2CPEA 2CNLB 1S9EB 4JI7J 4IQXA 2C2DA 2MEWA 5KG3A 4ED1A 4C3MA 1X4CA 4O3NA 2OELA 3HKZD 3VZHA 3H40A 1W25A 3MD1A 4JI1F 4M5HA 4P2XA 2FHJD 5G0RA 5J1EA 1VQ6S 1EP4B 3DRPB 1LFPA 4ECRA 1HNIB 1BWVA 4GMKA 3AODA 2V34A 4C6AA 1OY9A 2IAJB 1HBUA 3L7PA 4G1PA 3UDCA 4CO1A 3W2VB 4OI6A 2IFXA 2J6SA 2KG1A 3Q8UA 1TVRA 4GVLA 1KWMA 2V4JA 3PW0A 3DHWC 2XY6A 2KELA 4NCBA 3ZZZA 1RADB 5D0RA 1NHKL 1MSWD 5LL6d 2C2EA 5KFBA 4KT0C 2BDPA 5J2PA 3M4XA 2G1HA 2RDIA 1U9PA 1SJ4P 3DLJA 4KV8A 1X0PA 3M7VA 5EGYA 1T94A 1AUSL 1U24A 1EJ7L 3AY0A 1Y0HA 2XULA 1WHYA 1R7IA 3FRZA 4TQRA 1KVKA 4CO2A 2BJEA 2W2MP 3G2XA 1PYOB 3GYNA 2FHKA 4ES3A 3HVAA 4ED4A 4L75A 4LVNP 4DR3F 2YQ3A 2OI2A 2QYGA 3DOMB 4DSFA 2FZCB 1WG4A 4B9LA 1NNDA 2WB4A 4IG3A 2R7OA 3RU0A 2CDRB 1Y5IB 1HD1A 3ENWA 4DR1F 3MZIA 3UE2A 3PYDA 3D28A 3ILIA 1FDNA 4DR5F 4O4GB 1E6YA 4OJGA 3ISNC 3LP1A 2YWKA 3BN4A 2PI4A 4URGA 2XYPB 4RR5A 4ELUA 2MZQA 1QTNB 3QZ7A 5DS7A 3ELHA 2ZH2A 4PWUA 5BR8F 3GIIA 3P8BB 3CMAS 3MPYA 2HKEA 2KOEA 4EZ9A 2YH1A 1F9HA 2O3DA 4FP9A 1WWHA 4ZVUB 4F4XA 4GKJF 5DETA 1S0VA 4X4PA 4PQAA 4ZP6A 1RBLA 3R97A 2QA1A 3PX0A 4U8VA 3PRVA 1TMMA 2WONA 1O5JA 2GJIA 3HLUA 4CLWA 4DPYA 3MMAB 1HWKA 3L7UA 3LALA 1XC9A 1KHVA 4M8LA 1SL1A 2ZKTA 4YR2A 3I0SA 2W8LA 1JLCA 3HMJG 1FXRA 1R89A 2G0IA 1VQ7S 4DU8A 2OPRB 2E7VA 2E1MC 4WYLA 3CB4A 4MK8A 2J7WA 5HL7Q 2MSSA 5IT0A 1S79A 2IJRA 4DHVA 2W25A 4OJ1A 1CJVA 1VQNS 3B6BA 4MFBB 3GV8B 3OTDA 5BYSA 4D8JA 1HA1A 3MECA 4Q8FA 2JFKA 2B0GA 4P2FA 4YP3A 4DQIA 2IYIA 1RAFB 1RT1B 3KLHA 1VQYA 3J7AN 1Q5VA 4OZ1A 3CCWA 1YX2A 3E01B 1HIYA 2CQPA 2E9ZA 1I1GA 3L95X 1QD1A 4C0OC 1YSJA 1BQMA 4PEOA 3MPUB 2YXLA 4RNFA 1WHXA 3AQOA 4TNOA 1D9DA 2MTLA 2X1BA 1G6BA 1R8PA 3NGTA 4JI4J 4Y2AA 4J9RA 1S1XA 3OXLA 1Y10A 4NEYA 3RBZA 2XMTA 3FMWA 2BW2A 3KK1A 1XNRF 2CPHA 4K5RA 2EKYA 2CQ1A 4YN3B 4I6WA 1LOUA 4KH0B 2HQFA 3GIKA 3M2VB 5F3ZA 4IOAQ 1VQ4S 4RBTA 4ZVOB 1HQEB 3GCWP 2NUHA 1J5OB 1DLOA 3HXMA 2FLNA 4TU8A 1N0VC 1N36F 5HANA 4CLTA 4DEZA 3P96A 3GV7B 5KFSA 2Q6BA 3VAGA 5GADI 4B9NA 4RX6A 1RTZA 1GEHA 1T95A 5CYQA 3WZ0A 1UVLA 1X4BA 1L3TA 2Z2YB 3OTEA 1YGYA 2MKKA 1VS3A 4ED6A 2XI2A 3M1VA 3QRPA 5C24B 2B43A 4WU2A 1TKDA 5HQLA 3QWPA 6FD1A 4I68A 2XMAA 3ILJA 4PXBA 1H7XA 1XJWB 3HX9A 4ZVRB 3ZTSA 1U09A 4ENOA 3T5LA 2NLWA 2MGZB 1S77D 4KAIA 4JI3J 1SJFA 2B4PA 4WFBQ 2YWEA 5HP1A 2DGOA 3H4DA 4RNMA 4OYZA 4EBCA 4DPOA 1RT3A 1YJRA 1T8EA 1ZTWA 2P2CB 5LMUF 2J7UA 5THWA 2JH3A 3Q2SC 2F4VF 4P10A 2UUCJ 3A3NB 4HHUA 2DNGA 2KXFA 1U1KA 1OY8A 3CCUS 1DQ9A 1QTGA 4B3OB 3DLHA 4FBTA 4L6V3 1XN9A 2XGQA 4WXWA 4C11B 1H38A 4DZDA 5LSRA 5KG4A 3HSGA 1WI6A 5GAEI 2KO1A 4NCAA 5FLXU 2KDOA 1M5SA 2QL5B 3PFOA 5D4LA 4WZQA 1RAEB 1N34F 3GJTB 4YUDA 1N5YB 2JXIA 2EFOA 3FBCA 5HN0A 2IDLA 4EEYA 4NOHA 5DDQC 4K7QA 3KHHA 4DS5A 3A3PB 2Z2ZA 1PCAA 1T11A 1NSQA 3SCLE 2QG9B 2LQ8A 2Y9HA 2EBGA 2UUWA 2CQGA 2W7OA 5KFRA 2V8GA 1ZM9A 5DGBA 1GX5A 2XG8A 3MURP 1B28A 3IO1A 3K5LA 2FJEB 2WSCC 1S48A 2F7VA 2C22A 2HS4A 4U96A 4ZS6A 3R2CJ 1RT4B 2QMXA 3JAMY 2HQDA 2CZ9A 3R1HA 1NSAA 2XNQA 4CIOA 1RT6A 2XMVA 4QR2A 3W2WA 2OPQB 1YJTA 1S6PB 4C8KA 4HHHA 1HBMB 3DOLA 1B0PA 3B4DA 3MMJA 2XCPA 3NY0A 3R2DJ 2P5VA 4USJC 3FSYA 2HHPA 3LW5C 5C2GA 1U02A 2RUGA 4LF6J 2IJNA 1VQ9S 4KFBA 1EETA 3MI7X 4P74A 4RW6B 5DGAA 5KFLA 3GB0A 5KFYA 4LFCF 3TAQA 3TOQA 3TJ8A 1FCAA 2J0SD 4CLSA 2E7XA 3MM9A 3FQLA 3KNAA 2OTJS 2MQOA 2FVPA 2AYEA 3J80U 2O66A 3FNNA 4JV2A 3CDAA 2VFVA 2G0JA 2KL8A 3MM8B 3SBMA 4WP8A 3QAEA 4QWAA 1WSVA 2B3TB 5DDOC 1FKPA 2FVQA 2BOAA 2EW9A 3WBZA 2ADLA 3BGLA 2QLXA 4GO7X 2ASYA 3EXYA 3UCZP 1J5EF 1F2HA 3NS5A 4YFUA 2BACA 1RA6A 2FYXA 2V9KA 3W66A 1RT2B 4X2BA 4IH6A 1AYEA 4MKYA 4Q44A 3EVWA 4LF9J 4OYOA 2XLJA 4MTPA 1NKCA 3SSRA 4C4WA 1U6FA 1X4HA 1YVFA 4LF4J 3GP9A 1FKAF 4J37A 2C2ZB 1FFWB 3TEGA 3NL0A 3HHEA 2EEYA 2QL9B 4Q0BA 4ZMMA 1TELA 3WC0A 1HHQA 4J90A 3LPYA 4K0KF 2V67A 4IDKA 2UXBF 4FYYB 4HH1A 2V5HG 1YI2S 4C7QA 2YPZA 3EZUA 1X5SA 3HZGA 3ULHA 4EUVA 4KHPJ 1V3SA 5K8MA 1JJ2R 3W9HA 2GMLA 4RW4B 2IY5B 4UUWA 2AN7A 3UCGA 2WB1D 2B4OA 3I55S 2ZD1A 2A2CA 3DM2B 2J9CA 3MDFA 4DLEA 1S72S 4M5KA 2HGLA 4RJVA 1SB6A 6FDRA 3TUZC 3MFIA 3T5JA 2QN6B 1RT5A 2F3JA 4DFKA 4ECZA 1Y11A 3HHLB 4LF5J 4NE9C 3MUTP 3TRGA 2MZTA 3CJ8A 2DPIA 4YY3F 4X64J 1PYTA 2QA4G 2M5YA 4DFPA 5D78A 3DU5A 4NYZA 4X4VA 2B51A 3OJUA 1QE1A 1V6HA 2I38A 1S9GA 4AL7A 3HCXA 5DQIA 2I0XA 1B0VA 4EYHB 1NXIA 4WFZA 1HI8A 1S7IA 2ZH3A 3FFIA 4DUTA 3QO9A 1OG7A 1JLFB 3LP2B 3T5KA 4F02A 2PC6A 2RNEA 1F2GA 3JSMB 2J8SA 2DNOA 3BEGB 3R7BB 3MPWA 4L72B 5EUHA 1JIHA 5CZVA 5IT9Y 1TL1A 3Q23A 4WZMA 3GMGA 1M5PC 2G2YA 3IRWP 1NHVA 2K1RB 4LR9A 3LGNA 3JXOA 4BS2A 5GMDA 1ZS6A 4DV1J 4XK8C 2R9LA 1NK5A 3D1HA 4NPOA 1CJTA 5L1JA 1RHUB 1HWIA 2VBWA 1RWXB 2CQIA 3D9BA 4Y65A 4V19X 2DCLA 1C4CA 2LQBA 2M4MA 2G9OA 4GC6A 5HMZA 2CDQA 1TKTB 3KTQA 3I82A 3OR2B 3QJLA 2CFXA 4O0IA 4DV3F 2AGPA 3CD6S 3I5CA 3JQJA 2DBBA 4DSKA 4AL5A 1GQEA 3L09A 4NLTA 3RBDA 4FXEA 1KN6A 4C3KA 4NXMF 3PHTA 4ED3A 4WP9A 2EFPA 1HW9A 3PNIA 2FVCA 3ET6A 1IKWB 3MCOA 2RDJA 5D0HA 4V19J 4OYPA 4KRWA 4TY8B 5ITHA 2HRYA 5KG7A 4JV5J 4K4SA 2AJQA 3PKMA 2JRSA 2SXLA 2J6TA 1MU2B 1XMOJ 3CCQS 3MM5A 4ANCA 5CYMB 1U2FA 1KQKA 2OEJA 2XMKA 2QLWA 3K7RA 1RTJA 4P52A 1X4EA 3ITHA 4FYXB 1DZ5A 2HVZA 3QQCD 1WELA 2M8HA 2BZ2A 2RD5C 1GMVA 4O3QA 1JLEA 4FS1A 2BQ3A 4CLKA 2QLBB 3M6XA 1VHIA 5DZ6A 3K0JA 1WOPA 1EIYB 2G13A 3DMJB 4DV5J 4X66J 1NAQA 3PJWA 3QJPA 1FTRA 4K59A 1D1UA 1H2UX 4CNYA 4A46A 1EQ0A 3CJKA 3G6VA 4ES1A 4ZK7M 2QEXS 3KMQA 4XDDA 2Y3YA 3RR8A 4NL5A 4B3RF 1T0TV 1JKHB 3IS9B 3JTPA 2R7QA 4D3GA 2WBMA 4MH8A 4NEZA 1IBMF 3MTKA 2CVIA 2ACMA 4USUA 2NQPA 1Q7YT 5L8RC 4TU7A 4Q2MA 4WFYA 4ES2A 1V3RA 3MOZA 4WP3A 3RG6A 2N4CA 1FJ7A 1WC5A 4JV0A 2L08A 2HQCA 3FK4A 3EPGA 2AY0A 4C97A 2BABA 5KFQA 2GIQA 1PSDA 1EARA 2HZAA 4O0NA 3QOQA 1RCXB 1U1OA 1MWZA 4RZRA 3H7HB 2UU9J 2RQ4A 5ETTA 3DLLQ 3MM6A 3M8PA 2NR0A 2NYHA 3DOKB 2PN6A 2ERRA 5A8KA 5GAHI 4UW2A 1RI7A 4CQ1A 4JI5J 4ITSA 2ZITA 2F8EX 2W8KA 2Y0SD 5B7WA 5SUHA 5KT2A 3TARA 2BJ8A 3FZBA 3H5UA 5G0RB 5J1EB 2A0FB 1DHMA 4X4SA 1S12A 4Y34A 2ZFHA 3F56A 1KRPA 4JI2J 2PMZD 2RAQA 3FUYA 3UN3A 1HBUB 2HIYA 4XO0A 1Q4RA 1AROP 3TANA 4CTAA 2CWKA 2F40A 3K17A 4ZLPA 2EKNA 2IM2A 2BEFA 3W61A 1TVRB 4C0HA 2HVIA 3EZOA 1JLAA 3NMAA 2V4JB 3TP2A 1RAAB 5D4NA 2YQ0A 4FPRA 1S1WA 3PDNA 3IRXB 1IBLJ 2E5IA 4PZVA 4ZN3A 3GYXB 4DQQA 2OPSA 2FGCA 1SJRA 2CQ3A 3IXQA 1MYKA 2D1CA 4F3QA 2E5LF 3KG0A 1ZETA 1GMWD 5J2PB 3BKUA 1Q8LA 4XIUA 2CJYB 5BXIA 4DR7F 4KV8B 4KC5A 3HHKA 4R25A 4CLUA 2M52A 2BJDA 2PT0A 2YNIA 3O5TB 2HFVA 3PR5B 2ZH9A 2EK6A 3JSBA 1RABB 3R27A 4AQYF 2HWIA 1B01A 2XHCA 3T9NA 3GJQB 2DITA 2KH9A 4LFAF 3BDPA 5K9FA 2Z8QA 2BJ9A 5LMNF 2HFZA 3PYEA 2LP4A 3O3LA 1CC8A 2ZH7A 3EYZA 3MD3A 1CULA 3VTIA 3KJFB 1WF2A 5AXNA 3FMTA 4CT9A 2HQ3A 3HFZB 1Q81T 4MIAA 2HAIA 4RKUC 2OP5A 2LXUA 3LO3A 4IG3B 2UXCF 2AKWB 4HT5A 2J9EA 1AB8A 3M9MB 2JVOA 3NBPA 2QA4S 1HBNA 1E6YB 2IHR1 2JC0A 2OPPA 3H59A 4B3MF 2ZJRQ 1NJWA 2DR8A 3LP1B 1H2TZ 2DEJA 3TNVA 5ETKA 3PW4A 3HVRA 1FRKA 4DG1A 2J8AA 2IMWP 2CQ4A 1GNKA 3RJMB 4YHHF 4A8OA 4QIFA 4RUCA 2B4VA 2HHTA 2KM8C 4RLEA 2AYBA 3CCMS 5KG1A 4NLWA 1HNZF 5HQ8A 2JLFA 4M5MA 1RLCL 2RILA 4BDPA 1WDTA 2CPJA 5LSLA 3HVWA 4RNOA 2WONB 1WEXA 4JI1J 3OTOF 4TU9A 4NLYA 1K73T 2LLZA 4USWA 2NREA 1BAZA 1VC5A 3KMSA 3Q8PB 2GZOA 3HM9A 1K47A 4N77A 2JZ5A 3I0SB 4FF1A 4DN9A 1JLCB 2MHNA 3CJTA 3KUGA 3R6LB 3NO7A 3D66A 1N5TA 1SH0A 3PV8A 3V81A 3WC2A 5IWAF 2ALZA 2CJQA 4XPEA 2LU1A 4DWIA 3HSZA 2QE5A 1KOOA 3N0VA 1CJVB 1UJ5A 3GFXA 5I3PA 3N9UC 2LEBA 4O3OA 4WJBA 2YKPA 2KYXA 2P9CA 4H54A 3HO1A 2L41A 3MECB 1F5CA 4WPAA 2GNKA 2X7IA 1NK8A 3KLHB 4OV1A 3VAMA 4DZ6A 1OY6A 3M32A 2DD8S 1S97A 3VW4A 3TR5A 3WIVA 2IM1A 1BQMB 2GFFA 4B9VA 3DU6A 1RHQB 2DGXA 5G4DA 3VHQA 1P1TA 4P9SA 2I1RA 4C8LA 2UV8G 2I9SA 2WRMA 4DR3J 1S1XB 4YB7A 3VGUA 3U1NA 4F4KA 2LMIA 1RAJA 4IKAA 4LBPA 2IPOB 1EB0A 3KK1B 4WTOB 4PWDA 1MMNA 1S0OA 2WVDA 3UR0A 2AX0A 5KT4A 2D9OA 4DR1J 9RUBA 5KFMA 2YKMA 4DR5J 1QLNA 1CLFA 5FIIA 3MMCB 1O6XA 4FKXA 2RSQA 1DLOB 2H48B 5IC4B 2K2PA 1GH8A 2YKNA 2CNKB 3OLAA 2GGPA 1XBWA 3TW0A 1KONA 2BR0A 5CABA 3PTWA 2KT2A 4DCJB 4IUFA 1YKWA 1WJ9A 2YKOA 2JWNA 4NX9A 1SPBP 4FKYA 4Q7AA 2LVWA 5CYQB 2CZVC 4K4VA 3H87C 4GKJJ 4RUHA 2LA6A 2XY7A 4K8RA 1R6YA 4ZCLA 2LXFA 3M1VB 1K1QA 4CLPA 3UWTA 2NYIA 2OMOA 2KFYA 4LBIA 3VAIA 1FNOA 2NS1B 2PMWA 1MROA 3EXCX 1TZ0A 2QSWA 3BR9A 4F3MA 2CPYA 3CTRA 1H72C 1S1TA 3OFHA 1NHUA 5H9FJ 2XMJA 1HBOA 5HP1B 3TUJC 2D7SA 4ZJOA 2O67A 1HNWF 1KVIA 5JUMA 3RAMA 1CSJA 