2BJ8A

Nikr in closed conformation and nickel bound to high and low-affinity sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEIISSLHVHMDEHNCLEVIVVKGEAKKIKMIADKLLSLKGVKHGKLVMTSTGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transcription
molecule keywords NICKEL RESPONSIVE REGULATOR
total genus 37
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bj8A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2bj8A02
3LGHA 2K6LA 1EA4A 2JXIA 2BSQE 1Q5YA 1MYKA 3QSIA 4ME7E 3FMTA 3FT7A 4HV0A 1B01A 2BJ7A 1BDVA 3VW4A 1BAZA 2K1OA 2WVBA 4FXEA 1BDTA 1MYLA 2CAXA 2JXGA 2CADA 2K5JA 2H1OE 4D8JA 2Y3YA 1MNTA 2CA9A 3GXQA 1B28A 1ARRA 2BJ1A 1X93A 1QTGA 2FGCA 3H87C 3OD2A 1IRQA 2F1FA 3BKFA 3PHTA 2K9IA 2KELA 1NLAA 2BJ9A 2WVFA 2RBFA 2K29A 2BA3A 1P94A 2BJ3A 2BJ8A 2CAJA 3VEAA 3BKTA 1U9PA 2GPEA 3VEBA 1PARA 2AY0A 2HZVA 2WVEA 1Q5VA 2WVCA 2JXHA 3QOQA 1ARQA 2BNWA 2NZCA 2HZAA 3BKUA 2BNZA 2WVDA 2CPGA 2PC6A
chains in the Genus database with same CATH superfamily
3WC2A 2JC0A 1LXJA 2DXDA 4YDXA 2K6LA 5AT1B 2UUTA 1WC5A 2DCLA 5MAOA 5HQLA 4ME7E 3D1HA 1T11A 2IVYA 3A3NB 3MEGB 2O3DA 2J6TA 4UOCA 3RYLA 1IXKA 2BXJA 2YNHB 1KP6A 3EWGA 2ZHBA 5CCLA 3CDEA 3HHLD 5F3TA 2RF2A 3VVUA 1FJEB 2R8JA 1SQEA 1F2GA 5GMDA 1FRJA 3GR0A 4KGVB 2VPWB 2XY6A 5B0DA 3QJLA 1VISA 4J9RA 5B0BA 4ZPTR 1RABB 4CH0S 1GMWA 1TFWA 4DR7F 2MKYA 6FD1A 1AA1B 2UU9F 1RAAB 3O44A 3MUMP 2XWXA 3D6HB 3HVAA 2HAFA 2DGXA 2IHR1 1JLFA 2NUUG 1R89A 5L9XA 5J1EA 3V81A 3M9OB 3KNAA 2IYIA 4DI6A 1QLNA 1RACB 5KFFA 1K47A 4DSJA 3KUEA 2DNKA 3MWBA 4PR6A 3CJQA 4FF3A 2IAJB 4YEAA 3AD7C 4B3TJ 1MMDA 2CUYA 2Z58B 3JSMB 1QUVA 1LW0A 2CVIA 3MEKA 3R7NB 5KG3A 4CNYA 2OUGA 3CO9A 5LSRA 5M2UA 1T05B 1IM4A 2HNZA 2QLFB 4AE5A 5CD4A 2Q1LA 1ZTWA 3H2LA 2GQCA 2UUWA 4DCJB 3VAJA 2J9DE 3AT1B 4URQU 5IS2A 2C2NA 2NZCA 2CZVC 2HZAA 2V4JB 5HVFA 4ZK7M 4LF6J 1Q8LA 1Y5NB 4RR5A 1WEYA 4C97A 2B8QA 2BSQE 1GFWB 1GT8A 4KH1B 1B0PA 2VQFF 4MFBA 5KFYA 2GW8A 2XQCA 1FXLA 3RG6A 2XBPA 1GQEA 1WG5A 3VAKA 4AL7A 1QSSA 3NGUA 2X3DA 1EARA 3PIPQ 5I42A 5GAEI 3POTB 3UDEA 1ZM4A 3QFHA 5C2GA 3VAHA 1HWUA 4N5SA 2R7OA 4DL5A 4BC9A 4WIIA 3I0SB 4CLKA 5LSLA 1BMQB 1DQAA 2RH3A 1N5VA 2I5JB 3A8JA 3DLEB 4ES2A 2CWKA 4RW9B 5H9FJ 3LP0A 1SH3A 1FDAA 4YFUA 1R31A 2EI5A 4WP3A 5BXIA 1X5SA 1XK8A 1RHKB 4J9VA 2X1FA 2JXHA 1EETB 2FJDB 2B43A 4PAAA 2BE2A 1YJ7A 1WOSA 2J6UA 3BEGB 1JKHA 4FBUA 4M5GA 5IOLA 3CCSS 1JLCA 5ETPA 3OL8A 5EWFA 4MYTA 1UA0A 4X4TA 1R0BG 4L73A 1H2VZ 2PGCA 4XTTA 4X4QA 2QO3A 2B6AB 4RUAA 1GTEA 4RNNA 2E9ZA 2HWIA 3HK2A 3MM9A 3MMBB 3EDRB 4N7TA 3CJ8A 1TAUA 1D9FA 3NCQA 1RI7A 1KTQA 4B9LA 4FXWA 1R27B 2KYXA 1KQSR 1DRZA 4NLSA 2EFNA 2H9ZA 3MR7A 2DNGA 4OYPA 3CNQP 4USUA 1LW2B 4ZVTB 4OX9F 4BHQA 4KO0A 2V2QA 3A3PB 5IT4A 4U6PA 1PIEA 2WVFA 3FSIA 2FJVA 4JYAJ 3DRPB 4YOEA 3VEBA 3LPYA 2ASYA 2HURA 1T3NA 4LF8F 7AT1B 1REGX 2EBGA 2OP5A 3LP1B 3SMZA 4JI4F 4KY3A 1H73A 3U27A 2RS8A 1NSQA 5JUMA 1F9EB 2PMWA 1K9MT 4HHUA 4LSNA 4YR0A 4X4OA 1XNRF 5A8WB 3M8RA 2M9KA 4EYIB 2ZJPQ 1L3VA 3RBDA 1IKYA 2BACA 1U1PA 4FF4A 5G0RA 1SC1B 1T0TV 2XM3A 4O44B 3MFHA 1RTDA 3RR7A 2FC8A 3SDEA 4A8SA 4NLUA 2GAHC 2HWTA 1LFPA 3GZ7A 4O3PA 3UCGA 5KFKA 3CC4S 2X1BA 1MNTA 4CT9A 3HVRA 1S7HA 3O6QA 4L3NA 4K0KF 2FB0A 3OR2B 2EPIA 3BB5A 1F9FA 1ICEB 1J2VA 3HPOA 1YKWA 3G8SA 1R0AB 1FNMA 2UVWA 2AJQA 3M8ZA 4OYMA 1M5SA 4LIWA 3K58A 3DDNA 4ED1A 1R8BA 3EGVA 3U02A 1XIQA 4RO0A 1GAOA 3A12A 2CPYA 3BO2A 3NNAA 2AZ1A 1R8PA 4G6VB 4UT4A 3TI0A 5IWAJ 4DL3A 2HHQA 2VPYB 3MEDA 2AT1B 2ABYA 2BOAA 3B54A 4QIWD 3MR5A 2ZHAA 3KJNB 1F5AA 2ATLA 5HO4A 1VC5A 4DN9A 4DL2A 3I0RA 3KMQA 4OI1A 3CMAS 5CH7B 1TVRB 2BDPA 2OTLS 4JI0J 2YWFA 1XQIA 1PAUB 3H42A 4ETXA 5KG1A 2XLJA 4EO6A 3LO3A 2F4VJ 1IN0A 3ET6B 2H5JB 2IM0A 4AYBD 1R7IA 4RUCA 4U8VA 1WKJA 2PMHA 3CC2S 5BYSA 4YB6A 3MM6A 1RAFB 2ZUGA 1VC6A 3J81U 3FSYA 5ITHA 4RNOA 2BJ3A 1X4FA 2MQLA 3HT3A 4AL6A 1NDPA 5IV3A 2EWHA 4PWWA 4DR5F 1XJWB 5F8IA 3MMCB 4Y6IA 3JTOA 4ZJLA 2OIHA 3JTNA 3K5PA 1VRTB 3NGSA 2CJBA 1V3SA 4ES3A 1N8RT 5J1PA 3KG1A 4OHVA 4DV2J 2B4PA 1CQMA 3R7BB 7FD1A 1AXQA 1FESA 1KKHA 4AQYJ 2C2ZB 1SJFA 1NJXA 1N36J 3DLGA 1A7GE 2HGNA 4R5PA 2UVVA 3WX8A 3VCDA 4KTQA 5CYMA 2HHTA 2RU9A 4ILLA 1EZZB 4U8YA 5KFSA 5CD4H 2L41A 4IOAQ 2PE8A 1D8ZA 4RKUC 1UPPA 2W9CA 2WW4A 4O44A 1VJWA 3NS6A 1AFJA 1FKOA 2KN4A 1Y4ZB 1IRQA 5J1EB 1Q53A 1SIWB 3V81B 3MMJA 4B9VA 3OTBA 3EDQB 4P7VA 4ILRA 1VRQC 3BGRB 4IQMA 1S1WA 1VRTA 1WKLA 4Y2CA 5HSPA 4C11B 4JI6F 1K0VA 3A3OB 1Z2LA 2ZH9A 1H7XA 4DG1B 4QYZK 1CVJA 5T7LB 3AD9C 1HARA 3M1VA 2BYCA 2CPGA 3H5XA 1U2RA 5A0YA 3ZNUA 1SL2A 2NPIA 2HZCA 2XTJP 4WU2A 2HNZB 4P74A 1WTFA 1FX4A 1XMQJ 1TL4A 3A8EA 3K57A 1FI4A 2H5IB 2DHHA 5AE3A 2HK3A 2G4BA 3UCZP 1NDKA 4WXWA 4Z7YA 2X1AA 2UV8G 1U0SA 2ZM6F 2PD1A 2UUAF 