1RT3B 3MEDA 2MXYA 1FERA 5LJ5Y 1MWYA 4OLPA 1UKUA 2OLWA 3C15A 2RU3A 5KOWA 4JYAF 1VGYA 4XPCA 3HHDA 1DY3A 1W2IA 4WFAQ 1CEZA 1X4AA 5CCMA 2R8KA 2XEXA 3M8WA 2GA7A 3ZC4A 1VLOA 4CDIA 4LR8A 4DMZA 1IJFB 3LGHA 5D0EA 1FWKA 3HFKA 2N82B 1HI0P 3NCQA 4KHRA 1OQ6A 2FLPA 4NCGA 5L38A 2Z58B 2HLTA 4X65F 3TAMA 4RUAA 2EXUA 3I0RA 3PYGA 2XMUA 2NCKL 4X4QA 1B4SA 3LAKA 1OO0B 1DBDA 3U02A 3EGZA 1XK8A 5J2QA 4WU3A 2KTQA 3TO8A 3N4WA 1XNRJ 1SQFA 2HFSA 2VPXB 3D6FB 1NO8A 3AA8A 1FTCA 3W60A 1LXJA 4FDFA 2W4PA 1QAIA 2ROPA 4DPWA 5KFPA 4RBUA 5EHHA 4Z7CA 3OV7A 4RL1A 4MK9A 2BQUA 2CJKA 1FE4A 3K5PA 1E6VA 3NP5A 2K7KA 3ZTQA 4HT7A 4IFYA 1S6QA 1RT6B 3W2WB 4DL0C 1RP5A 2ADCA 1NSPA 3DOLB 2HSEB 3B54A 2F4FA 2FZKB 1ZTTA 5IZHA 2FGOA 3L9ZA 4UUXA 1CJKA 2W9AA 2BW7A 3N6LA 4DL2A 3H2LA 2YTCA 1T05A 4J9LA 2A10A 4KFBB 1EETB 2L9NA 3OPKA 3KDNA 1XR5A 3PCOB 1N6QA 1I94F 3KLFA 2BRKA 4NLQA 3W9JA 1TAQA 2FDNA 3MM9B 1QSYA 1RHMB 4KGKA 2WSEC 2OSQA 2R42A 1T7PA 4X4TA 1KFDA 3MCSA 4CZCA 5T7LA 3ZTRA 1FEEA 1S10A 1EKRA 4WTYA 4DR4F 1FKPB 4RW7A 2V8DA 4K2XA 3J7A1 3ISZA 4O3PA 4LBHA 3PG9A 1TR0A 4FF3A 3RR7A 4R5PA 5LMUJ 3ZTOA 3IM9A 2F4VJ 4NRTA 2ZHBA 2RQKA 3K89A 3J7YI 1C0UA 1VIXA 5B09A 4DCOB 2KRBA 2GVZA 1OMSA 2U2FA 5D4PA 4WBFA 4TYBA 1VYAA 3S6EA 2W9CA 4FXWA 4OX8A 3P3DA 2HQIA 4Q0BB 3S8SA 2FLLA 3D68A 1UPPA 4C8MA 2V2QA 2XBPA 3QSIA 4IDKB 4KE5A 1VK8A 3ICLA 4IH5A 5BYQA 1N34J 3FMBA 1FFSB 3T1HF 2H4WB 3J81U 4RW8A 5HJXA 1UP1A 4OL8A 4Y2CA 3NGRA 1ZPVA 4DS4A 3GG1A 3FRYA 3FBEA 2KXNB 1GT8A 1N33F 1TUGB 1IVZA 1UFLA 4K4YA 2RS2A 3C16A 1EA4A 5ETPA 3CDWA 2ZD1B 4LT6A 1FNXH 2MQLA 4KHMA 3HK2A 1N88A 2EBEA 4S0MA 5B08A 1FRLA 1JB0C 5C2CA 1WD6A 3CC7S 2N3LA 1XMBA 2Q2KA 4YEAA 5I4MA 4DUYJ 5KFXA 3PZPA 2B9XA 1NM2A 1X93A 2CWXA 1RT5B 1YBTA 3PW7A 2DRAA 1P94A 2HQGA 3GIMA 3NGDA 1VQ8S 2HVEA 4RWXA 4W98A 3AFGA 4U7CA 2VASA 2QRRA 2BM1A 2BKPA 2X51A 3DI6A 2HVDA 2EG1A 1WKJA 1YZ6A 4YR0A 5GAGU 3KLEA 1P1LA 1YJWS 2VDIA 4LJMA 1QE1B 4OI1A 3FKBA 3OW2R 1K9MT 1TL3A 4Q2LA 1NB2A 2XLKA 4C8ZA 2AD9A 4DFJA 1H0HB 1S9GB 5HI7A 1OJ4A 4B9MA 1VRUA 3BR8A 4LFCJ 2PI5A 2DXDA 3FFIB 2ZOMA 1WTBA 2H1OE 2DR9A 5E3RA 4RO0A 4ZIVA 3R7SB 3UNYA 3SSQA 3BQ2A 3LOUA 1WSRA 1H3DA 3G71S 4M1KA 1X7VA 5GADU 2HYIB 4KO0A 2LQ9A 3CVKA 3E2EA 4NMLA 4I2PA 1KEKA 3JTNA 2L48A 1TL1B 4X4UA 1SC3B 1K0VA 1JLQA 1QDUB 3GU0A 1JNRB 2XO7A 1FJGF 4BCAA 1RTDA 1CJTB 3MOJB 4O23A 1J5EJ 1Z2LA 2KHCA 1NKEA 3ZZ0A 3BGFA 4M5IA 3F41A 3DRSA 4UQGA 3JSYA 3K2YA 4H4MA 5E3AA 1Y3JA 5F8MA 5F3TA 3O8WA 2B5JA 4ANEA 4LF7F 1H2VZ 3GWCA 4DXLA 2AT1B 2QC3A 5IXUA 2JLGA 1ARQA 1UFKA 4K0KJ 2VQEF 3EE3A 2UXBJ 3UNGC 2RB7A 1ZM3A 3DXBA 1NCLA 3ET6B 3GE9A 3MUVP 1HPZA 2ZBIA 1RT7A 4A8XA 4F26A 3MCNA 2RBFA 3JQKA 2JOQA 2B9YA 3RRGA 2GO9A 1WKLA 2QFIA 3MM5B 2VOPA 1YG0A 2VHGA 4IO1A 1V9OA 4N8NA 1RTJB 1M1KT 3PKYA 3J81j 4K50A 1Y3KA 3C14A 3ITHB 3ENQA 1S9FA 1RYSA 4F04B 1FEHA 1U25A 3QT6A 2H3AA 1JLEB 4RBVA 4JI0F 1M5KC 2YY3A 4OYMA 4PUOA 3ILLA 1F6TA 4IG0A 3JYTA 4EGLA 3ZNJ1 1HD0A 1HNVA 3Q8VA 4QW9A 1HHTP 1AT1B 2OMLA 4ZPTR 1YTYA 4JI8F 2YVSA 3CJKB 4B3TF 3A8JA 4YY3J 3C6TB 2HRTA 5CAAA 2YBVA 4OHVA 3RB6A 3TZZA 2AJ0A 2N3OA 2CG4A 1AFIA 1KSPA 1OYEA 4HV0A 4ZPWR 2H5EA 1FESA 4ED5A 2UUAF 3ETOA 1AFJA 3MPVA 3EX7B 5HQMA 3FDSA 3WQPA 2VG5A 5IC6B 2VPWB 4ED2A 3G8QA 4WFNQ 4EFAC 2O01C 1EHWA 2DNYA 3QIDA 4OX9F 5CH7B 2DO4A 1W2BR 4OHWA 3MTJA 3MM6B 2DXFA 2DJWA 3M8PB 4ETXA 1VQPS 5H9FK 3BSAA 3W8PA 2DGTA 2W9BA 5A8KB 2C3UA 2CPZA 3TQ1A 4OLOA 2W4DA 1REVA 4JUZA 3CJQA 4OZNA 4QWBA 2UVRA 3OQ2A 4IFVA 4DV3J 3IAM9 1SVDA 2DNQA 1NK6A 3D0GE 4KJIA 1ZM4A 5A2QY 3TX8A 3CSKA 3BZQA 4CTAB 3PW5A 3W62A 2MMYA 1Q8BA 4USKA 1A6LA 2KB2A 1D9AA 1S4FA 1JLAB 4BC7A 2ZUAA 1ZA1B 2ZUGA 1WI8A 1S1WB 2BOPA 1IR2A 2OPSB 3QMQA 1FVQA 2XO6A 2HURA 4ZLNA 3IP0A 3QRQA 3D3BJ 2PDAA 3HHLC 3W1YC 2HFUA 4OYAA 4U95A 3SXLA 1SXLA 4CM2A 3OL7A 3T9ZA 2Z0GA 1S57A 4Y00A 3M8SA 1R31A 2YNIB 1UEKA 4J9SA 3RB0A 3UD3P 4NLDA 2J9DE 1FRMA 1FA0A 2EVZA 2BRLA 2GX8A 2MKIA 2C3OA 1NMEB 3QGIA 3MEKA 1SI9A 3G4SS 3W8GA 3BGRA 1FK9A 2HZCA 2A3JA 1GXUA 1CULB 1HARA 3CCRS 3NMRA 5KFNA 1EX8A 1YJUA 3U7JA 2GVDA 1FX4A 1WC6A 4AAIA 2YWFA 5D77A 2ZC4A 2HAFA 1B0TA 2WW8A 1DQAA 1RWOB 1IBMJ 3P49B 6AT1B 1M90T 3NBPB 2D3OR 1C4AA 2ZH1A 3SSSA 1HBNB 2OPPB 1F3VA 4TYAA 3DLKA 4A8SA 1YLXA 4P72A 1VOMA 3QGGA 4DG1B 1FDBA 2FLOA 3N5BA 4ZVHA 1ZYQA 2KG0A 4DQSA 5MLCV 3Q8YA 2KVIA 1ULRA 4NA3A 3TUPA 3Q8QB 5KOXA 3UVJA 3L4BC 3CXCR 1LKZA 1IXKA 2V63A 2PMHA 2F9JA 2NUUG 2AHOB 1PC5A 2GQCA 4IO9Q 2B6AB 2CXEA 4DX7A 1SKUB 2GJ2A 1PGZA 2XHWA 3GTYX 3LAMA 3D67A 3AD8C 4NYOA 2PFDA 3N6NA 4QPTA 3KHGA 2VFRA 2CRLA 1BE4A 3W7BA 4OYIA 3UFCX 2Z2LA 4OYBA 4IQMA 1BWEA 2DKOB 1R0BG 1QAJA 3I9ZA 4TVAB 1GX6A 3V81B 2ZOGA 2LKZA 3JQMA 3VALA 5E41A 5CD4H 4RNNA 2H54B 3ISND 2MLYA 3S01A 5DG8A 4QCLA 1UETA 3HI9A 4E2FB 5D6GA 4PR6A 2HGNA 4CWBA 1IR0A 1N5VA 3IGNA 3NOCA 2E5LJ 3CJ3A 5M2UA 3QJJA 2XC9A 4HACA 4ECUA 4MJKA 2XYGB 4XAKA 4DSIA 3OL6A 2LECA 2H65B 3M32B 4NYPA 4DR7J 1LW0B 2LU2A 5A76A 4BBYA 4M63A 3Q89A 3SEOA 2PEBA 4AFFA 4OI0A 3VAHA 2W24A 3IG1A 2HHWA 1OQ3A 1W26A 4AQYJ 1QSSA 1WACA 2MJNA 4LFAJ 2C2OB 1TAUA 3BDEA 4RWWA 4I4BA 4AXJA 2RS8A 2DCUB 2W4CA 2HW3A 2YNHA 1T9WA 3LTOA 2VPZB 1ZH5A 3N28A 1I5OB 3PRDA 4F2SA 3EGWB 4PWDB 4GO5X 4J9PA 3KJQB 4YB1P 3CJ5A 4DJBA 1S59A 1LK5A 2UXCJ 2EPIA 1NSKL 1KBRA 3CCVS 1KLMA 5L1KA 2YKMB 4HDGA 2DHAA 3TVYA 5F8IA 4B3MJ 4PPZA 5T41A 4CH0S 3SFGA 4DL3A 2ZC3A 1U1LA 1IR1A 4PAAA 3KKFA 1WEYA 5IV4A 5KAKA 5H1SV 1U2CA 2YKNB 3M8QA 2BKOA 4DL4A 1U1NA 2GGPB 1FRIA 2GS8A 3VZIA 2VG6A 4YHHJ 5KFVA 4ZVQB 3OTCA 4ECVA 1CVJA 3OBIA 1X5OA 3M2UA 1UVJA 3IRXA 4O3SA 1TK5A 3CIMA 4KY3A 2AQ4A 2PFFB 3EPIA 2Y0BB 2MZJA 2IM0A 1BQNA 3OTOJ 1MNTA 1VI7A 2W7AA 3O6QA 4XTTA 4DFMA 2XWXA 2APOA 2E5GA 2KYZA 1MROB 2MQNA 5HBMA 2DNMA 1S1TB 3AA9A 4DX5A 1HBOB 1N56A 1NKBA 1B70B 4QWEA 2VC1A 4LF8F 5CHCB 1TL4A 3CD7A 3DC2A 1U6ZA 4QBUA 1FT8A 5IWAJ 3C3LA 1QUPA 1P9QC 3MEDB 1Z1ZA 2AJFE 5KFJA 3UN2A 2BE2A 5KFIA 5C5JA 3OTBA 3BH6B 4DSJA 4FBUA 3H0PA 3C15B 4FS2A 4O44A 1GFWB 4PABA 3ZZRA 1P8GA 4FPIA 2XMWA 4NA1A 5J2NA 3CULA 5H9EJ 1NK7A 2QMWA 2AU0A 3HZEA 4J9UE 2FVSA 5HMWA 3OL9A 1V5IB 3NS7B 2GAGC 5F8NA 4LRBA 4DLGA 1HW8A 1YWXA 3T1YF 3KK2A 4NCGB 1PAUB 3BJYA 3P6YC 3M30A 2BKNA 3TAMB 2XS7A 1UZDA 4YDDB 5FDLA 4N8OA 3I0RB 1TL5A 4EMDA 2GCFA 2MY7A 5B0EA 3BSOA 5J2QB 2IVMA 3UO0A 4I2QA 3EJMA 3IC1A 3DGPA 1WG1A 3SDEA 3IMQJ 5T14A 3FVYA 2AEMA 5LXRA 4J91A 2WW4A 4A8WA 3NS6A 4ZIWA 4LSLA 2V69A 4UQTA 2DGQA 2HHXA 4DV0F 3QRRA 3IWXA 1BLUA 1E6VB 3UI3A 1FJCA 2BMBA 4IFYB 1S6QB 3ZZYA 4A8KA 4W90B 4XDCA 1KR4A 3HD2A 3CWJA 2NPIA 1CJKB 4B02A 4QIVA 1A9NB 1T05B 3KOAA 2BANA 4M5DA 3QLHA 4NI2A 1N6QB 1QAXA 4ED8A 1K8AT 2VOOA 2BSQE 3KLFB 2EFGA 5KFCA 3VV2B 5AJ3F 4CH7A 4WXOA 5F0WA 1RXOB 1B64A 3HSJA 4ZPAA 1UJ6A 1X4FA 3H20A 4U6PA 3CCES 3PO5A 2OAUA 2ATLA 4W92B 5T7LB 1FWPA 4ZP7A 1C1CA 4O3RA 1TU0B 1U1MA 1RJJA 4ZCMA 2QX0A 4IR9A 1HNWJ 1SKSA 5DM6Q 4RW7B 2ZH5A 4HVZA 3G9CA 1O0PA 3CUNA 3MMBA 2IBKA 1IWAA 2BVZA 4R5PB 4X4NA 1YRXA 1EZZB 2R7WA 3N5FA 2B56A 4AL6A 3DKDA 1SJ1A 2W2NP 2UUTA 3FCWA 4L74A 3WX8A 2X1FA 1A7GE 4JYAJ 1C0UB 1MNEA 3K57A 2GVZB 5K20B 2LEPA 4DX6A 3GFZA 3OR1A 2W9CB 1X0FA 4ID5A 3MMCA 4KB7A 1M1HA 3H25A 1YBUA 4ECWA 5KFEA 4Y6IA 4USHA 2GMHA 4ZCIA 3FGVA 1VQMS 4X65J 3MM7A 2R8HA 1SKRA 1FKOA 4LF9F 3OLBA 4RW8B 2OJ3A 2G1DA 4PQUA 4KGZB 2D41A 1CJUA 4WK1A 4DR6F 3EM1A 5L39A 3A4TA 3C16B 4QIWD 4CLYA 1FNMA 2EFVA 2R2RA 1URNA 4N7TA 3C19A 3CEDA 1QTMA 2YKAA 2K8GA 2UUBF 2R3VA 3OXFA 1N54B 2EC2A 3MWBA 5KG0A 3EDQB 4FVCA 4KHPF 2IIHA 2IMOA 4HH0A 2VQFJ 1OWXA 2XCAA 1RHJB 4ER8A 2DR7A 2DTJA 4I0WA 5ETMA 2ZM6F 5CZXA 1BXNA 5D4OA 2PIIA 4OMFG 3AJDA 3G8TA 3GV5B 4CH1A 2Q1LA 3LH2S 5B0BA 4C48A 1VLYA 4F0HA 3DI6B 1UTAA 3AT1B 4N56A 1YZ7A 1H74A 3KLEB 2NPFA 2QO3A 2RF2A 1JMTA 1RCOB 2JHEA 1Q1KA 1TL3B 4PG5A 4ZVSB 3ENAA 4TLQA 3GJRB 2NSBA 1VRUB 4M5JA 1J2VA 2CQ2A 4GC7A 1I94J 4Y0FA 4CT8A 1WORA 2Y1RI 4HTJA 2HNDA 2W2QP 1R3NA 2NZ4A 3QT8A 2HS3A 1Q95G 5HVGA 3ZFVA 2V4RA 4KO0B 1PBAA 1RBOB 3CDUA 4OYWA 4I2PB 4CYUA 4J5OA 2M8DB 2CPIA 2AEFA 2CPGA 1WF1A 3TZYA 1JLQB 3IBCB 3AD7C 1R43A 3L7OA 4DR4J 3I96A 2IRXA 3RTVA 3PVXA 4EWTA 1T03A 1M1GA 2ALYB 4P2MA 1RTDB 2ZHAA 1CQMA 5K8PA 2VKRA 3M8YA 4A8FA 4OI4A 4UZCA 4LUBA 4P71A 4LF2A 2VIHA 1Z2ZA 1RSCA 4GKKF 1HYSA 3DRSB 3W64A 4F3OA 2AJ2A 1FI4A 3V2UC 4H4MB 1RWVB 2B5JB 3M9NB 1SC6A 3BKFA 4EI2A 4MMOA
chains in the Genus database with same CATH topology