5H1SV 4J9OA 3ENVA 1JLQA 2NPFA 4C8OA 3EYZA 2ZH7A 1KBRA 2DR9A 2JC1A 4RW4A 4A8OA 2V69A 3C8YA 4WXOA 5HROB 2IYGA 2BX6A 2MKJA 1IR2A 2MMYA 2AJ1A 4ZIWA 3W2WB 5LXYA 2MZ1A 4ECTA 4P2XA 1RA6A 1RU1A 1SJQA 4CTAB 4LRCA 2UP1A 1CS4A 1WHXA 3SSSA 2RQCA 2PFFB 1REVA 5KFRA 3JYTB 3KLHB 2ZDOA 2MPUA 3KJQB 3QSIA 5ETKA 2UVUA 1S97A 2C2RA 4F2RA 5EWEA 2WBMA 3VGUA 5K14B 1RWNB 2A3JA 3E3XA 3QGIA 4HYKA 5BYQA 3K0JA 4K5SA 2W24A 4GKJF 2DHSA 3LA0A 4OZ3A 4DSEA 1QAXA 1WC3A 3M4XA 4FKYA 4WYLA 2O01C 4HI1A 3Q0AA 3RB6A 4DS5A 1T7PA 4CLLA 1JK9B 2DNYA 3LTOA 5K8OA 2HQGA 2YH1A 1DBDA 1NHKL 2VBWA 3P45B 3ZNJ1 3QRPA 1HQUA 5K5MA 2YPYA 3MCMA 3C15B 5JXSA 3BYPA 4CO3A 4ZLNA 2FVCA 3M1VB 4M63A 4EBEA 4F3OA 3M2RB 2NXJA 4TQRA 4KH0B 2UUCJ 3M7VA 1JXEA 2CNLB 2PN6A 1UW4A 3TZZA 4AFFA 1SL0A 3G5OA 3MM7B 4HHJA 4OYBA 1I51B 1QVGR 2Z30B 1YI2S 2MLXA 1RHRB 3M2VB 1NB7A 1BHNA 4KO0B 1C1BA 1Q8KA 2FZGB 3TAMA 4ZVFA 4Y2MA 1YHQS 2IC3A 3D5MA 3DOLA 4G1PA 4C6AA 3UPFA 4OFZA 2AWZA 2DEJA 5HMWA 2W8KA 3BSNA 2OH2A 1RWOB 3IM8A 1PILA 3EICA 2AV5A 2HNDB 2CA9A 1SI9A 2EC2A 1DAXA 2ALYB 2BJ1A 4OYXA 4OHZA 2E7VA 3PKYA 5KG0A 4V19J 3BH6B 2AEJA 2Y9HA 3DI6B 1SC4B 2JFDA 3D67A 2HG4A 2LA4A 2XEXA 3D6MB 3KLGA 1S0VA 4OYWA 4TN2A 5AXMA 3M9NB 2DNPA 1NKBA 5L1LA 3CUNA 1KFDA 5LSOA 3KK2B 2CQGA 5D3GA 3N01A 3MAQA 4DPWA 4LFCF 2V34A 3NGRA 4CO5A 3OBIA 2H54B 3OXFA 4DR5J 3KJVA 1S1TB 3X1LB 2ZH4A 1DZ5A 4Z7CA 4RNMA 3LAKA 3FRZA 1IJFB 2CPZA 3SIPB 1JNZB 4OZ2A 2YX1A 4L72B 3TARA 1B7FA 2XB2D 2ILYA 1FE0A 4C2MA 3V6DA 3CJSA 1NJIT 4LF2A 3H98A 3CTRA 3B4MA 4CRJA 4ZCKA 4ECUA 3IWNC 2R9LA 5J2MA 5KG2A 1F3FA 2HVDA 2HBYB 2DB1A 1N54B 1D09B 1NUEA 1VQ7S 5HBMA 1U45A 2C3PA 3H2UB 1BQNA 4YMEA 1JLQB 2MQQA 3BO4A 2C2MB 3M2VA 4NZ6A 1KEKA 3IS9A 3DGPA 2MXYA 3NAHA 2JOQA 2XGQA 2KI2A 3MAAB 4DFKA 4ZVOB 3KUGA 3VGTA 1QTNB 3PDNA 4X66J 5GMKa 5CXTA 4B3OB 2RQMA 5B09A 4X2BA 3D28A 1FTRA 3DN9A 2ROPA 3Q89A 1VBXA 5KT5A 2NREA 2BJ7A 1X8DA 2QC3A 4Q0BA 4W98A 2K1OA 2W9AA 3I96A 4P73A 4WTYA 1OWXA 2ZJQQ 2CQDA 2YQ3A 3ADAC 3LWMA 3ZZ0A 1N32J 2ZKUA 2P9EA 3G6YA 3SBMA 1RGVA 3RBEA 4J9LA 4RW7B 1JLFB 1QM9A 3EM1A 1SC3B 5D4LA 3HHKA 1U09A 1HBNB 2HFNA 2MLZA 4K4YA 3JSRA 3ITHB 2EC0A 2Z56B 1L5UA 1RWPB 5HJXA 3A8KA 1TUVA 5F8MA 4DUZJ 3T19A 1NCLA 2VFRA 3PRDA 2CJ9A 3KLHA 1Q16A 2W2NP 2DR5A 4KHPJ 1ULRA 2H3EB 3M6VA 2MJUA 4URSA 3T6BA 2CJKA 5CYJA 1M5KC 2M70A 2PT0A 1RT7B 1WOOA 