2Y3YA 2WVEA 3LGHA 3H87C 1U9PA 1NLAA 2BJ3A 1P94A 2K1OA 3FT7A 1BAZA 3GXQA 2PC6A 1BDVA 3FMTA 1B28A 3BKTA 2CA9A 4D8JA 2CAXA 2BNZA 3VEBA 1Q5VA 2AY0A 2BA3A 2BJ1A 4ME7E 1QTGA 3QSIA 2FGCA 2WVCA 2HZAA 2CPGA 3QOQA 1PARA 2WVDA 1MYKA 2GPEA 2JXHA 2JXGA 1IRQA 1ARQA 1MYLA 1X93A 2BNWA 2CADA 3BKUA 2H1OE 1Q5YA 2CAJA 2WVFA 4HV0A 1EA4A 1ARRA 2JXIA 3VEAA 2KELA 2WVBA 1MNTA 2RBFA 2HZVA 2NZCA 3OD2A 2BJ8A 2F1FA 1B01A 2BSQE 3VW4A 1BDTA 4FXEA 2K9IA 2K29A 3BKFA 2BJ9A 2BJ7A 3PHTA 2K5JA 2K6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3Y A;  2WVE A;  3LGH A;  3H87 C;  1U9P A;  1NLA A;  2BJ3 A;  1P94 A;  2K1O A;  3FT7 A;  1BAZ A;  3GXQ A;  2PC6 A;  1BDV A;  3FMT A;  1B28 A;  3BKT A;  2CA9 A;  4D8J A;  2CAX A;  2BNZ A;  3VEB A;  1Q5V A;  2AY0 A;  2BA3 A;  2BJ1 A;  4ME7 E;  1QTG A;  3QSI A;  2FGC A;  2WVC A;  2HZA A;  2CPG A;  3QOQ A;  1PAR A;  2WVD A;  1MYK A;  2GPE A;  2JXH A;  2JXG A;  1IRQ A;  1ARQ A;  1MYL A;  1X93 A;  2BNW A;  2CAD A;  3BKU A;  2H1O E;  1Q5Y A;  2CAJ A;  2WVF A;  4HV0 A;  1EA4 A;  1ARR A;  2JXI A;  3VEA A;  2KEL A;  2WVB A;  1MNT A;  2RBF A;  2HZV A;  2NZC A;  3OD2 A;  2BJ8 A;  2F1F A;  1B01 A;  2BSQ E;  3VW4 A;  1BDT A;  4FXE A;  2K9I A;  2K29 A;  3BKF A;  2BJ9 A;  2BJ7 A;  3PHT A;  2K5J A;  2K6L A; 
#chains in the Genus database with same CATH topology
 4PYA A;  1JJ4 A;  2FJV A;  5A2Q U;  1Q8I A;  3AJ2 A;  1VR6 A;  5B0C A;  3MEG A;  3V6H A;  2QL7 B;  1HQ2 A;  2MST A;  3LP0 A;  2KKH A;  3RUB L;  1HPZ B;  2Y1I A;  1FDD A;  1QVG R;  1IUJ A;  1RT7 B;  1NK9 A;  1TP7 A;  2O1P A;  2H5I B;  1GTH A;  2XGP A;  1U45 A;  2VBX A;  1TMJ A;  3UDV A;  1N33 J;  1RIS A;  3NWG A;  2IYG A;  5FLX Y;  2CQB A;  2AP6 A;  3TX0 A;  1S76 D;  1G2E A;  1RYR A;  2Z56 B;  2W2P P;  5KFU A;  2KXH A;  5I42 A;  3C14 B;  3LQV A;  2CQ0 A;  3OUY A;  2VF3 A;  3EZ5 A;  2MKY A;  1IBK F;  4ZPV R;  3DLE A;  4K4T A;  1Y5L B;  2DGS A;  4JV5 F;  4PUO B;  1HI1 A;  4IG0 B;  3JYT B;  1Q7L B;  1ICE B;  4KH1 B;  1D0E A;  1NJX A;  1HNV B;  1VK3 A;  4B3S F;  1YJ7 A;  2O5D A;  4QR1 A;  2V8H A;  2P6S A;  1Q53 A;  2P8I A;  3NNH A;  4YB6 A;  3DRR A;  4M94 A;  4I1T A;  2KRR A;  2DGU A;  2FTR A;  1CG2 A;  2WHO A;  2XS2 A;  3CDE A;  1RWU A;  1WC1 A;  1T02 A;  3RB3 A;  3D54 A;  3GFY A;  1BY9 A;  2IVY A;  2C42 A;  4P73 A;  2VOD A;  1FRX A;  4J9K A;  3QAT A;  2WAQ D;  1NJZ A;  2VG5 B;  4NAS A;  2XZT B;  2MYF A;  3GCX P;  1TUV A;  3R5G A;  4Q8E A;  1WOS A;  3NEK A;  3W5X A;  3TQE A;  4FZV A;  3HSD A;  2XB2 D;  4A4J A;  1SL2 A;  3B4M A;  4PYD A;  1ZM2 A;  2AW0 A;  2CAJ A;  1JXV A;  4L3N A;  2GHW A;  2ZNY A;  1RA7 A;  2VB6 A;  3MAA A;  1VQ5 S;  1FJG J;  1U8S A;  2RRB A;  4G1I A;  2W9B B;  2UXD F;  2HZV A;  5HSP A;  1P27 B;  1HMV A;  2QLJ B;  3JB9 k;  4TXS A;  1A0O B;  1VJW A;  1N8R T;  1FXL A;  3VAJ A;  3R5A A;  3NNE A;  1REV B;  4ZPC A;  2E9T A;  1U6B A;  4OJH A;  2GJF A;  4I64 A;  2OFG X;  3TYT A;  2K6L A;  3H2U B;  2AJ4 A;  4IFV B;  1OSC A;  4LR7 A;  3M2R A;  2KKE A;  2E1P A;  2DB1 A;  1X9M A;  1GMU A;  4LF7 J;  4ECT A;  5H9E K;  5ETO A;  1S6U A;  4G1Q A;  1SQG A;  1U4B A;  4X4R A;  4F36 A;  3DDN A;  3HT0 A;  2OD6 A;  3MUM P;  1S7H A;  3MGJ A;  4PXD A;  4QYZ J;  2OUG A;  4DOZ A;  4URQ U;  3HF5 A;  3W3S A;  2ZWP A;  3FEZ A;  3SZ2 A;  5AXK A;  4U9R A;  1UAW A;  2CJ9 A;  2QGF B;  2M9K A;  2KM8 B;  3CO0 P;  2ZZT A;  3MCM A;  2FC8 A;  1N32 F;  3CCT A;  3M6W A;  1RBA A;  3FSX A;  1TUW A;  2C3Y A;  3IR5 B;  3OL8 A;  4PRF A;  2HIQ A;  1FHT A;  1NU4 A;  1RKJ A;  2H3E B;  2QV6 A;  2R8I A;  2BUN A;  1HQU A;  3TJA A;  4DF4 A;  5DM7 Q;  4KGX B;  4B9S A;  4A48 A;  2XSJ A;  3V6D A;  3RBE A;  1S5Z A;  1R0A A;  1ELO A;  3CCJ S;  1VQL S;  3FCH A;  1J27 A;  2WCX A;  3R7N B;  3KXD A;  3GR0 A;  1XEZ A;  4MAK A;  3H98 A;  1CBK A;  1N5S A;  2Z2M A;  4X84 A;  2H9Z A;  2ZBC A;  2RIJ A;  2CPF A;  4JP8 A;  1IKV A;  3BGR B;  1FK9 B;  4JI8 J;  5IM0 A;  4I6Y A;  2MLX A;  3S7R A;  2Q79 A;  2HNY A;  3MEE B;  4LSN A;  1YRT A;  2GVD B;  5HMX A;  2MKJ A;  1MN9 A;  5C42 A;  1T9U A;  3T41 A;  2IBO A;  1R0C B;  4LSZ B;  2DK2 A;  2ASL A;  3TVZ A;  4OHZ A;  2UUA J;  4F0K A;  1LWC A;  3I32 A;  2GQ2 A;  2HHH F;  1KHW A;  1MYL A;  4J9Q A;  1U1R A;  2MQQ A;  3DLK B;  1Q79 A;  4ZHR A;  1KD1 T;  5E3Q A;  3CIZ A;  3SFU A;  2BE9 B;  3HVT A;  2OO4 A;  2A2D A;  3G87 A;  5KTQ A;  8RUC A;  1F0X A;  4OX9 J;  3OHA A;  4DV6 J;  4DDF A;  4PCQ A;  2ZOF A;  1T3O A;  2G4B A;  1SV5 A;  3EGV A;  3UVJ B;  2UVU A;  4IRD A;  1VBK A;  4MKV A;  4DL6 A;  4QU6 A;  3NRB A;  1UWA A;  4QWD A;  1U0S A;  2H51 B;  1RTH A;  4ZOS A;  2OKQ A;  2K1O A;  1TTH B;  2JEG A;  1PAE X;  1XR7 A;  2UV8 A;  2EK1 A;  2PGC A;  1SKW A;  4WFX A;  5HJY A;  1R8A A;  2R7V A;  3I5A A;  4CI0 B;  3PM9 A;  1DRZ A;  2AV5 A;  5DDP C;  4QJV A;  3PYF A;  4UOF A;  5CD4 A;  3RGI A;  2HLU A;  1NK4 A;  3OXG A;  4F2R A;  2WOM A;  1N52 B;  4ZVF A;  1QY7 A;  4AUK A;  1GAO A;  5K8O A;  3GPA A;  3X3U A;  5ETN A;  2MQP A;  2NSC A;  3C6T A;  5KFZ A;  2W1B A;  3KG1 A;  1RHR B;  4ALZ A;  3F0N A;  2KJW A;  2GQQ A;  1K44 A;  1X31 C;  1XMQ F;  1UW9 A;  3E8O A;  3EVO A;  1LW2 A;  2BQR A;  3EDR B;  5DZ7 A;  3AHP A;  3QGP A;  4LMZ A;  4DU7 A;  4HAC B;  4HTI A;  1F5A A;  3G96 A;  2DNN A;  2Y8Y A;  3Q8S B;  1FRJ A;  4WWS A;  4C8O A;  3NGK A;  2BX6 A;  4FF4 A;  1U0H A;  5D8H B;  1KLN A;  1WTF A;  3IG1 B;  2CZ4 A;  4HDH A;  2YX7 A;  4E8U A;  4Y2I A;  2C3P A;  3NGS A;  4UOC A;  5HLF A;  1DFD A;  3TZW A;  2BNZ A;  1NDP A;  4FNH A;  5ADZ A;  4F67 A;  3PRB A;  1YDL A;  4ZDN A;  4ZJL A;  4WYW A;  2M0G B;  4L76 A;  1AXQ A;  2YNH B;  3KLV A;  4J9V A;  2Z4P A;  5B0F A;  2B7B B;  2JXG A;  2D3Z A;  4DV7 F;  4A8Q A;  5K8N A;  1QUV A;  2B8P A;  4RW9 A;  1YQH A;  4ZLL A;  3BPD A;  5DQH A;  1KLM B;  1TFW A;  4Q43 A;  4ICL A;  3KFW X;  4DUZ J;  3K5O A;  2YQ1 A;  4IRK A;  4KR0 B;  2E29 A;  4F4Z A;  2JL9 A;  3IWL A;  3CO9 A;  2AJ1 A;  2VH7 A;  4Z37 A;  3M8Q B;  3ADA C;  4ZJQ A;  3ZZU A;  2VG6 B;  2K29 A;  4FN5 A;  1DTQ A;  4CO3 A;  4YS2 A;  4ILL A;  4IRC A;  1SIW A;  4U67 Q;  3M2U B;  5A8R A;  2Z57 B;  5IQQ A;  1NPK A;  2B9W A;  1Y4Z B;  3ONQ A;  3NAI A;  3KDO A;  3D7S B;  2CA9 A;  2LCW A;  4KYZ A;  3TJ9 A;  4Z2X A;  2HHU A;  4U7U K;  1RB0 A;  2HK3 A;  2MQ8 A;  1TKZ A;  2RHS B;  1BQN B;  3P5T L;  2ZKU A;  1LXN A;  2OHD A;  2DH8 A;  2WVC A;  9ATC B;  4AE5 A;  2C2N A;  1SUQ A;  2FZG B;  4CLL A;  5HBM B;  4OHX A;  1TKX A;  1FO1 A;  4M5G A;  2G2O A;  5EWG A;  5DLG A;  1HL6 A;  1LQ9 A;  2WVF A;  3VR1 A;  2GIF A;  1X4D A;  2BE2 B;  3OHB A;  3VGV A;  4M95 A;  2F1F A;  4E98 A;  4O44 B;  4ETZ A;  4NLR A;  3PY8 A;  1REG X;  2EFQ A;  5J2N B;  1YJ9 S;  3SV4 A;  5KFD A;  3SV3 A;  4YQW A;  2ZZN A;  1IJE B;  4PKD B;  4OZ2 A;  4PG6 A;  2Q6C A;  2FIU A;  1L3S A;  3KK2 B;  2R7R A;  3M30 B;  3GYG A;  1PJ7 A;  3R6G B;  3RAQ A;  4Y2M A;  5FDL B;  2J5A A;  1V5V A;  4R0E A;  5U47 A;  4BLG A;  4UF4 A;  4R0J A;  3FEY B;  5LJ3 Y;  3L3C A;  1PIE A;  3IR7 A;  2XWY A;  1VIO A;  3CT9 A;  1U1Q A;  4I2Q B;  2B6A A;  5F0U A;  1OIA A;  4MIW A;  3DGP B;  1P9Y A;  1PYS B;  1VC6 A;  3SDE B;  1GXL A;  2V2V A;  2V2K A;  2MZR A;  3K8V A;  4X62 F;  4P75 A;  2X3G A;  5KT5 A;  4AD6 A;  5HK4 A;  7FD1 A;  4C8N A;  4P7T A;  1I6J A;  2LFV A;  4LSL B;  3I87 A;  3VWS A;  3H42 A;  5AE1 A;  2VFU A;  2R7S A;  1WUU A;  2I5J A;  2K5J A;  2V50 A;  1L3U A;  2BJ3 A;  2VBY A;  1S1U A;  2E9R X;  3G6E S;  2VJU A;  3TA1 A;  5GAG I;  3CC4 S;  1RWW B;  2LYV A;  2XI3 A;  3Q24 A;  1JQG A;  2RJZ A;  3VEB A;  3BRE A;  2R2U A;  2Z30 B;  3S1T A;  5I3Q A;  2FJA B;  2BAN B;  4M5D B;  2P6T A;  2FY1 A;  3QLH B;  2ZE2 A;  4NI2 B;  3UDE A;  4Q5V A;  5F8L A;  3CJ0 A;  4G3I A;  4ZVG A;  1YIJ S;  3U1M A;  4ZVE A;  2PO4 A;  3KWM A;  4KIA A;  1IRQ A;  2CJB A;  1JXE A;  1LW0 A;  1QM9 A;  1MN7 A;  4MJW A;  2B4U A;  3A3O B;  3PX6 A;  3V6J A;  1C1C B;  2NXJ A;  3I6P A;  5KFW A;  4U7U D;  5JVH Q;  2RKI A;  2DIV A;  4IOC Q;  3C6U A;  4LF8 J;  2BM0 A;  3MMB B;  2PEH A;  5E33 A;  1H73 A;  1RAG B;  2XM3 A;  3ZZO A;  3ZZP A;  3BYR A;  1N48 A;  5GME A;  4OZL A;  1Q86 T;  5D15 A;  1OYD A;  4QYZ K;  3HDS A;  1PBU A;  1U48 A;  1BDV A;  5AE2 A;  2VU5 A;  3D2W A;  4ECY A;  4EO6 A;  1F5B A;  2W7P A;  4V1A k;  4LRA A;  3IR6 B;  4DN0 A;  3BQ0 A;  3GLJ A;  3I4P A;  4JB8 