4ZITA 2VQEJ 1OSCA 2HQDA 3OLAA 3PJWA 1KLMB 2CQ1A 2IMOA 1U2CA 2IY5B 3I32A 3I5BA 1CLFA 2ZWOA 3BN7A 1RYSA 2J5AA 4PEOA 1CJKA 3SCJE 4IYQA 1SJRA 3ITHA 4DHVA 1UTAA 1BQNB 3UN3A 3W2VA 2V2VA 3Q83A 2QLJB 2N82B 1XMOJ 1KC8T 2EK6A 1JJ4A 2XGPA 4GKKF 3FFIA 2M7SA 4NLGA 2CAJA 3IR7B 1RBAA 4R0EA 4I2QB 1VQOS 1D1UA 1WSVA 2VG5B 2YNGB 5HLFA 1JLEA 2J9EA 3C16B 1Y9OA 3Q8PB 1KDNA 2XZDB 3HFZB 2WOMA 3J81j 2YNFA 4F04B 5A6PA 2W4CA 1TZ0A 4KQZA 4ELUA 4PQAA 4K4SA 3UWTA 4Z2XA 2AMCB 3FUYA 4OX6A 3R97A 4C7QA 3S8SA 4XPCA 4DSKA 1HYSA 2DNZA 3FMBA 3DDIA 2O67A 1LWCA 2XS2A 1E6VB 1GX6A 3N6LA 4EFAC 4B3MF 2JFKA 4C8ZA 1VYAA 5LXRA 1GH8A 4KT0C 2F3JA 4RX6A 1BQMA 3HZGA 3MM8A 2BVZA 2IJRA 1QDUB 1F2HA 1FEHA 1OS5A 3AXMA 3OR1B 3KUHA 3N6MA 3PJ9A 3QMQA 3DU6A 3IR7A 2DGTA 3PG9A 5JMNA 4JV0A 1IR1A 2O5DA 4DV5J 2LEBA 1Y7PA 1LXNA 2MKSA 1NJYA 1WHWA 1J5EF 2XS5A 2DH8A 4NLRA 3GIMA 2K9IA 1TK8A 1N6QB 1WSRA 3J7AN 1T9XA 1N0VC 1RAOA 2ZC3A 5J2MB 4WFAQ 3R1LA 4X4VA 4RW7A 1KNZA 1ZYQA 4K4WA 3H90A 3HF5A 5DG9A 4X4NA 2YKMA 1WACA 4RJVA 3MM8B 3OR1A 2IIHA 2Q79A 1R0AA 2GO8A 1NB2A 4DQRA 4NI2B 4LRVA 4C0HA 1HQEB 1NDCA 1TAQA 3D6TB 1N34F 2VG7B 1YBUA 2VZ9A 2ZH3A 1SC6A 4F8RA 3DRRB 2P2CB 5DS7A 4ZPAA 2E1PA 2WB1D 2XI3A 2A10A 2BV3A 1ZZFA 3THTA 3KJFB 3U1MA 5F9NA 2CKWA 1RWVB 2JSXA 3CD7A 4QOTA 4HTIA 4DU8A 5I42B 1APSA 3TQEA 2GO9A 4N8NA 3MD3A 3NWRA 2G2YA 3NGKA 4ED3A 1UVJA 2R7UA 3BGRA 1I94J 3NAIA 2AGQA 1F0XA 1TL1A 1W2BR 2VL1A 2OSQA 1Q95G 4O4GA 4DWIA 2HBRB 2JJ4D 4LR9A 1PC5A 2G13A 1Q5VA 1B3TA 1X4DA 3WX4A 4U96A 1FERA 3DRRA 3HVTB 1RAIB 3JQKA 4NYPA 2DK2A 2R7QA 2JRSA 4CCHA 1UZDA 2VONA 3GIJA 1S77D 5DDRC 3BV8A 3W9JA 3C6TB 2CQ0A 2YNIB 1LV5A 1KFSA 4ECWA 2XZTB 1BDTA 2AEFA 2MJNA 2OPRA 4GMKA 3O1LA 1RHMB 2OD6A 2CIMA 2GCFA 2ZOGA 3MGJA 3NCRA 2Y8WA 1FXDA 2HHXA 3ZTOA 1WC1A 1BQMB 4RW6B 4ZOSA 1SIZA 4BC7A 4LSLA 1RTIB 3CJTA 2MZQA 2VKZG 3W5YA 4CO0A 4CDIA 3MURP 1ZZNA 2ERRA 1OPZA 2KELA 1IBCB 2OGUA 5LJ5Y 4W90B 2HRTA 3BDPA 3DM2B 3VEAA 1YJ9S 3CCUS 2GJFA 3TAPA 4AXIA 1RTJB 4MK8A 2AY0A 3BZQA 1EP4B 2VBXA 3GLJA 4K59A 1HHQA 3NXZA 2HBQB 2XMTA 3A13A 3ET6A 4A8MP 1SJ3P 1RT5B 3M8YA 3UD5A 4F3MA 4C0OC 2AGPA 5F8LA 4V19X 3QFWA 3WHIA 3FBEA 4IG0B 1RT6A 4DPXA 2MZJA 4F3QA 3EVMA 4ED4A 3IRWP 1J5OB 2GIRA 4ZKAA 4DCPB 4DUZF 1TMMA 1N5YA 1HNXJ 4Y65A 4X65J 1UEVA 2XY7A 1RTJA 4NPOA 2A2CA 4AXJA 3H5UA 4HDHA 3HSGA 5HJYA 4N8OA 1YRUA 2B8PA 