B;  2R7U A;  1LWX A;  5JJB A;  2IDE A;  3CCL S;  3OR1 B;  2ZVI A;  4TKT A;  4WK3 A;  1VBX A;  3D4J A;  3CGI A;  5LT5 A;  2MLZ A;  1IQT A;  4ID5 B;  1XWL A;  4HEA 9;  3T1Y J;  1RHK B;  2DNZ A;  3C46 A;  2HHV A;  3JAM U;  2WBR A;  2R7X A;  2D9P A;  3MM7 B;  3POT A;  1FKO B;  1ZAX A;  2H4Y B;  5BR8 J;  1SBR A;  1F3F A;  3QAU A;  4PQU B;  3J7Z T;  2EFN A;  1CJU B;  1WC3 A;  3JS9 A;  5LXY A;  3VAF A;  3MR6 A;  2J0W A;  3T6B A;  1VBY A;  1S1V A;  2L9D A;  3PR4 A;  4NWB A;  5ETL A;  4K2J A;  3HJV A;  2OFH X;  2YWW A;  3Q22 A;  4NRU A;  2RML A;  5KFO A;  4EK2 A;  2YNF A;  3GG0 A;  1NUE A;  2ASD A;  5DQG A;  1I51 B;  4Y3C A;  4ED7 A;  4DV0 J;  2DXE A;  5KT3 A;  3OSN A;  3ETM A;  1X9W A;  5IOL A;  1PJ6 A;  2DNR A;  1RQ0 A;  4JV1 A;  4DUY F;  1IWG A;  4QZV B;  3H4B A;  3UR3 C;  3ILO A;  4OYX A;  1KQF B;  2RF2 B;  4F25 A;  2PD1 A;  3NNC A;  2RRN A;  1HNX F;  3MR5 A;  4NLS A;  4DPT A;  1SCJ B;  3OFF A;  3K58 A;  4WII A;  2IC3 A;  5B0D A;  4EYI B;  3O2I A;  2HND B;  2YPY A;  5AJ3 J;  2VPY B;  2Y1J A;  4LF1 A;  2ROG A;  4BC9 A;  1R8B A;  1D09 B;  1T9Y A;  1LV5 A;  1VRT A;  1KNZ A;  3DRX A;  5JXS A;  4CYU B;  5A6W A;  3IWN C;  3M8R A;  4FF2 A;  3CD0 A;  4OZJ A;  2A6M A;  3D0H E;  3QGH A;  1AZS B;  3AOA A;  4KKO A;  2DO0 A;  3SI8 A;  3A8K A;  2JX2 A;  4Q45 A;  1T03 B;  4P7V A;  4NXN F;  4H4O A;  3BSN A;  3HHN B;  2KT5 A;  1RTI A;  4NLP A;  2LDY A;  3Q2T C;  1FXD A;  4ZVT B;  4ERD A;  2DNP A;  4IR1 A;  1HYS B;  1IN0 A;  2HBR B;  1MMD A;  2P9E A;  1X9S A;  1DJ0 A;  1XQI A;  2HBQ B;  4UY8 5;  2GV1 A;  4OZ5 A;  2JXH A;  1KDN A;  1F60 B;  1DTT A;  1GK8 A;  2DHG A;  1VRQ C;  2GO8 A;  2RQC A;  2UVW A;  2FJW A;  3MEG B;  1RAH B;  3G82 A;  1ARR A;  4OFZ A;  1N36 J;  4QR0 A;  4NZ6 A;  3LP0 B;  1WKK A;  4EU0 A;  1LK7 A;  3OVB A;  1ZBT A;  2W01 A;  5L46 A;  4I7F B;  2WK4 A;  1HWL A;  4DR6 J;  1HR0 F;  1JJH A;  2BE7 D;  3MPD A;  3UD4 P;  2XZW A;  4K4U A;  1KOH A;  1D8Y A;  1PKU A;  5I42 B;  2ABY A;  3NG8 A;  4DSE A;  3CD5 A;  2FJD B;  3OUY B;  2UUB J;  4KTQ A;  3DLE B;  4QQB A;  2B9E A;  1H6K X;  2JDJ A;  4PG8 A;  2DEI A;  1UL3 A;  4ILM A;  3IGV A;  1F1B B;  3O44 A;  2K3K A;  1RUS A;  1LWF A;  3LPE A;  4B9U A;  1MML A;  4LRF A;  3DCA A;  3D1Q A;  5EWF A;  2ZM6 J;  1FFG B;  5IT9 U;  4MYT A;  1TL7 A;  3TA2 A;  5I3U A;  3KJV A;  3WX4 A;  3DRR B;  3VAK A;  2CQH A;  2KU7 A;  3RYL A;  2DRB A;  1CS4 A;  3DLG A;  2IA6 A;  4EZ6 A;  4LQ3 A;  1JJC B;  3EGN A;  4MKA A;  7AT1 B;  3ZO7 A;  2JSX A;  3KYL A;  1G7C B;  1RWK B;  2WVB A;  3P45 B;  2V94 A;  5KT7 A;  1NZ8 A;  3CPW R;  4P2S A;  1S6O A;  4MT1 A;  2JEJ A;  3NXZ A;  4ZA1 A;  5KFG A;  3W5Z A;  1UWB A;  4PPD A;  4HYK A;  4A8Y A;  2F65 A;  2KHD A;  1UA0 A;  2VIC A;  2UZA A;  4AYB D;  2KJV A;  4WE1 A;  2LQJ A;  4Z7Y A;  2ZJQ Q;  1Q8K A;  1HWJ A;  3A8E A;  4CO0 A;  1BMQ B;  2E1C A;  2ZZM A;  2RE1 A;  3MAA B;  3DRY A;  1YK9 A;  2RQM A;  3KJN B;  2CG8 A;  3V5R A;  1ROF A;  5BJR A;  1HMV B;  2BJ1 A;  5A0Y A;  1B99 A;  4F0M A;  3THV A;  3OVS A;  3KUH A;  3V4I A;  1ZOT A;  5B0G A;  2DR6 A;  2R2S A;  3CJ4 A;  3GJS B;  5CYJ A;  4JI6 F;  1BGX T;  4GKK J;  1NH7 A;  2K7J A;  3K8W A;  2MQM A;  1AUD A;  1KTQ A;  2XQC A;  1MG7 A;  3M2R B;  2ZDO A;  2YX1 A;  3DDI A;  4DV4 F;  4G1Q B;  2M88 A;  3NCR A;  3N79 A;  1WF0 A;  2B8Q A;  4K4W A;  3AXM A;  2JVR A;  1QSL A;  4HR2 A;  1XR6 A;  3W9I A;  3PX4 A;  4UOG A;  3K5N A;  1YJV A;  5AXL A;  2YKQ A;  4CM0 A;  2D3O 1;  2WVE A;  1FF2 A;  4WKY A;  2V2Z A;  2YNG A;  2QMU B;  2UVV A;  2FHM A;  3DHX A;  3R5D A;  2OEM A;  4OI3 A;  3BH7 B;  4C9D A;  2XY5 A;  1Q78 A;  5L1L A;  5AE3 A;  1Y7P A;  4DL7 A;  2V0N A;  4QYR A;  1IKY A;  3J81 Y;  4FYW B;  3TA0 A;  1HQU B;  5GVQ A;  2YWG A;  1KFS A;  1IBK J;  3K59 A;  2V8V A;  2XSJ B;  3V6D B;  1R0A B;  2IRU A;  4ZPB A;  5KT6 A;  4OV6 A;  3A8I A;  3GSI A;  5HAT A;  2ZWO A;  2V9W A;  1OS5 A;  2J7K A;  4B3S J;  5F8G A;  1SH3 A;  2QLF B;  3PHE A;  4BHQ A;  2JJ4 D;  1M0S A;  1Z4U A;  3DDK A;  1IKV B;  1TFY A;  2A6O A;  3KK3 A;  5IM0 B;  5CQG A;  1C1B A;  3PFE A;  3SMZ A;  1UFW A;  2KVQ E;  4RNH A;  2HNY B;  4LSN B;  1TV6 A;  2AMC B;  1LNQ A;  5C42 B;  3MHY A;  5FJ4 A;  4F7V A;  1B3T A;  2QYC A;  2RH3 A;  2L9W A;  2M7S A;  1UCN A;  2KZM A;  8ATC B;  1NB7 A;  4CCH A;  5K14 A;  1LWC B;  4LFB F;  4HI1 A;  2FD2 A;  1JK9 B;  5F8J A;  2E1A A;  2EG2 A;  3TI0 A;  4LRD A;  3T19 A;  2Y8W A;  4ZHR B;  5J2M A;  2MKC A;  2MZS A;  3HHL D;  3HVT B;  3UD5 A;  3D3C J;  1FE0 A;  3D1O A;  2V68 A;  5DRK A;  4FYD A;  4R8U A;  4DV2 F;  4O4R A;  1SV5 B;  4U8Y A;  5AT1 B;  2BYC A;  4NZ7 A;  1FJE B;  4KGV B;  4BWJ A;  4ZIT A;  4OZ0 A;  3V6K A;  4J9O A;  2A18 A;  2CNO B;  4UT4 A;  2UXD J;  2WTF A;  1BQX A;  5GAE U;  2DPJ A;  2MKH A;  1RTH B;  2OH2 A;  3G8S A;  2FB0 A;  1SH2 A;  2E7W A;  3AOB A;  4AT1 B;  3W65 A;  4C3L A;  3N01 A;  2VD3 A;  3KLG A;  2AYM A;  2JNJ A;  2XSF A;  2BBE A;  1WOO A;  1NPP A;  4DR2 F;  1AW0 A;  3KHL A;  1U1P A;  1RE1 B;  4ZN1 A;  1UZH A;  2OTL S;  3OJS A;  5HRO A;  2J0X A;  1O8B A;  2WOM B;  1WDD A;  3NAH A;  2D3U A;  4K4X A;  3NWR A;  1KP6 A;  2HHS A;  4ED0 A;  4G65 A;  4ECQ A;  1XNQ F;  3GIJ A;  1ZZF A;  4UST A;  3U1L A;  1RWP B;  1T3N A;  4TLR A;  3ZXW A;  2RVJ A;  1N32 J;  3CE8 A;  1YRU A;  1RAI B;  4NMX A;  1WNE A;  1LW2 B;  3BO3 A;  2FHO B;  5C7P A;  2FVR A;  3PEH A;  5M2R A;  2LXI A;  5C25 A;  1ZAW A;  4LIR A;  1KQS R;  2ZNZ A;  3C8Y A;  2MZ1 A;  4GVB A;  4PXE A;  3KLI A;  4DSL A;  3TAP A;  1U0H B;  7FDR A;  4EO8 A;  1C0T A;  1BUX A;  1T9V A;  3CDB A;  1D9F A;  1U8W A;  2DNL A;  5HLF B;  2ACY A;  1X5P A;  4URS A;  2KT3 A;  4NZ0 A;  1ZAV A;  4DI6 A;  2QZ8 A;  3IBW A;  3ZTP A;  5ETV A;  4L73 A;  3NLC A;  3CNQ P;  2F9D A;  1G4C A;  2F8M A;  2DHH A;  3T5H A;  4IOB A;  1DQ8 A;  1X8D A;  5DLF A;  5ETQ A;  2HWH A;  3AB4 B;  3LA0 A;  2ZVS A;  1RAO A;  2U1A A;  2AGQ A;  2AEJ A;  3P5B P;  4RW9 B;  5SZT A;  1WHW A;  5L9X A;  1FVS A;  4E0D A;  2DIS A;  1JLB A;  3MXH P;  5CA5 A;  4N41 A;  1C2P A;  3BV8 A;  4OI2 A;  2HHH J;  1KVJ A;  4ICL B;  2IJF A;  2FHJ A;  1KC8 T;  4JI7 F;  2NXN A;  1FRH A;  2R4F A;  3OFG A;  3W63 A;  4Y2K A;  2QFJ A;  4NXM J;  3R9L A;  3PXG a;  1DTQ B;  2F5G A;  2HFN A;  4H4K C;  1SIW B;  5KFF A;  5A8R B;  3QIP A;  1UW4 A;  3WDO A;  3PW2 A;  3B78 A;  1RZM A;  3UCU P;  3FBB A;  3HT3 A;  4USI A;  3MR3 A;  3CJS A;  1TKZ B;  2KN4 A;  1HFE L;  5LM7 E;  1ITP A;  4ECX A;  4EBD A;  2A2B A;  1VIS A;  1QJH A;  2KZZ A;  5IS2 A;  4CP5 A;  2K3I A;  3F44 A;  2I2Y A;  1SUQ B;  4DQR A;  5D3G A;  2BXJ A;  3ZZT A;  1NDK A;  2JC1 A;  1TKX B;  3WHI A;  4QIE A;  3BM7 A;  2IA0 A;  1ZPW X;  4NLG A;  1T9X A;  2EWH A;  5M2P A;  1R8C A;  2VG7 A;  3BF4 A;  2M70 A;  2AZ1 A;  1Y5N B;  2XS5 A;  4BWM A;  2NXU A;  3THT A;  4B9T A;  3MEE A;  4FNI A;  1XMQ J;  4B3R J;  4ZLJ A;  5E5N A;  2MY8 A;  3JSR A;  2I8E A;  1S0M A;  4B08 A;  1LWE A;  3ENV A;  2J0Q D;  5A8W A;  5ETR A;  2HNZ A;  2VC0 A;  1JX4 A;  4HKQ A;  1L3K A;  2CUY A;  1F9F A;  3BB5 A;  3DYA A;  3VQS A;  3A13 A;  2PSZ A;  2HGM A;  1Y9O A;  4ZVP B;  3US5 A;  4LQ9 A;  5HVH A;  3LWM A;  1Q16 A;  3JTO A;  2GW8 A;  2HMI A;  2YH0 A;  3KUE A;  1UVK A;  3FT7 A;  1KQG B;  1URR A;  1IM4 A;  1SJ3 P;  5DJB A;  3IR7 B;  1VFJ A;  2E5H A;  4A47 A;  1IKX A;  2OGU A;  2HEK A;  3LAN A;  4UTG A;  3SQG A;  4USM A;  2KFZ A;  4DV7 J;  2QSF A;  1CPZ A;  3Q0A A;  2XLI A;  3LJP A;  2RUS A;  1SJQ A;  3QBC A;  3TZX A;  2D74 B;  2GPE A;  1CQN A;  1EAY C;  2I5J B;  1JLG A;  1S9E A;  4HI2 A;  3FBF A;  3BGO P;  5KG5 A;  2BNW A;  2VON A;  1UA1 A;  1JNZ B;  3PJ9 A;  5DDR C;  2DHS A;  3D6M B;  3LGM A;  1S1U B;  2C28 A;  2GIR A;  3GON A;  1N4L A;  1EP4 A;  1K1S A;  3DRP A;  2DY9 A;  1KTV A;  3R3T A;  1HNI A;  2GHV C;  1VMB A;  1Y00 A;  2G0C A;  3KHR A;  5HVF A;  1HWU A;  2IAJ A;  2G2Z A;  2ZE2 B;  3W2V A;  2ROE A;  1XIQ A;  4WKR A;  2OIH A;  3FEX B;  3V4M A;  3CME S;  1U2R A;  4B17 A;  1P6T A;  3GXQ A;  3HUL A;  1H98 A;  5F41 A;  3BN7 A;  1OPZ A;  2JEI A;  1VCT A;  2ZH8 A;  1LFW A;  2RKI B;  5F9N A;  1G1X A;  5E2Q A;  4Y28 C;  1NEE A;  3C6U B;  4F4W A;  1HHS A;  3LWL A;  3D5M A;  1NK0 A;  5LMN J;  2NXC A;  3CW2 C;  5BYR A;  4UOH A;  2COL A;  1UEV A;  2DR5 A;  4N5S A;  3GSD A;  4QOT A;  4DPU A;  1NH8 A;  2ASJ A;  3I56 S;  2B7C B;  4RU2 A;  3D6T B;  2E66 A;  2PA3 A;  5KFK A;  4ATN A;  1B7Y B;  2K06 A;  2N7C A;  2BA9 A;  3R5B A;  3OT9 A;  3RZA A;  4JI4 F;  2DRD A;  3BBC A;  4ZKA A;  2WZ1 A;  2HWT A;  2C1E B;  3DOM A;  3AD9 C;  2ZBP A;  1NRK A;  4DF8 A;  4DBQ A;  3FSI A;  4K5S A;  1VBZ A;  5JMN A;  3POT B;  5L1I A;  2ZH4 A;  2E44 A;  2X1A A;  4NLU A;  5KFH A;  1PG5 B;  3NGU A;  4O4G A;  2MDA A;  2E5J A;  1HNZ J;  3BSC A;  1YHQ S;  4ME7 E;  2VBZ A;  2ZBR A;  3T6J A;  2RHQ B;  3AB2 B;  1S1V B;  4C0B A;  3KNG A;  1SQE A;  3B82 A;  5KG2 A;  3A1Y G;  2DYA A;  3PJX A;  3OVA A;  4X62 J;  3P4U B;  3G5O A;  1XER A;  2YWH A;  3TUI C;  2YNF B;  2E1R A;  2C2R A;  4AXI A;  1TQL A;  5GAH U;  2W2O P;  3BYP A;  2P9G A;  2C3M A;  1VQO S;  4PWW A;  4PG7 A;  4NLX A;  2MJU A;  3DN9 A;  2AYG A;  1RU2 A;  4QPX A;  1XTZ A;  3CF5 Q;  3RW7 A;  3HD1 A;  2CIM A;  4MKB A;  3NCP A;  5KFT A;  3MMA A;  2XNR A;  2FC9 A;  5L9N A;  2VQF F;  2MHE A;  3MF5 A;  4JI3 F;  2J9D A;  2C2K B;  1V3Z A;  1VDH A;  4ELV A;  3H2V E;  2OPR A;  2IC3 B;  3BKT A;  3BQ1 A;  2FY8 A;  1HLW A;  5E0O A;  4FXV A;  4OZ3 A;  2AGO A;  1SL0 A;  1UJ4 A;  2N7Y A;  3H5X A;  1S0N A;  4K4Z A;  2F63 A;  2HBY B;  4A8M P;  1VRT B;  3AAW B;  4F4Y A;  2UUC F;  4CRJ A;  1D8Z A;  2M3D A;  4MFB A;  2DH7 A;  1N5Q A;  2DHX A;  4KKO B;  4ZP8 A;  2FJX A;  2DGV A;  3MAQ A;  2IRY A;  2X1G A;  2R2T A;  4H4O B;  1RT1 A;  4F50 A;  5EDW A;  1RTI B;  3GFH A;  3E01 A;  2VZ9 A;  4KPY A;  1RAC B;  2OD4 A;  3IM8 A;  3T3F A;  1NJI T;  3E3X A;  4J9M A;  3G6Y A;  3I4H X;  1VHF A;  2FUG 9;  3IFE A;  3EIC A;  4OX6 A;  3FZ2 A;  4FYV B;  1S99 A;  3BO2 A;  3G6X A;  1DTT B;  3DXS X;  5B0A A;  1WC0 A;  3G82 B;  2XMM A;  2R8G A;  1RDR A;  1TK0 A;  3UDL A;  4C98 A;  5AXM A;  2DVI A;  4ID8 A;  1U7L A;  2ZH6 A;  4FXD A;  4HHJ A;  1X5T A;  4YME A;  1RWM B;  5ETS A;  3AH6 A;  3M2V A;  3GR1 A;  2RT3 A;  3C2P A;  2ZHO A;  2ADB A;  5E7O B;  2VJV A;  1UVN A;  4N76 A;  1CC7 A;  1HQE A;  1PO6 A;  3VGT A;  1J5O A;  4J9N A;  3H5S A;  2JEF A;  5DO2 A;  1MLA A;  3I9V 9;  3SIP B;  4DCP B;  3CMQ A;  2PA8 D;  1ZA2 B;  3D0I E;  1BD6 A;  5FD1 A;  2MKS A;  1RWN B;  3DGV A;  3GQC A;  1LWF B;  4LF6 F;  4N47 A;  2ZEJ A;  1U49 A;  5J1N A;  4JOU A;  2EC0 A;  4WIQ A;  2ILZ A;  2XZD B;  1R6V A;  1TL7 B;  5C24 A;  5I3U B;  3KJV B;  1R27 B;  4KSE B;  3CCS S;  5EWE A;  1CS4 B;  2HK2 A;  3DLG B;  5F9L A;  2M2B A;  4F4A A;  2V8P A;  2Q3P A;  4ZP9 A;  3NKY A;  1HNX J;  2VL1 A;  2MGZ A;  3VVU A;  2GC8 A;  2KI2 A;  1I3O B;  1FD8 A;  4TY9 A;  4AND A;  3QYY A;  1RGV A;  1PAR A;  5LSO A;  5A6P A;  1EQM A;  2HBZ B;  2JBV A;  3R1L A;  5IV3 A;  3H90 A;  2VV5 A;  2VA2 A;  2DIU A;  1UWB B;  3BGU A;  2RRA A;  3O1L A;  2A1B A;  1OSD A;  3HJF A;  1RKI A;  1SIZ A;  2LA4 A;  2H1Y A;  4WE1 B;  4QWC A;  1IM6 A;  2VDH A;  4P6Q A;  4LIW A;  3EVM A;  1R8H A;  4B3O A;  3QO9 B;  4LF4 F;  5A0Y B;  4ZCK A;  1LEO A;  4C11 A;  4NXN J;  1M5H A;  4I67 A;  3V4I B;  1VQK S;  2GAH C;  3Q8R B;  2RDD A;  2QIF A;  2LQ5 A;  1NLK L;  2VA3 A;  1GTE A;  3K5M A;  3THP A;  1N5Y A;  2X3D A;  2JFD A;  2CVE A;  2J76 E;  1M5V C;  2CAX A;  1GXT A;  4DL5 A;  2V4Q A;  3SCI E;  4CLF A;  1YBA A;  2BV3 A;  2J6U A;  4M5L A;  5HAO A;  2R7T A;  2BA3 A;  2LEA A;  1KS2 A;  3F73 A;  2IM3 A;  4I69 A;  4LRC A;  2FPH X;  2HHQ A;  5DG9 A;  4KQZ A;  1VC0 A;  4QW8 A;  2DY1 A;  3D6H B;  3MR2 A;  3PO4 A;  1YIT S;  3RRH A;  3RB4 A;  1WEZ A;  2YNG B;  4IH7 A;  5J1P A;  1IBC B;  1HR0 J;  3FJ2 A;  4I56 A;  3IA0 A;  1FD2 A;  2HFO A;  1F9E B;  1RT4 A;  3EWG A;  2F8H A;  2NZC A;  1IKY B;  4LF5 F;  3QNW B;  4WCE Q;  1H7W A;  2OPQ A;  1PJ5 A;  5EX3 A;  1S6P A;  2K9I A;  1OPI A;  2ZBQ A;  4X64 F;  1HBM A;  1NZA A;  5HMY A;  1AA1 B;  1NLA A;  3DNC A;  5E3C A;  5KG6 A;  2ZJP Q;  4KGM A;  1K0T A;  3QWU A;  3PIO Q;  3HP6 A;  2OEK A;  2VKZ G;  1AZS A;  4RW6 A;  2HPU A;  2C2M B;  3VVT A;  4CO5 A;  3KK3 B;  1RU1 A;  1C1B B;  3MFH A;  3M8Z A;  3BPS P;  4MYU A;  2WSF C;  1WC4 A;  2FJB B;  2POK A;  1TV6 B;  3RAX A;  2GMJ A;  1FDA A;  4TN2 A;  5IQ6 A;  1UEU A;  3AQP A;  5LOQ A;  4DQP A;  1APS A;  5DG7 A;  3MM8 A;  3AJ1 A;  4TQS A;  3BBF A;  3W5Y A;  4DX8 H;  2CAD A;  3I31 A;  5K14 B;  3GIL A;  3MAH A;  3VF0 B;  4DV1 F;  3A12 A;  1NJY A;  1N0U A;  5J2M B;  1L3V A;  1B7F A;  5HO4 A;  3AXK A;  4IYQ A;  3PAC A;  3OD2 A;  1U26 A;  5D0G A;  3M9O B;  2I6W A;  1S4E A;  3SQO P;  4M5N A;  1RT2 A;  1MWQ A;  3M6V A;  3G86 A;  4R8U B;  3E51 A;  3T1H J;  1WG5 A;  3Q86 A;  1IQZ A;  4CO4 A;  2MPU A;  1X4G A;  2R8J A;  2PE8 A;  2ATC B;  3BO4 A;  3IBF B;  3QZ8 A;  4I7F A;  2CJA A;  4USV A;  3IN5 A;  3C66 A;  3OSP A;  5CXT A;  3SCK E;  3B8H A;  5F8H A;  3UQS A;  3NNA A;  5EN1 A;  1UMJ A;  4JI6 J;  1BHN A;  2Y1L B;  3TWZ A;  4DV6 F;  3N6M A;  4F8R A;  1TK8 A;  2AZ3 A;  3KLG B;  1D3W A;  3GZ7 A;  4DV4 J;  5RUB A;  5HRO B;  1XMO F;  4RW4 A;  2AWZ A;  3M05 A;  2DNH A;  1Q5Y A;  3EUN A;  4X4O A;  2OSR A;  3DM2 A;  1ZZN A;  4EBE A;  3MR7 A;  4YOE A;  4DPX A;  5IT4 A;  1NDL A;  3GIR A;  3HPO A;  4H4K A;  3QT7 A;  1MW7 A;  2YX4 A;  2FQQ B;  2LDI A;  3Q83 A;  2V6A A;  1PIL A;  3T1A A;  4YB5 A;  3QFW A;  3KG4 A;  3VGS A;  4JBC A;  4RU9 A;  2D69 A;  2ILY A;  5C25 B;  1SC4 B;  4DV5 F;  3BS9 A;  4X66 F;  2DNK A;  2UP1 A;  2AF6 A;  4GVB B;  3HHL A;  5GMK a;  5IFM A;  1YJN S;  3KLI B;  4OHY A;  4C8Y A;  1T9T A;  2VFS A;  2CYY A;  4HLB A;  4NLO A;  4D3H A;  3UPF A;  1C0T B;  4OQJ A;  1UVI A;  4QU7 A;  2Q66 A;  4G6V B;  1U47 A;  4J7C A;  5E3P A;  2AIR B;  3RW6 A;  4L3K A;  3VQT A;  1JLF A;  2HVH A;  3LP2 A;  5EX0 A;  2KFN A;  2CPD A;  3FC9 A;  3CC2 S;  3J80 Y;  3JSM A;  2AX1 A;  3LUY A;  4LVO P;  1DAR A;  4KBI A;  2CKW A;  2CNN B;  2N4D A;  1DUR A;  2CPX A;  1JWW A;  3VEA A;  4OIX A;  5JVG Q;  2K1R A;  2UU9 F;  1JLB B;  1FX2 A;  3U27 A;  4UY8 T;  4LFB J;  3BBB A;  5KFA A;  4RPF A;  1ACM B;  2DGW A;  4JI5 F;  2CQC A;  2VFT A;  4LRE A;  3UN5 A;  1HKA A;  2VQE J;  2NXE A;  3J7Y U;  2QA2 A;  4OJ3 A;  2VUG A;  1PC4 A;  3PEJ A;  3CCZ A;  1EKS A;  4DV2 J;  3QIP B;  1TKT A;  4JI2 F;  3UW1 A;  3OR2 A;  3ZNU A;  2QTW A;  2EI5 A;  1Q82 T;  4OX7 A;  2MB0 B;  4ZPD A;  4DUZ F;  3OFE A;  4YR3 A;  4UZB A;  2L3M A;  1WHV A;  2ZDP A;  3QT5 A;  3VCD A;  4ELT A;  3QSY B;  3SYZ A;  3TEH B;  1NPR A;  4NA2 A;  3HFV A;  1KKH A;  4I6A A;  8AT1 B;  4RUB A;  4CNZ A;  2XYH B;  3WIU A;  1IKW A;  1IBL F;  1NBE B;  1GMW A;  3HKW A;  2RU9 A;  5D3G B;  4TY8 A;  3J7Z 5;  4JI0 J;  4DR2 J;  1MU2 A;  3IAS 9;  2QT7 A;  4FVM A;  4GRS A;  5CYM A;  2HS0 A;  3DFE A;  2XTJ P;  1DAX A;  2QJ3 A;  4C2M A;  1M5O C;  1RK8 A;  2VG7 B;  1VQS A;  2HRU A;  1XNQ J;  3R5J B;  4B3T J;  1X60 A;  2HG4 A;  1JXL A;  1S49 A;  3CJ2 A;  1NDC A;  4YDX A;  2DH9 A;  3M6U A;  4QIG A;  4ILR A;  2H5J B;  1LWE B;  1OHN A;  4KPC A;  3DMJ A;  3DLB A;  2CQD A;  5A8W B;  2HNZ B;  4HL9 A;  1G3O A;  4NLV A;  4MIB A;  4PG4 A;  3H8Y A;  3TVK A;  3EMT A;  4LRV A;  4PXC A;  3NOG A;  3DYA B;  1SC1 B;  3QPI A;  1FWL A;  5K5M A;  1O51 A;  1QAY A;  1QVF R;  3LF0 A;  1JKH A;  3IS9 A;  2IVF B;  4W4M A;  1Q16 B;  3I5B A;  3RRK A;  2HMI B;  5CCL A;  3SCJ E;  2DT9 A;  4CLZ A;  2Q43 A;  3AOC A;  1RLD A;  2CJX B;  3PIP Q;  3CJR A;  3H5Y A;  1IKX B;  1Q0N A;  4ECS A;  3QFH A;  3SQG B;  3FQK A;  4MK7 A;  3FCV A;  4WF9 Q;  1VJQ A;  1BDT A;  1L5U A;  3RBX A;  2BJ7 A;  1UPM B;  1BC6 A;  1UVM A;  5MAO A;  2GHP A;  3DOK A;  1W7W A;  3X1L B;  3R8Y A;  1JLG B;  2JLE A;  3R5C A;  2CPE A;  2CNL B;  1S9E B;  4JI7 J;  4IQX A;  2C2D A;  2MEW A;  5KG3 A;  4ED1 A;  4C3M A;  1X4C A;  4O3N A;  2OEL A;  3HKZ D;  3VZH A;  3H40 A;  1W25 A;  3MD1 A;  4JI1 F;  4M5H A;  4P2X A;  2FHJ D;  5G0R A;  5J1E A;  1VQ6 S;  1EP4 B;  3DRP B;  1LFP A;  4ECR A;  1HNI B;  1BWV A;  4GMK A;  3AOD A;  2V34 A;  4C6A A;  1OY9 A;  2IAJ B;  1HBU A;  3L7P A;  4G1P A;  3UDC A;  4CO1 A;  3W2V B;  4OI6 A;  2IFX A;  2J6S A;  2KG1 A;  3Q8U A;  1TVR A;  4GVL A;  1KWM A;  2V4J A;  3PW0 A;  3DHW C;  2XY6 A;  2KEL A;  4NCB A;  3ZZZ A;  1RAD B;  5D0R A;  1NHK L;  1MSW D;  5LL6 d;  2C2E A;  5KFB A;  4KT0 C;  2BDP A;  5J2P A;  3M4X A;  2G1H A;  2RDI A;  1U9P