1VIXA 1WI8A 2QT7A 1UW9A 2F8EX 3EGWB 4IH7A 3CCRS 3PEJA 3E01B 4DR3J 3MECB 3QGPA 1FNOA 3R5BA 4OYAA 4ECRA 2KZZA 4OLOA 2B7BB 1VQ5S 3TX8A 3TQ1A 2VC0A 3HLUA 2YPZA 2AX1A 2LA6A 1YRXA 5KFGA 4EZ9A 4L75A 4K4XA 2JH3A 3G8TA 1JLBA 2LKZA 3OR2A 2RKIA 5B0FA 3K5OA 3VHQA 1MN9A 2FY1A 1FCAA 3NBPA 3WQPA 4YS2A 4QR2A 2I0XA 1LFWA 1PYSB 4G65A 1YZ7A 3CCZA 4UOFA 3T1AA 4DUTA 3AD8C 1TUGB 3MOZA 4MT1A 3VZHA 3G71S 3PW0A 1RT1B 2DIVA 2YVSA 1O51A 1MWYA 3OVAA 4GRSA 3N0VA 2B3TB 4WP9A 4JI8F 2M52A 2QX0A 4B9SA 4MKAA 1HI8A 2AJ4A 1A6LA 2MYFA 4OJ1A 2X51A 3GJTB 5EWGA 4DR2F 1EHWA 2WVCA 2YWHA 2F5GA 4ICLB 2DPJA 4ED8A 4B9TA 1S6OA 1UP1A 1CC8A 1V5VA 4ZCMA 1ZA1B 3GSDA 3MPYA 1S1XB 4DL4A 2V8GA 2NSBA 2ZZNA 3N6NA 4PQUA 2RJZA 2VH7A 1RWWB 3W1YC 3D68A 4KRWA 2OPQA 2HPUA 2OPPB 1H6KX 1NHVA 3DLGB 3SFGA 3IAS9 2EBEA 3ONQA 3TX0A 2V50A 5BJRA 5DDPC 4EYHB 5IFMA 2BEFA 4LFCJ 3MM7A 3CDAA 3MEEB 3PO4A 1YG0A 4NLOA 4ZLJA 4NLVA 2LECA 2XMVA 4DR6F 2P6TA 2RHSB 2YKNA 4Q2MA 3H87C 3W8GA 2R2UA 5JVGQ 5J2QB 2R7WA 2RRAA 1U4BA 3KMSA 2IBOA 1S1WB 2Z2MA 3CJ4A 4USJC 4HT5A 1K8AT 2HLUA 1QE1B 2DHXA 3IWXA 2V4QA 1ZM2A 4LBPA 4MAKA 2WVEA 2DCUB 2LXIA 2YQ0A 5KTQA 1NKCA 4JI3J 3GILA 4QWBA 2JWNA 4OJHA 2WZ1A 4IG3B 1X4HA 1FXRA 1W2IA 3E51A 4LF7F 2FQQB 2GNKA 2DNNA 2QA4S 1WC6A 3HSDA 3H0PA 1HNWJ 3GFYA 5KFQA 1M5VC 5BR8J 4EUVA 5FD1A 1LNQA 2KXNB 3EVOA 2OLWA 2Y0BB 2HW3A 1U1QA 4X4PA 1C4CA 3M2UB 4Q45A 2KT5A 2CFXA 3QSYB 1PGZA 1QTGA 1QE1A 4M5LA 3RBXA 5JVHQ 2FHMA 2IFXA 1HNWF 5IT9U 4RBTA 2Z8QA 4NLQA 1HKAA 2L48A 3I6PA 3GV8B 4OHXA 3SCKE 1LK7A 1RLDA 2K1RB 2AQ4A 2HFSA 2EXUA 3DYAB 4QZVB 1UEUA 2VHGA 2E29A 1FRLA 4F0MA 4DV6F 3OHBA 2B9XA 1T02A 4A48A 4IO9Q 2P6SA 2DBBA 5D78A 1TU0B 3ZO7A 2CQPA 3LF0A 2PDAA 4FNIA 1AYEA 4WE1A 3HX9A 3M32B 5IQ6A 3E2EA 1GNKA 2QYCA 2FVPA 1GMWD 3HMJG 1NK0A 3NO7A 2KT2A 3CDWA 4XO0A 2KG0A 3GE9A 2R2RA 2ZBPA 1RCOB 1CJUA 3W64A 1SKWA 2XYPB 3G87A 1PJ6A 3R9LA 3DC2A 1SJ4P 1HMVA 4OZNA 3PFEA 1H0HB 2FDNA 3L4BC 3THPA 4IFYB 4TVAB 2YX4A 2MY8A 4DSIA 5F8HA 1KHWA 3WIUA 1VRUA 1YJTA 2IJFA 4B02A 4BBYA 3SQOP 4Q5VA 1VQNS 4K4UA 1V5IB 1HQUB 2CQ4A 3TRGA 4PXCA 1WUUA 2E1MC 2V4RA 5DG7A 3QLHA 2ATCB 4FZVA 1EX8A 1FKOB 2CPXA 3IN5A 3PHEA 3CCMS 2KVIA 4PPZA 3HP6A 4JV1A 2XMWA 3M8QA 4ENOA 3J7YI 2ZHOA 5M2RA 2AKWB 2DGSA 2DH7A 2YWGA 3B6BA 3ULHA 3OTOF 2Y1JA 2BBEA 3I82A 1VK8A 2V8VA 3MTKA 1FDNA 2V2ZA 4DSLA 1FHTA 3HZEA 1HWLA 