A;  1SJ4 P;  3DLJ A;  4KV8 A;  1X0P A;  3M7V A;  5EGY A;  1T94 A;  1AUS L;  1U24 A;  1EJ7 L;  3AY0 A;  1Y0H A;  2XUL A;  1WHY A;  1R7I A;  3FRZ A;  4TQR A;  1KVK A;  4CO2 A;  2BJE A;  2W2M P;  3G2X A;  1PYO B;  3GYN A;  2FHK A;  4ES3 A;  3HVA A;  4ED4 A;  4L75 A;  4LVN P;  4DR3 F;  2YQ3 A;  2OI2 A;  2QYG A;  3DOM B;  4DSF A;  2FZC B;  1WG4 A;  4B9L A;  1NND A;  2WB4 A;  4IG3 A;  2R7O A;  3RU0 A;  2CDR B;  1Y5I B;  1HD1 A;  3ENW A;  4DR1 F;  3MZI A;  3UE2 A;  3PYD A;  3D28 A;  3ILI A;  1FDN A;  4DR5 F;  4O4G B;  1E6Y A;  4OJG A;  3ISN C;  3LP1 A;  2YWK A;  3BN4 A;  2PI4 A;  4URG A;  2XYP B;  4RR5 A;  4ELU A;  2MZQ A;  1QTN B;  3QZ7 A;  5DS7 A;  3ELH A;  2ZH2 A;  4PWU A;  5BR8 F;  3GII A;  3P8B B;  3CMA S;  3MPY A;  2HKE A;  2KOE A;  4EZ9 A;  2YH1 A;  1F9H A;  2O3D A;  4FP9 A;  1WWH A;  4ZVU B;  4F4X A;  4GKJ F;  5DET A;  1S0V A;  4X4P A;  4PQA A;  4ZP6 A;  1RBL A;  3R97 A;  2QA1 A;  3PX0 A;  4U8V A;  3PRV A;  1TMM A;  2WON A;  1O5J A;  2GJI A;  3HLU A;  4CLW A;  4DPY A;  3MMA B;  1HWK A;  3L7U A;  3LAL A;  1XC9 A;  1KHV A;  4M8L A;  1SL1 A;  2ZKT A;  4YR2 A;  3I0S A;  2W8L A;  1JLC A;  3HMJ G;  1FXR A;  1R89 A;  2G0I A;  1VQ7 S;  4DU8 A;  2OPR B;  2E7V A;  2E1M C;  4WYL A;  3CB4 A;  4MK8 A;  2J7W A;  5HL7 Q;  2MSS A;  5IT0 A;  1S79 A;  2IJR A;  4DHV A;  2W25 A;  4OJ1 A;  1CJV A;  1VQN S;  3B6B A;  4MFB B;  3GV8 B;  3OTD A;  5BYS A;  4D8J A;  1HA1 A;  3MEC A;  4Q8F A;  2JFK A;  2B0G A;  4P2F A;  4YP3 A;  4DQI A;  2IYI A;  1RAF B;  1RT1 B;  3KLH A;  1VQY A;  3J7A N;  1Q5V A;  4OZ1 A;  3CCW A;  1YX2 A;  3E01 B;  1HIY A;  2CQP A;  2E9Z A;  1I1G A;  3L95 X;  1QD1 A;  4C0O C;  1YSJ A;  1BQM A;  4PEO A;  3MPU B;  2YXL A;  4RNF A;  1WHX A;  3AQO A;  4TNO A;  1D9D A;  2MTL A;  2X1B A;  1G6B A;  1R8P A;  3NGT A;  4JI4 J;  4Y2A A;  4J9R A;  1S1X A;  3OXL A;  1Y10 A;  4NEY A;  3RBZ A;  2XMT A;  3FMW A;  2BW2 A;  3KK1 A;  1XNR F;  2CPH A;  4K5R A;  2EKY A;  2CQ1 A;  4YN3 B;  4I6W A;  1LOU A;  4KH0 B;  2HQF A;  3GIK A;  3M2V B;  5F3Z A;  4IOA Q;  1VQ4 S;  4RBT A;  4ZVO B;  1HQE B;  3GCW P;  2NUH A;  1J5O B;  1DLO A;  3HXM A;  2FLN A;  4TU8 A;  1N0V C;  1N36 F;  5HAN A;  4CLT A;  4DEZ A;  3P96 A;  3GV7 B;  5KFS A;  2Q6B A;  3VAG A;  5GAD I;  4B9N A;  4RX6 A;  1RTZ A;  1GEH A;  1T95 A;  5CYQ A;  3WZ0 A;  1UVL A;  1X4B A;  1L3T A;  2Z2Y B;  3OTE A;  1YGY A;  2MKK A;  1VS3 A;  4ED6 A;  2XI2 A;  3M1V A;  3QRP A;  5C24 B;  2B43 A;  4WU2 A;  1TKD A;  5HQL A;  3QWP A;  6FD1 A;  4I68 A;  2XMA A;  3ILJ A;  4PXB A;  1H7X A;  1XJW B;  3HX9 A;  4ZVR B;  3ZTS A;  1U09 A;  4ENO A;  3T5L A;  2NLW A;  2MGZ B;  1S77 D;  4KAI A;  4JI3 J;  1SJF A;  2B4P A;  4WFB Q;  2YWE A;  5HP1 A;  2DGO A;  3H4D A;  4RNM A;  4OYZ A;  4EBC A;  4DPO A;  1RT3 A;  1YJR A;  1T8E A;  1ZTW A;  2P2C B;  5LMU F;  2J7U A;  5THW A;  2JH3 A;  3Q2S C;  2F4V F;  4P10 A;  2UUC J;  3A3N B;  4HHU A;  2DNG A;  2KXF A;  1U1K A;  1OY8 A;  3CCU S;  1DQ9 A;  1QTG A;  4B3O B;  3DLH A;  4FBT A;  4L6V 3;  1XN9 A;  2XGQ A;  4WXW A;  4C11 B;  1H38 A;  4DZD A;  5LSR A;  5KG4 A;  3HSG A;  1WI6 A;  5GAE I;  2KO1 A;  4NCA A;  5FLX U;  2KDO A;  1M5S A;  2QL5 B;  3PFO A;  5D4L A;  4WZQ A;  1RAE B;  1N34 F;  3GJT B;  4YUD A;  1N5Y B;  2JXI A;  2EFO A;  3FBC A;  5HN0 A;  2IDL A;  4EEY A;  4NOH A;  5DDQ C;  4K7Q A;  3KHH A;  4DS5 A;  3A3P B;  2Z2Z A;  1PCA A;  1T11 A;  1NSQ A;  3SCL E;  2QG9 B;  2LQ8 A;  2Y9H A;  2EBG A;  2UUW A;  2CQG A;  2W7O A;  5KFR A;  2V8G A;  1ZM9 A;  5DGB A;  1GX5 A;  2XG8 A;  3MUR P;  1B28 A;  3IO1 A;  3K5L A;  2FJE B;  2WSC C;  1S48 A;  2F7V A;  2C22 A;  2HS4 A;  4U96 A;  4ZS6 A;  3R2C J;  1RT4 B;  2QMX A;  3JAM Y;  2HQD A;  2CZ9 A;  3R1H A;  1NSA A;  2XNQ A;  4CIO A;  1RT6 A;  2XMV A;  4QR2 A;  3W2W A;  2OPQ B;  1YJT A;  1S6P B;  4C8K A;  4HHH A;  1HBM B;  3DOL A;  1B0P A;  3B4D A;  3MMJ A;  2XCP A;  3NY0 A;  3R2D J;  2P5V A;  4USJ C;  3FSY A;  2HHP A;  3LW5 C;  5C2G A;  1U02 A;  2RUG A;  4LF6 J;  2IJN A;  1VQ9 S;  4KFB A;  1EET A;  3MI7 X;  4P74 A;  4RW6 B;  5DGA A;  5KFL A;  3GB0 A;  5KFY A;  4LFC F;  3TAQ A;  3TOQ A;  3TJ8 A;  1FCA A;  2J0S D;  4CLS A;  2E7X A;  3MM9 A;  3FQL A;  3KNA A;  2OTJ S;  2MQO A;  2FVP A;  2AYE A;  3J80 U;  2O66 A;  3FNN A;  4JV2 A;  3CDA A;  2VFV A;  2G0J A;  2KL8 A;  3MM8 B;  3SBM A;  4WP8 A;  3QAE A;  4QWA A;  1WSV A;  2B3T B;  5DDO C;  1FKP A;  2FVQ A;  2BOA A;  2EW9 A;  3WBZ A;  2ADL A;  3BGL A;  2QLX A;  4GO7 X;  2ASY A;  3EXY A;  3UCZ P;  1J5E F;  1F2H A;  3NS5 A;  4YFU A;  2BAC A;  1RA6 A;  2FYX A;  2V9K A;  3W66 A;  1RT2 B;  4X2B A;  4IH6 A;  1AYE A;  4MKY A;  4Q44 A;  3EVW A;  4LF9 J;  4OYO A;  2XLJ A;  4MTP A;  1NKC A;  3SSR A;  4C4W A;  1U6F A;  1X4H A;  1YVF A;  4LF4 J;  3GP9 A;  1FKA F;  4J37 A;  2C2Z B;  1FFW B;  3TEG A;  3NL0 A;  3HHE A;  2EEY A;  2QL9 B;  4Q0B A;  4ZMM A;  1TEL A;  3WC0 A;  1HHQ A;  4J90 A;  3LPY A;  4K0K F;  2V67 A;  4IDK A;  2UXB F;  4FYY B;  4HH1 A;  2V5H G;  1YI2 S;  4C7Q A;  2YPZ A;  3EZU A;  1X5S A;  3HZG A;  3ULH A;  4EUV A;  4KHP J;  1V3S A;  5K8M A;  1JJ2 R;  3W9H A;  2GML A;  4RW4 B;  2IY5 B;  4UUW A;  2AN7 A;  3UCG A;  2WB1 D;  2B4O A;  3I55 S;  2ZD1 A;  2A2C A;  3DM2 B;  2J9C A;  3MDF A;  4DLE A;  1S72 S;  4M5K A;  2HGL A;  4RJV A;  1SB6 A;  6FDR A;  3TUZ C;  3MFI A;  3T5J A;  2QN6 B;  1RT5 A;  2F3J A;  4DFK A;  4ECZ A;  1Y11 A;  3HHL B;  4LF5 J;  4NE9 C;  3MUT P;  3TRG A;  2MZT A;  3CJ8 A;  2DPI A;  4YY3 F;  4X64 J;  1PYT A;  2QA4 G;  2M5Y A;  4DFP A;  5D78 A;  3DU5 A;  4NYZ A;  4X4V A;  2B51 A;  3OJU A;  1QE1 A;  1V6H A;  2I38 A;  1S9G A;  4AL7 A;  3HCX A;  5DQI A;  2I0X A;  1B0V A;  4EYH B;  1NXI A;  4WFZ A;  1HI8 A;  1S7I A;  2ZH3 A;  3FFI A;  4DUT A;  3QO9 A;  1OG7 A;  1JLF B;  3LP2 B;  3T5K A;  4F02 A;  2PC6 A;  2RNE A;  1F2G A;  3JSM B;  2J8S A;  2DNO A;  3BEG B;  3R7B B;  3MPW A;  4L72 B;  5EUH A;  1JIH A;  5CZV A;  5IT9 Y;  1TL1 A;  3Q23 A;  4WZM A;  3GMG A;  1M5P C;  2G2Y A;  3IRW P;  1NHV A;  2K1R B;  4LR9 A;  3LGN A;  3JXO A;  4BS2 A;  5GMD A;  1ZS6 A;  4DV1 J;  4XK8 C;  2R9L A;  1NK5 A;  3D1H A;  4NPO A;  1CJT A;  5L1J A;  1RHU B;  1HWI A;  2VBW A;  1RWX B;  2CQI A;  3D9B A;  4Y65 A;  4V19 X;  2DCL A;  1C4C A;  2LQB A;  2M4M A;  2G9O A;  4GC6 A;  5HMZ A;  2CDQ A;  1TKT B;  3KTQ A;  3I82 A;  3OR2 B;  3QJL A;  2CFX A;  4O0I A;  4DV3 F;  2AGP A;  3CD6 S;  3I5C A;  3JQJ A;  2DBB A;  4DSK A;  4AL5 A;  1GQE A;  3L09 A;  4NLT A;  3RBD A;  4FXE A;  1KN6 A;  4C3K A;  4NXM F;  3PHT A;  4ED3 A;  4WP9 A;  2EFP A;  1HW9 A;  3PNI A;  2FVC A;  3ET6 A;  1IKW B;  3MCO A;  2RDJ A;  5D0H A;  4V19 J;  4OYP A;  4KRW A;  4TY8 B;  5ITH A;  2HRY A;  5KG7 A;  4JV5 J;  4K4S A;  2AJQ A;  3PKM A;  2JRS A;  2SXL A;  2J6T A;  1MU2 B;  1XMO J;  3CCQ S;  3MM5 A;  4ANC A;  5CYM B;  1U2F A;  1KQK A;  2OEJ A;  2XMK A;  2QLW A;  3K7R A;  1RTJ A;  4P52 A;  1X4E A;  3ITH A;  4FYX B;  1DZ5 A;  2HVZ A;  3QQC D;  1WEL A;  2M8H A;  2BZ2 A;  2RD5 C;  1GMV A;  4O3Q A;  1JLE A;  4FS1 A;  2BQ3 A;  4CLK A;  2QLB B;  3M6X A;  1VHI A;  5DZ6 A;  3K0J A;  1WOP A;  1EIY B;  2G13 A;  3DMJ B;  4DV5 J;  4X66 J;  1NAQ A;  3PJW A;  3QJP A;  1FTR A;  4K59 A;  1D1U A;  1H2U X;  4CNY A;  4A46 A;  1EQ0 A;  3CJK A;  3G6V A;  4ES1 A;  4ZK7 M;  2QEX S;  3KMQ A;  4XDD A;  2Y3Y A;  3RR8 A;  4NL5 A;  4B3R F;  1T0T V;  1JKH B;  3IS9 B;  3JTP A;  2R7Q A;  4D3G A;  2WBM A;  4MH8 A;  4NEZ A;  1IBM F;  3MTK A;  2CVI A;  2ACM A;  4USU A;  2NQP A;  1Q7Y T;  5L8R C;  4TU7 A;  4Q2M A;  4WFY A;  4ES2 A;  1V3R A;  3MOZ A;  4WP3 A;  3RG6 A;  2N4C A;  1FJ7 A;  1WC5 A;  4JV0 A;  2L08 A;  2HQC A;  3FK4 A;  3EPG A;  2AY0 A;  4C97 A;  2BAB A;  5KFQ A;  2GIQ A;  1PSD A;  1EAR A;  2HZA A;  4O0N A;  3QOQ A;  1RCX B;  1U1O A;  1MWZ A;  4RZR A;  3H7H B;  2UU9 J;  2RQ4 A;  5ETT A;  3DLL Q;  3MM6 A;  3M8P A;  2NR0 A;  2NYH A;  3DOK B;  2PN6 A;  2ERR A;  5A8K A;  5GAH I;  4UW2 A;  1RI7 A;  4CQ1 A;  4JI5 J;  4ITS A;  2ZIT A;  2F8E X;  2W8K A;  2Y0S D;  5B7W A;  5SUH A;  5KT2 A;  3TAR A;  2BJ8 A;  3FZB A;  3H5U A;  5G0R B;  5J1E B;  2A0F B;  1DHM A;  4X4S A;  1S12 A;  4Y34 A;  2ZFH A;  3F56 A;  1KRP A;  4JI2 J;  2PMZ D;  2RAQ A;  3FUY A;  3UN3 A;  1HBU B;  2HIY A;  4XO0 A;  1Q4R A;  1ARO P;  3TAN A;  4CTA A;  2CWK A;  2F40 A;  3K17 A;  4ZLP A;  2EKN A;  2IM2 A;  2BEF A;  3W61 A;  1TVR B;  4C0H A;  2HVI A;  3EZO A;  1JLA A;  3NMA A;  2V4J B;  3TP2 A;  1RAA B;  5D4N A;  2YQ0 A;  4FPR A;  1S1W A;  3PDN A;  3IRX B;  1IBL J;  2E5I A;  4PZV A;  4ZN3 A;  3GYX B;  4DQQ A;  2OPS A;  2FGC A;  1SJR A;  2CQ3 A;  3IXQ A;  1MYK A;  2D1C A;  4F3Q A;  2E5L F;  3KG0 A;  1ZET A;  1GMW D;  5J2P B;  3BKU A;  1Q8L A;  4XIU A;  2CJY B;  5BXI A;  4DR7 F;  4KV8 B;  4KC5 A;  3HHK A;  4R25 A;  4CLU A;  2M52 A;  2BJD A;  2PT0 A;  2YNI A;  3O5T B;  2HFV A;  3PR5 B;  2ZH9 A;  2EK6 A;  3JSB A;  1RAB B;  3R27 A;  4AQY F;  2HWI A;  1B01 A;  2XHC A;  3T9N A;  3GJQ B;  2DIT A;  2KH9 A;  4LFA F;  3BDP A;  5K9F A;  2Z8Q A;  2BJ9 A;  5LMN F;  2HFZ A;  3PYE A;  2LP4 A;  3O3L A;  1CC8 A;  2ZH7 A;  3EYZ A;  3MD3 A;  1CUL A;  3VTI A;  3KJF B;  1WF2 A;  5AXN A;  3FMT A;  4CT9 A;  2HQ3 A;  3HFZ B;  1Q81 T;  4MIA A;  2HAI A;  4RKU C;  2OP5 A;  2LXU A;  3LO3 A;  4IG3 B;  2UXC F;  2AKW B;  4HT5 A;  2J9E A;  1AB8 A;  3M9M B;  2JVO A;  3NBP A;  2QA4 S;  1HBN A;  1E6Y B;  2IHR 1;  2JC0 A;  2OPP A;  3H59 A;  4B3M F;  2ZJR Q;  1NJW A;  2DR8 A;  3LP1 B;  1H2T Z;  2DEJ A;  3TNV A;  5ETK A;  3PW4 A;  3HVR A;  1FRK A;  4DG1 A;  2J8A A;  2IMW P;  2CQ4 A;  1GNK A;  3RJM B;  4YHH F;  4A8O A;  4QIF A;  4RUC A;  2B4V A;  2HHT A;  2KM8 C;  4RLE A;  2AYB A;  3CCM S;  5KG1 A;  4NLW A;  1HNZ F;  5HQ8 A;  2JLF A;  4M5M A;  1RLC L;  2RIL A;  4BDP A;  1WDT A;  2CPJ A;  5LSL A;  3HVW A;  4RNO A;  2WON B;  1WEX A;  4JI1 J;  3OTO F;  4TU9 A;  4NLY A;  1K73 T;  2LLZ A;  4USW A;  2NRE A;  1BAZ A;  1VC5 A;  3KMS A;  3Q8P B;  2GZO A;  3HM9 A;  1K47 A;  4N77 A;  2JZ5 A;  3I0S B;  4FF1 A;  4DN9 A;  1JLC B;  2MHN A;  3CJT A;  3KUG A;  3R6L B;  3NO7 A;  3D66 A;  1N5T A;  1SH0 A;  3PV8 A;  3V81 A;  3WC2 A;  5IWA F;  2ALZ A;  2CJQ A;  4XPE A;  2LU1 A;  4DWI A;  3HSZ A;  2QE5 A;  1KOO A;  3N0V A;  1CJV B;  1UJ5 A;  3GFX A;  5I3P A;  3N9U C;  2LEB A;  4O3O A;  4WJB A;  2YKP A;  2KYX A;  2P9C A;  4H54 A;  3HO1 A;  2L41 A;  3MEC B;  1F5C A;  4WPA A;  2GNK A;  2X7I A;  1NK8 A;  3KLH B;  4OV1 A;  3VAM A;  4DZ6 A;  1OY6 A;  3M32 A;  2DD8 S;  1S97 A;  3VW4 A;  3TR5 A;  3WIV A;  2IM1 A;  1BQM B;  2GFF A;  4B9V A;  3DU6 A;  1RHQ B;  2DGX A;  5G4D A;  3VHQ A;  1P1T A;  4P9S A;  2I1R A;  4C8L A;  2UV8 G;  2I9S A;  2WRM A;  4DR3 J;  1S1X B;  4YB7 A;  3VGU A;  3U1N A;  4F4K A;  2LMI A;  1RAJ A;  4IKA A;  4LBP A;  2IPO B;  1EB0 A;  3KK1 B;  4WTO B;  4PWD A;  1MMN A;  1S0O A;  2WVD A;  3UR0 A;  2AX0 A;  5KT4 A;  2D9O A;  4DR1 J;  9RUB A;  5KFM A;  2YKM A;  4DR5 J;  1QLN A;  1CLF A;  5FII A;  3MMC B;  1O6X A;  4FKX A;  2RSQ A;  1DLO B;  2H48 B;  5IC4 B;  2K2P A;  1GH8 A;  2YKN A;  2CNK B;  3OLA A;  2GGP A;  1XBW A;  3TW0 A;  1KON A;  2BR0 A;  5CAB A;  3PTW A;  2KT2 A;  4DCJ B;  4IUF A;  1YKW A;  1WJ9 A;  2YKO A;  2JWN A;  4NX9 A;  1SPB P;  4FKY A;  4Q7A A;  2LVW A;  5CYQ B;  2CZV C;  4K4V A;  3H87 C;  4GKJ J;  4RUH A;  2LA6 A;  2XY7 A;  4K8R A;  1R6Y A;  4ZCL A;  2LXF A;  3M1V B;  1K1Q A;  4CLP A;  3UWT A;  2NYI A;  2OMO A;  2KFY A;  4LBI A;  3VAI A;  1FNO A;  2NS1 B;  2PMW A;  1MRO A;  3EXC X;  1TZ0 A;  2QSW A;  3BR9 A;  4F3M A;  2CPY A;  3CTR A;  1H72 C;  1S1T A;  3OFH A;  1NHU A;  5H9F J;  2XMJ A;  1HBO A;  5HP1 B;  3TUJ C;  2D7S A;  4ZJO A;  2O67 A;  1HNW F;  1KVI A;  5JUM A;  3RAM A;  1CSJ A;  1RT3 B;  3MED A;  2MXY A;  1FER A;  5LJ5 Y;  1MWY A;  4OLP A;  1UKU A;  2OLW A;  3C15 A;  2RU3 A;  5KOW A;  4JYA F;  1VGY A;  4XPC A;  3HHD A;  1DY3 A;  1W2I A;  4WFA Q;  1CEZ A;  1X4A A;  5CCM A;  2R8K A;  2XEX A;  3M8W A;  2GA7 A;  3ZC4 A;  1VLO A;  4CDI A;  4LR8 A;  4DMZ A;  1IJF B;  3LGH A;  5D0E A;  1FWK A;  3HFK A;  2N82 B;  1HI0 P;  3NCQ A;  4KHR A;  1OQ6 A;  2FLP A;  4NCG A;  5L38 A;  2Z58 B;  2HLT A;  4X65 F;  3TAM A;  4RUA A;  2EXU A;  3I0R A;  3PYG A;  2XMU A;  2NCK L;  4X4Q A;  1B4S A;  3LAK A;  1OO0 B;  1DBD A;  3U02 A;  3EGZ A;  1XK8 A;  5J2Q A;  4WU3 A;  2KTQ A;  3TO8 A;  3N4W A;  1XNR J;  1SQF A;  2HFS A;  2VPX B;  3D6F B;  1NO8 A;  3AA8 A;  1FTC A;  3W60 A;  1LXJ A;  4FDF A;  2W4P A;  1QAI A;  2ROP A;  4DPW A;  5KFP A;  4RBU A;  5EHH A;  4Z7C A;  3OV7 A;  4RL1 A;  4MK9 A;  2BQU A;  2CJK A;  1FE4 A;  3K5P A;  1E6V A;  3NP5 A;  2K7K A;  3ZTQ A;  4HT7 A;  4IFY A;  1S6Q A;  1RT6 B;  3W2W B;  4DL0 C;  1RP5 A;  2ADC A;  1NSP A;  3DOL B;  2HSE B;  3B54 A;  2F4F A;  2FZK B;  1ZTT A;  5IZH A;  2FGO A;  3L9Z A;  4UUX A;  1CJK A;  2W9A A;  2BW7 A;  3N6L A;  4DL2 A;  3H2L A;  2YTC A;  1T05 A;  4J9L A;  2A10 A;  4KFB B;  1EET B;  2L9N A;  3OPK A;  3KDN A;  1XR5 A;  3PCO B;  1N6Q A;  1I94 F;  3KLF A;  2BRK A;  4NLQ A;  3W9J A;  1TAQ A;  2FDN A;  3MM9 B;  1QSY A;  1RHM B;  4KGK A;  2WSE C;  2OSQ A;  2R42 A;  1T7P A;  4X4T A;  1KFD A;  3MCS A;  4CZC A;  5T7L A;  3ZTR A;  1FEE A;  1S10 A;  1EKR A;  4WTY A;  4DR4 F;  1FKP B;  4RW7 A;  2V8D A;  4K2X A;  3J7A 1;  3ISZ A;  4O3P A;  4LBH A;  3PG9 A;  1TR0 A;  4FF3 A;  3RR7 A;  4R5P A;  5LMU J;  3ZTO A;  3IM9 A;  2F4V J;  4NRT A;  2ZHB A;  2RQK A;  3K89 A;  3J7Y I;  1C0U A;  1VIX A;  5B09 A;  4DCO B;  2KRB A;  2GVZ A;  1OMS A;  2U2F A;  5D4P A;  4WBF A;  4TYB A;  1VYA A;  3S6E A;  2W9C A;  4FXW A;  4OX8 A;  3P3D A;  2HQI A;  4Q0B B;  3S8S A;  2FLL A;  3D68 A;  1UPP A;  4C8M A;  2V2Q A;  2XBP A;  3QSI A;  4IDK B;  4KE5 A;  1VK8 A;  3ICL A;  4IH5 A;  5BYQ A;  1N34 J;  3FMB A;  1FFS B;  3T1H F;  2H4W B;  3J81 U;  4RW8 A;  5HJX A;  1UP1 A;  4OL8 A;  4Y2C A;  3NGR A;  1ZPV A;  4DS4 A;  3GG1 A;  3FRY A;  3FBE A;  2KXN B;  1GT8 A;  1N33 F;  1TUG B;  1IVZ A;  1UFL A;  4K4Y A;  2RS2 A;  3C16 A;  1EA4 A;  5ETP A;  3CDW A;  2ZD1 B;  4LT6 A;  1FNX H;  2MQL A;  4KHM A;  3HK2 A;  1N88 A;  2EBE A;  4S0M A;  5B08 A;  1FRL A;  1JB0 C;  5C2C A;  1WD6 A;  3CC7 S;  2N3L A;  1XMB A;  2Q2K A;  4YEA A;  5I4M A;  4DUY J;  5KFX A;  3PZP A;  2B9X A;  1NM2 A;  1X93 A;  2CWX A;  1RT5 B;  1YBT A;  3PW7 A;  2DRA A;  1P94 A;  2HQG A;  3GIM A;  3NGD A;  1VQ8 S;  2HVE A;  4RWX A;  4W98 A;  3AFG A;  4U7C A;  2VAS A;  2QRR A;  2BM1 A;  2BKP A;  2X51 A;  3DI6 A;  2HVD A;  2EG1 A;  1WKJ A;  1YZ6 A;  4YR0 A;  5GAG U;  3KLE A;  1P1L A;  1YJW S;  2VDI A;  4LJM A;  1QE1 B;  4OI1 A;  3FKB A;  3OW2 R;  1K9M T;  1TL3 A;  4Q2L A;  1NB2 A;  2XLK A;  4C8Z A;  2AD9 A;  4DFJ A;  1H0H B;  1S9G B;  5HI7 A;  1OJ4 A;  4B9M A;  1VRU A;  3BR8 A;  4LFC J;  2PI5 A;  2DXD A;  3FFI B;  2ZOM A;  1WTB A;  2H1O E;  2DR9 A;  5E3R A;  4RO0 A;  4ZIV A;  3R7S B;  3UNY A;  3SSQ A;  3BQ2 A;  3LOU A;  1WSR A;  1H3D A;  3G71 S;  4M1K A;  1X7V A;  5GAD U;  2HYI B;  4KO0 A;  2LQ9 A;  3CVK A;  3E2E A;  4NML A;  4I2P A;  1KEK A;  3JTN A;  2L48 A;  1TL1 B;  4X4U A;  1SC3 B;  1K0V A;  1JLQ A;  1QDU B;  3GU0 A;  1JNR B;  2XO7 A;  1FJG F;  4BCA A;  1RTD A;  1CJT B;  3MOJ B;  4O23 A;  1J5E J;  1Z2L A;  2KHC A;  1NKE A;  3ZZ0 A;  3BGF A;  4M5I A;  3F41 A;  3DRS A;  4UQG A;  3JSY A;  3K2Y A;  4H4M A;  5E3A A;  1Y3J A;  5F8M A;  5F3T A;  3O8W A;  2B5J A;  4ANE A;  4LF7 F;  1H2V Z;  3GWC A;  4DXL A;  2AT1 B;  2QC3 A;  5IXU A;  2JLG A;  1ARQ A;  1UFK A;  4K0K J;  2VQE F;  3EE3 A;  2UXB J;  3UNG C;  2RB7 A;  1ZM3 A;  3DXB A;  1NCL A;  3ET6 B;  3GE9 A;  3MUV P;  1HPZ A;  2ZBI A;  1RT7 A;  4A8X A;  4F26 A;  3MCN A;  2RBF A;  3JQK A;  2JOQ A;  2B9Y A;  3RRG A;  2GO9 A;  1WKL A;  2QFI A;  3MM5 B;  2VOP A;  1YG0 A;  2VHG A;  4IO1 A;  1V9O A;  4N8N A;  1RTJ B;  1M1K T;  3PKY A;  3J81 j;  4K50 A;  1Y3K A;  3C14 A;  3ITH B;  3ENQ A;  1S9F A;  1RYS A;  4F04 B;  1FEH A;  1U25 A;  3QT6 A;  2H3A A;  1JLE B;  4RBV A;  4JI0 F;  1M5K C;  2YY3 A;  4OYM A;  4PUO A;  3ILL A;  1F6T A;  4IG0 A;  3JYT A;  4EGL A;  3ZNJ 1;  1HD0 A;  1HNV A;  3Q8V A;  4QW9 A;  1HHT P;  1AT1 B;  2OML A;  4ZPT R;  1YTY A;  4JI8 F;  2YVS A;  3CJK B;  4B3T F;  3A8J A;  4YY3 J;  3C6T B;  2HRT A;  5CAA A;  2YBV A;  4OHV A;  3RB6 A;  3TZZ A;  2AJ0 A;  2N3O A;  2CG4 A;  1AFI A;  1KSP A;  1OYE A;  4HV0 A;  4ZPW R;  2H5E A;  1FES A;  4ED5 A;  2UUA F;  3ETO A;  1AFJ A;  3MPV A;  3EX7 B;  5HQM A;  3FDS A;  3WQP A;  2VG5 A;  5IC6 B;  2VPW B;  4ED2 A;  3G8Q A;  4WFN Q;  4EFA C;  2O01 