1UVKA 4C8YA 3BGLA 2WVBA 5EUHA 1URNA 2YKOA 2KB2A 4NXNF 1UFWA 1R43A 3R5CA 1U7LA 2BE7D 2NXUA 3V4IB 3F56A 1X93A 1BWVA 2AN7A 3IBWA 4I6WA 1S1UB 4EMDA 2HS3A 1UCNA 3GR1A 3MCNA 3BR9A 1BWEA 4IG0A 1NNDA 3SEOA 5CYQB 1VDHA 2QL5B 4M94A 3M32A 4N56A 2CDRB 4PABA 3ILLA 1GMVA 4DL7A 1VHFA 2OO4A 1P9QC 2B56A 3N28A 3QZ7A 4RU2A 3OTDA 2IC3B 3OV7A 1OYEA 1VIOA 3JYTA 5E3CA 1CPZA 3T9ZA 1XERA 3HDSA 4M5NA 2EVZA 4OZ1A 4QYZJ 1N36F 1NK6A 1N52B 1U6ZA 1VK3A 4O3OA 1F1BB 2W7AA 5L9NA 4J9KA 4IFYA 4YN3B 4AUKA 1Q7LB 3L7OA 3ZZOA 1JIHA 5RUBA 1CJTB 3KDOA 1VRUB 4WYWA 3VAMA 1JKHB 3M8WA 3BSCA 4OIXA 5D6GA 4CO2A 2F4VF 2Z0GA 4TLRA 5KT6A 4N41A 1C2PA 2RQKA 1SB6A 2LYVA 1RSCA 2ZVSA 6FDRA 3KLIA 3MXHP 3G4SS 2ZH1A 4I2PA 4YQWA 3W5ZA 2F9JA 4OYZA 2W2MP 2QA2A 3KTQA 3IBCB 2OKQA 3HD2A 5CHCB 4YY3J 3H5YA 3U7JA 5CCMA 1Z1ZA 2E7XA 2YNHA 1Q8BA 2NSCA 3B8HA 4IFVA 1VHIA 3K7RA 3UI3A 1FDBA 2ADBA 1TKDA 4RW8B 2E7WA 2N3OA 1R8AA 3D0GE 1N6QA 2DR8A 4WCEQ 1Q5YA 8RUCA 2CJXB 2VUGA 1RBLA 2HHSA 1NZAA 5KFHA 3ELHA 3JSYA 3T41A 2DNLA 2C2EA 1S9EA 3HHEA 4NLXA 3I31A 4ZP8A 1MYLA 1ZM3A 3OPKA 4KHRA 3OTOJ 2X7IA 4EO8A 2RDIA 1HNVB 3EZOA 3IA0A 4MK7A 3OW2R 3IP0A 2M3DA 3I9V9 4JV2A 5J2NA 2V67A 2VA3A 4LRBA 2BJ9A 4UTGA 1AB8A 2BKPA 2BZ2A 3QO9A 1ZAWA 4FPIA 5E33A 3UNYA 2UUCF 4F25A 3TOQA 3TEGA 4W4MA 1U02A 2YWEA 3CGIA 2LU1A 4OX7A 5D0GA 5KFOA 3CCJS 1D9AA 1EAYC 2WB4A 3LAMA 3GFZA 1B64A 1T9TA 4Y2IA 4P2SA 4UOHA 4JYAF 1F5CA 1GX5A 2ZOMA 1MWZA 2GVDA 3J81Y 3BQ2A 3WIVA 3H25A 2DYAA 2GJIA 2UZAA 5E3PA 2NS1B 2DISA 5GMEA 4JI4J 3BGOP 3RW6A 2CJYB 2C2OB 2BE2B 5KOWA 3KLFB 4JI2F 2DT9A 4C3KA 1U1RA 4G1QB 1IWGA 2MGZB 2GFFA 3O5TB 4ETZA 3V6DB 4NXMF 3P6YC 3RAQA 1ZA2B 3RJMB 2VJVA 3FVYA 2VF3A 1HNIB 3C6UA 4H4MA 4OX9J 3K8VA 2XLKA 3BYRA 1FRKA 1F6TA 3CVKA 1EQMA 2Q6CA 2K7KA 4NWBA 2N3LA 3POTA 1VQPS 1PKUA 2HSEB 4BDPA 1A9NB 1TL3B 2F7VA 5C42B 3L7PA 3H8YA 3TO8A 3JXOA 1UFKA 4KPCA 2RRNA 1TKXA 3OL6A 1LWCB 1EJ7L 4P9SA 4RL1A 1D8YA 2IDEA 2KDOA 3BS9A 2GHWA 3UFCX 3ZTSA 4CLPA 2KFNA 1HWIA 3LP1A 2FGOA 4PG8A 2UXDJ 1X9WA 4HT7A 4Q0BB 3LP2B 2JX2A 3EUNA 2PMZD 1OY8A 2G0CA 4Z37A 4A4JA 4IOCQ 1M5HA 2M5YA 4IR9A 2ZZMA 1VBYA 3WC0A 1JLCB 2PI4A 2BJ8A 1ZPWX 2GC8A 3K8WA 4HLBA 5SUHA 4WKYA 3UD4P 3LOUA 2K3IA 4QR0A 4NCAA 1Q1KA 4DV7J 3MPVA 3MM9B 4C8NA 4ZPBA 2HVIA 1HWJA 1NLKL 3IGVA 3IRXA 2B5JA 4R8UA 4KHPF 3FJ2A 1KLMA 5KFVA 5K8PA 4OMFG 5ETVA 4PUOB 