C;  1EHW A;  2DNY A;  3QID A;  4OX9 F;  5CH7 B;  2DO4 A;  1W2B R;  4OHW A;  3MTJ A;  3MM6 B;  2DXF A;  2DJW A;  3M8P B;  4ETX A;  1VQP S;  5H9F K;  3BSA A;  3W8P A;  2DGT A;  2W9B A;  5A8K B;  2C3U A;  2CPZ A;  3TQ1 A;  4OLO A;  2W4D A;  1REV A;  4JUZ A;  3CJQ A;  4OZN A;  4QWB A;  2UVR A;  3OQ2 A;  4IFV A;  4DV3 J;  3IAM 9;  1SVD A;  2DNQ A;  1NK6 A;  3D0G E;  4KJI A;  1ZM4 A;  5A2Q Y;  3TX8 A;  3CSK A;  3BZQ A;  4CTA B;  3PW5 A;  3W62 A;  2MMY A;  1Q8B A;  4USK A;  1A6L A;  2KB2 A;  1D9A A;  1S4F A;  1JLA B;  4BC7 A;  2ZUA A;  1ZA1 B;  2ZUG A;  1WI8 A;  1S1W B;  2BOP A;  1IR2 A;  2OPS B;  3QMQ A;  1FVQ A;  2XO6 A;  2HUR A;  4ZLN A;  3IP0 A;  3QRQ A;  3D3B J;  2PDA A;  3HHL C;  3W1Y C;  2HFU A;  4OYA A;  4U95 A;  3SXL A;  1SXL A;  4CM2 A;  3OL7 A;  3T9Z A;  2Z0G A;  1S57 A;  4Y00 A;  3M8S A;  1R31 A;  2YNI B;  1UEK A;  4J9S A;  3RB0 A;  3UD3 P;  4NLD A;  2J9D E;  1FRM A;  1FA0 A;  2EVZ A;  2BRL A;  2GX8 A;  2MKI A;  2C3O A;  1NME B;  3QGI A;  3MEK A;  1SI9 A;  3G4S S;  3W8G A;  3BGR A;  1FK9 A;  2HZC A;  2A3J A;  1GXU A;  1CUL B;  1HAR A;  3CCR S;  3NMR A;  5KFN A;  1EX8 A;  1YJU A;  3U7J A;  2GVD A;  1FX4 A;  1WC6 A;  4AAI A;  2YWF A;  5D77 A;  2ZC4 A;  2HAF A;  1B0T A;  2WW8 A;  1DQA A;  1RWO B;  1IBM J;  3P49 B;  6AT1 B;  1M90 T;  3NBP B;  2D3O R;  1C4A A;  2ZH1 A;  3SSS A;  1HBN B;  2OPP B;  1F3V A;  4TYA A;  3DLK A;  4A8S A;  1YLX A;  4P72 A;  1VOM A;  3QGG A;  4DG1 B;  1FDB A;  2FLO A;  3N5B A;  4ZVH A;  1ZYQ A;  2KG0 A;  4DQS A;  5MLC V;  3Q8Y A;  2KVI A;  1ULR A;  4NA3 A;  3TUP A;  3Q8Q B;  5KOX A;  3UVJ A;  3L4B C;  3CXC R;  1LKZ A;  1IXK A;  2V63 A;  2PMH A;  2F9J A;  2NUU G;  2AHO B;  1PC5 A;  2GQC A;  4IO9 Q;  2B6A B;  2CXE A;  4DX7 A;  1SKU B;  2GJ2 A;  1PGZ A;  2XHW A;  3GTY X;  3LAM A;  3D67 A;  3AD8 C;  4NYO A;  2PFD A;  3N6N A;  4QPT A;  3KHG A;  2VFR A;  2CRL A;  1BE4 A;  3W7B A;  4OYI A;  3UFC X;  2Z2L A;  4OYB A;  4IQM A;  1BWE A;  2DKO B;  1R0B G;  1QAJ A;  3I9Z A;  4TVA B;  1GX6 A;  3V81 B;  2ZOG A;  2LKZ A;  3JQM A;  3VAL A;  5E41 A;  5CD4 H;  4RNN A;  2H54 B;  3ISN D;  2MLY A;  3S01 A;  5DG8 A;  4QCL A;  1UET A;  3HI9 A;  4E2F B;  5D6G A;  4PR6 A;  2HGN A;  4CWB A;  1IR0 A;  1N5V A;  3IGN A;  3NOC A;  2E5L J;  3CJ3 A;  5M2U A;  3QJJ A;  2XC9 A;  4HAC A;  4ECU A;  4MJK A;  2XYG B;  4XAK A;  4DSI A;  3OL6 A;  2LEC A;  2H65 B;  3M32 B;  4NYP A;  4DR7 J;  1LW0 B;  2LU2 A;  5A76 A;  4BBY A;  4M63 A;  3Q89 A;  3SEO A;  2PEB A;  4AFF A;  4OI0 A;  3VAH A;  2W24 A;  3IG1 A;  2HHW A;  1OQ3 A;  1W26 A;  4AQY J;  1QSS A;  1WAC A;  2MJN A;  4LFA J;  2C2O B;  1TAU A;  3BDE A;  4RWW A;  4I4B A;  4AXJ A;  2RS8 A;  2DCU B;  2W4C A;  2HW3 A;  2YNH A;  1T9W A;  3LTO A;  2VPZ B;  1ZH5 A;  3N28 A;  1I5O B;  3PRD A;  4F2S A;  3EGW B;  4PWD B;  4GO5 X;  4J9P A;  3KJQ B;  4YB1 P;  3CJ5 A;  4DJB A;  1S59 A;  1LK5 A;  2UXC J;  2EPI A;  1NSK L;  1KBR A;  3CCV S;  1KLM A;  5L1K A;  2YKM B;  4HDG A;  2DHA A;  3TVY A;  5F8I A;  4B3M J;  4PPZ A;  5T41 A;  4CH0 S;  3SFG A;  4DL3 A;  2ZC3 A;  1U1L A;  1IR1 A;  4PAA A;  3KKF A;  1WEY A;  5IV4 A;  5KAK A;  5H1S V;  1U2C A;  2YKN B;  3M8Q A;  2BKO A;  4DL4 A;  1U1N A;  2GGP B;  1FRI A;  2GS8 A;  3VZI A;  2VG6 A;  4YHH J;  5KFV A;  4ZVQ B;  3OTC A;  4ECV A;  1CVJ A;  3OBI A;  1X5O A;  3M2U A;  1UVJ A;  3IRX A;  4O3S A;  1TK5 A;  3CIM A;  4KY3 A;  2AQ4 A;  2PFF B;  3EPI A;  2Y0B B;  2MZJ A;  2IM0 A;  1BQN A;  3OTO J;  1MNT A;  1VI7 A;  2W7A A;  3O6Q A;  4XTT A;  4DFM A;  2XWX A;  2APO A;  2E5G A;  2KYZ A;  1MRO B;  2MQN A;  5HBM A;  2DNM A;  1S1T B;  3AA9 A;  4DX5 A;  1HBO B;  1N56 A;  1NKB A;  1B70 B;  4QWE A;  2VC1 A;  4LF8 F;  5CHC B;  1TL4 A;  3CD7 A;  3DC2 A;  1U6Z A;  4QBU A;  1FT8 A;  5IWA J;  3C3L A;  1QUP A;  1P9Q C;  3MED B;  1Z1Z A;  2AJF E;  5KFJ A;  3UN2 A;  2BE2 A;  5KFI A;  5C5J A;  3OTB A;  3BH6 B;  4DSJ A;  4FBU A;  3H0P A;  3C15 B;  4FS2 A;  4O44 A;  1GFW B;  4PAB A;  3ZZR A;  1P8G A;  4FPI A;  2XMW A;  4NA1 A;  5J2N A;  3CUL A;  5H9E J;  1NK7 A;  2QMW A;  2AU0 A;  3HZE A;  4J9U E;  2FVS A;  5HMW A;  3OL9 A;  1V5I B;  3NS7 B;  2GAG C;  5F8N A;  4LRB A;  4DLG A;  1HW8 A;  1YWX A;  3T1Y F;  3KK2 A;  4NCG B;  1PAU B;  3BJY A;  3P6Y C;  3M30 A;  2BKN A;  3TAM B;  2XS7 A;  1UZD A;  4YDD B;  5FDL A;  4N8O A;  3I0R B;  1TL5 A;  4EMD A;  2GCF A;  2MY7 A;  5B0E A;  3BSO A;  5J2Q B;  2IVM A;  3UO0 A;  4I2Q A;  3EJM A;  3IC1 A;  3DGP A;  1WG1 A;  3SDE A;  3IMQ J;  5T14 A;  3FVY A;  2AEM A;  5LXR A;  4J91 A;  2WW4 A;  4A8W A;  3NS6 A;  4ZIW A;  4LSL A;  2V69 A;  4UQT A;  2DGQ A;  2HHX A;  4DV0 F;  3QRR A;  3IWX A;  1BLU A;  1E6V B;  3UI3 A;  1FJC A;  2BMB A;  4IFY B;  1S6Q B;  3ZZY A;  4A8K A;  4W90 B;  4XDC A;  1KR4 A;  3HD2 A;  3CWJ A;  2NPI A;  1CJK B;  4B02 A;  4QIV A;  1A9N B;  1T05 B;  3KOA A;  2BAN A;  4M5D A;  3QLH A;  4NI2 A;  1N6Q B;  1QAX A;  4ED8 A;  1K8A T;  2VOO A;  2BSQ E;  3KLF B;  2EFG A;  5KFC A;  3VV2 B;  5AJ3 F;  4CH7 A;  4WXO A;  5F0W A;  1RXO B;  1B64 A;  3HSJ A;  4ZPA A;  1UJ6 A;  1X4F A;  3H20 A;  4U6P A;  3CCE S;  3PO5 A;  2OAU A;  2ATL A;  4W92 B;  5T7L B;  1FWP A;  4ZP7 A;  1C1C A;  4O3R A;  1TU0 B;  1U1M A;  1RJJ A;  4ZCM A;  2QX0 A;  4IR9 A;  1HNW J;  1SKS A;  5DM6 Q;  4RW7 B;  2ZH5 A;  4HVZ A;  3G9C A;  1O0P A;  3CUN A;  3MMB A;  2IBK A;  1IWA A;  2BVZ A;  4R5P B;  4X4N A;  1YRX A;  1EZZ B;  2R7W A;  3N5F A;  2B56 A;  4AL6 A;  3DKD A;  1SJ1 A;  2W2N P;  2UUT A;  3FCW A;  4L74 A;  3WX8 A;  2X1F A;  1A7G E;  4JYA J;  1C0U B;  1MNE A;  3K57 A;  2GVZ B;  5K20 B;  2LEP A;  4DX6 A;  3GFZ A;  3OR1 A;  2W9C B;  1X0F A;  4ID5 A;  3MMC A;  4KB7 A;  1M1H A;  3H25 A;  1YBU A;  4ECW A;  5KFE A;  4Y6I A;  4USH A;  2GMH A;  4ZCI A;  3FGV A;  1VQM S;  4X65 J;  3MM7 A;  2R8H A;  1SKR A;  1FKO A;  4LF9 F;  3OLB A;  4RW8 B;  2OJ3 A;  2G1D A;  4PQU A;  4KGZ B;  2D41 A;  1CJU A;  4WK1 A;  4DR6 F;  3EM1 A;  5L39 A;  3A4T A;  3C16 B;  4QIW D;  4CLY A;  1FNM A;  2EFV A;  2R2R A;  1URN A;  4N7T A;  3C19 A;  3CED A;  1QTM A;  2YKA A;  2K8G A;  2UUB F;  2R3V A;  3OXF A;  1N54 B;  2EC2 A;  3MWB A;  5KG0 A;  3EDQ B;  4FVC A;  4KHP F;  2IIH A;  2IMO A;  4HH0 A;  2VQF J;  1OWX A;  2XCA A;  1RHJ B;  4ER8 A;  2DR7 A;  2DTJ A;  4I0W A;  5ETM A;  2ZM6 F;  5CZX A;  1BXN A;  5D4O A;  2PII A;  4OMF G;  3AJD A;  3G8T A;  3GV5 B;  4CH1 A;  2Q1L A;  3LH2 S;  5B0B A;  4C48 A;  1VLY A;  4F0H A;  3DI6 B;  1UTA A;  3AT1 B;  4N56 A;  1YZ7 A;  1H74 A;  3KLE B;  2NPF A;  2QO3 A;  2RF2 A;  1JMT A;  1RCO B;  2JHE A;  1Q1K A;  1TL3 B;  4PG5 A;  4ZVS B;  3ENA A;  4TLQ A;  3GJR B;  2NSB A;  1VRU B;  4M5J A;  1J2V A;  2CQ2 A;  4GC7 A;  1I94 J;  4Y0F A;  4CT8 A;  1WOR A;  2Y1R I;  4HTJ A;  2HND A;  2W2Q P;  1R3N A;  2NZ4 A;  3QT8 A;  2HS3 A;  1Q95 G;  5HVG A;  3ZFV A;  2V4R A;  4KO0 B;  1PBA A;  1RBO B;  3CDU A;  4OYW A;  4I2P B;  4CYU A;  4J5O A;  2M8D B;  2CPI A;  2AEF A;  2CPG A;  1WF1 A;  3TZY A;  1JLQ B;  3IBC B;  3AD7 C;  1R43 A;  3L7O A;  4DR4 J;  3I96 A;  2IRX A;  3RTV A;  3PVX A;  4EWT A;  1T03 A;  1M1G A;  2ALY B;  4P2M A;  1RTD B;  2ZHA A;  1CQM A;  5K8P A;  2VKR A;  3M8Y A;  4A8F A;  4OI4 A;  4UZC A;  4LUB A;  4P71 A;  4LF2 A;  2VIH A;  1Z2Z A;  1RSC A;  4GKK F;  1HYS A;  3DRS B;  3W64 A;  4F3O A;  2AJ2 A;  1FI4 A;  3V2U C;  4H4M B;  1RWV B;  2B5J B;  3M9N B;  1SC6 A;  3BKF A;  4EI2 A;  4MMO A; 
#chains in the Genus database with same CATH homology
 2Y3Y A;  2WVE A;  3LGH A;  3H87 C;  1U9P A;  1NLA A;  2BJ3 A;  1P94 A;  2K1O A;  3FT7 A;  1BAZ A;  3GXQ A;  2PC6 A;  1BDV A;  3FMT A;  1B28 A;  3BKT A;  2CA9 A;  4D8J A;  2CAX A;  2BNZ A;  3VEB A;  1Q5V A;  2AY0 A;  2BA3 A;  2BJ1 A;  4ME7 E;  1QTG A;  3QSI A;  2FGC A;  2WVC A;  2HZA A;  2CPG A;  3QOQ A;  1PAR A;  2WVD A;  1MYK A;  2GPE A;  2JXH A;  2JXG A;  1IRQ A;  1ARQ A;  1MYL A;  1X93 A;  2BNW A;  2CAD A;  3BKU A;  2H1O E;  1Q5Y A;  2CAJ A;  2WVF A;  4HV0 A;  1EA4 A;  1ARR A;  2JXI A;  3VEA A;  2KEL A;  2WVB A;  1MNT A;  2RBF A;  2HZV A;  2NZC A;  3OD2 A;  2BJ8 A;  2F1F A;  1B01 A;  2BSQ E;  3VW4 A;  1BDT A;  4FXE A;  2K9I A;  2K29 A;  3BKF A;  2BJ9 A;  2BJ7 A;  3PHT A;  2K5J A;  2K6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...