4ID5B 4H4KC 4TY9A 1WHYA 3MAAA 2OJ3A 1C4AA 3P49B 3ZZYA 1T05A 1NSPA 4FXDA 3M8QB 1AUDA 2JXGA 1QSLA 2V8PA 4NA2A 5F3ZA 2AJFE 1MU2B 1NJZA 3MCSA 2HKEA 4M5DA 5D4PA 1FNXH 2E5LF 2V9WA 2VQEF 3DLEA 4JI8J 3NL0A 4ZHRA 1JLBB 1UJ5A 1JLAB 4DV3F 3R6LB 2R7SA 2GPEA 2E5GA 2I1RA 2K7JA 2MKCA 4LF5F 1FJGF 5DDQC 2JEIA 2MZSA 1HMVB 2FIUA 4PKDB 4M95A 3JAMY 2JDJA 3V2UC 3QIPB 2WVDA 4ZP7A 1O6XA 2VG5A 2RB7A 3FSXA 4Y00A 2A6MA 2BM0A 2POKA 3BREA 5B0EA 3UR3C 3HKZD 3MPUB 2B9EA 4P52A 2Q6BA 5A8RB 3HO1A 3DLKB 1FFWB 4YP3A 4HH0A 4F4ZA 4OZ5A 3V6KA 2GAGC 3DOMA 3TVKA 1IKXA 2R2TA 3EGZA 4NLDA 4WF9Q 1G3OA 1YGYA 2K8GA 1IKVA 4M8LA 2HFUA 1KQGB 2D41A 2HHUA 1TK0A 4ZLLA 4Q2LA 3L9ZA 4WTOB 1U2FA 4WFNQ 3ENWA 4LFAF 3IBFB 3HVTA 1QUPA 1S59A 3CDUA 2YKMB 1U9PA 2YX7A 3BKTA 3FEXB 3H2VE 3NOCA 4FYYB 4H4KA 3WZ0A 5C25B 3T1YF 2AW0A 4I4BA 3G6ES 2VBZA 2G2ZA 4ECQA 5IC6B 1HW9A 2ADCA 5B7WA 1RQ0A 1UETA 3QAUA 3S7RA 1S9GA 1RU2A 2MQMA 3K59A 1PCAA 2QEXS 3Q2TC 3OL7A 4UF4A 4J9SA 5E41A 4CO1A 5D0RA 4I2PB 5LMUJ 3PW2A 3D3BJ 4RUHA 3AB4B 4O0IA 5A8WA 5CZXA 1KOOA 1VQYA 1CJUB 1UFLA 2YTCA 3D6FB 4ECVA 1WG4A 4IOBA 2R3VA 4ZP9A 4PUOA 1SH0A 3PXGa 3FQKA 3L3CA 5F8GA 3EZ5A 1NPRA 2WSCC 1Q82T 1H7WA 2F9DA 1D0EA 4TY8A 1JWWA 4XDCA 2BQUA 1O5JA 4YR3A 4GKJJ 3WDOA 2KO1A 4QW9A 4DV4J 1NJWA 1YBTA 2VDHA 3IGNA 2J8AA 2MZRA 3OFEA 3F0NA 1ZPVA 2GVZB 3N4WA 1S0NA 2H65B 1PYTA 4U95A 3ENQA 1SQFA 2MQNA 3H5SA 2H48B 4ZPDA 3MPWA 4F26A 2WONA 5LMNF 4DR2J 3AA9A 3AXKA 3HJVA 1NK5A 1RT4B 4OHWA 1WI6A 2M8HA 3W61A 5J2QA 1S79A 2F63A 5IZHA 2VICA 2K1RA 2W2OP 2VIHA 1U1KA 4B3SJ 2XO7A 2HHWA 2DNHA 1ACMB 1RT3A 1I3OB 1VFJA 1WDDA 2N4DA 1ZAVA 4IH5A 4NLPA 2AX0A 1L3KA 3MR3A 5J2PA 4MYUA 2PEHA 2W25A 3BBBA 1GMUA 2UV8A 3DRYA 3PYFA 2OMOA 3AHPA 4FPRA 4X4RA 2W9BA 4EEYA 2NLWA 2OPSA 4LT6A 4FYDA 2BKOA 3W66A 4DJBA 5IM0B 3V5RA 1SQGA 2WAQD 3OLBA 4LF4F 2EG2A 1NPKA 1IQZA 3I5AA 4TU7A 1NH8A 1PG5B 1CULB 5LOQA 1KVKA 4M5DB 2UUBJ 2KKHA 3W62A 2ZNYA 3KK2A 4JI5F 4QWEA 3NMRA 2B9YA 2CQCA 3QT6A 4DR4J 1S5ZA 1GXUA 3EJMA 3PNIA 1FJCA 2C3OA 3ZXWA 2W2PP 2XMUA 2OPQB 2V63A 3GTYX 3NOGA 2UXBJ 1UAWA 1YRTA 5DLFA 1VS3A 3H40A 3RAXA 2XLIA 3PYGA 4LF5J 1FJGJ 4HKQA 3MEEA 2ZDPA 4MIWA 2YNIA 4C8LA 4Y28C 4E98A 1SIWA 3OJUA 3UDVA 1MWQA 2GVZA 4C4WA 4K4ZA 4FP9A 3R1HA 2PI5A 2ZD1A 2HYIB 2BQRA 5KOXA 1F9HA 1SUQA 3R6GB 3MR2A 2F4FA 3DGPB 1QVFR 1S0OA 4ANCA 4PG6A 4PXEA 2RS2A 4F02A 3PW4A 4MIBA 3D0HE 1HBNA 3OVSA 1S76D 4FYWB 3SV3A 4ECXA 1S6PB 2J0XA 3CD6S 3DLKA 3R5GA 1O0PA 5DLGA 2AYGA 1RP5A 1SKUB 4IRDA 5HP1B 3THVA 2QSWA 1N33F 2HHHF 2CWXA 4EBDA 3VWSA 3EX7B 2C2DA 4A8FA 4IO1A 3ZZTA 5F9LA 4DV6J 4AD6A 1OQ6A 2QG9B 3TA0A 4O3QA 2AEMA 8AT1B 2HAIA 2E44A 4R0JA 1TP7A 5A2QY 1ZTTA 4ERDA 1SUQB 3AQOA 1U1MA 3I4HX 1S1TA 5J2NB 4YB1P 4EU0A 5DM7Q 4OV1A 1VBZA 1N5QA 2AP6A 2K29A 1WD6A 2RHQB 3TA1A 3OFGA 1VBKA 3SFUA 4IG3A 1WWHA 1P1TA 2DY9A 2Y8YA 3VGSA 2HFOA 1OSDA 2V94A 4GO7X 2J7KA 1BGXT 2CZ4A 4CT8A 2EFQA 2ZBQA 3HSJA 1NU4A 4CM2A 4CYUB 1CEZA 4WIQA 2DNQA 3CJ0A 5GADU 1URRA 1H2UX 1KOHA 2ZFHA 3HCXA 1FRHA 4GVBA 1X9MA 1FEEA 2GVDB 1VLYA 4IH6A 2FZKB 4NA1A 2WONB 3FT7A 5EX3A 3UE2A 5DETA 1U6FA 2KXFA 4CLYA 1OG7A 2I6WA 5KFCA 1CSJA 2MEWA 4IDKA 2L9DA 2Y3YA 3MMCA 3QIPA 3PO5A 1Y3JA 2Q3PA 1P6TA 2R8IA 3CW2C 2ZBIA 2FJAB 1IBMF 4WZMA 2ASJA 4WFXA 1WOPA 2I38A 4HI2A 1T03B 1EKRA 4I7FB 3W60A 1X0FA 4JI2J 3TJ9A 2RU3A 1CJTA 3DNCA 3OHAA 2CNOB 2YNFB 3JAMU 1HNVA 1OO0B 2CNNB 1NMEB 1IKYB 3KG0A 1WC0A 1XR6A 4JB8B 3CD0A 2GX8A 1VQ4S 4NE9C 3L09A 3X3UA 3PEHA 4CO4A 1T3OA 2RUGA 2CJAA 2DGUA 2FJEB 3TR5A 1X0PA 2HRYA 1OY6A 2XWYA 4LFBJ 3QAEA 3VW4A 4E2FB 2CPEA 4QIFA 4LSLB 2FC9A 1MMNA 3H4BA 1IBKF 3OL9A 3GFXA 1T03A 2KM8B 2VG7A 1OYDA 3DYAA 3FCVA 5KFEA 1RWXB 3CCWA 2K2PA 2HVEA 4B3MJ 3PHTA 2IM2A 3BBCA 4LREA 1RT7A 4YDDB 1B0VA 2D7SA 5BR8F 1P94A 3DOKB 3G82B 1NKEA 3Q2SC 3RRKA 3R8YA 4DCOB 1DURA 4NL5A 1G1XA 3CCTA 3CSKA 3KLFA 1NK9A 2CZ9A 5FJ4A 2HQ3A 4I68A 1DTQA 4KGKA 3LP0B 3LGMA 1FVQA 4PRFA 4QPXA 2G1DA 4ZN3A 2RNEA 3K5MA 4DXLA 4B3RJ 2NYHA 4OI2A 3QBCA 3K5NA 2D3O1 1ZBTA 4LR7A 3C15A 1R3NA 4D3HA 3TUZC 5IT9Y 2RT3A 4KGXB 3BO3A 1HBUA 1VJQA 2IM1A 1T9WA 2L9NA 3MM5A 1S6PA 3D0IE 3DHXA 2AD9A 2J0SD 4F0KA 1S1VA 1VMBA 1H74A 1TL3A 3EVWA 2WW8A 1S99A 3DMJA 2PIIA 2XMMA 3LQVA 3P5TL 1I5OB 4TYAA 5HP1A 1SKRA 2BKNA 1WDTA 3AFGA 4EK2A 4ED2A 5KFJA 4UY85 1KSPA 1FJ7A 3DLBA 4CP5A 1XNRJ 1XN9A 4ZHRB 1H38A 2ZD1B 2IVFB 3AAWB 1BD6A 4WFZA 4PWDB 3HHLB 3MD1A 3LUYA 2KU7A 2HFZA 5CABA 1Q8IA 5H9EK 2J9CA 5KFZA 1GXLA 4MFBB 5FIIA 3PTWA 1NRKA 2JBVA 3CIZA 3CPWR 4F50A 3FRYA 3RU0A 3CO0P 3KLEB 5DGBA 1IBMJ 1OMSA 3K17A 2VOOA 2OHDA 3D4JA 2B51A 3SCLE 9ATCB 1Z2ZA 4DFPA 2HMIB 5DZ7A 1FD2A 2O66A 5HANA 4B17A 4GC6A 2E5JA 1K73T 4EZ6A 3I5CA 3NS5A 2VFTA 3I0SA 4DDFA 3SXLA 2Z2ZA 3T6JA 4DN0A 4DX5A 2M8DB 1FWPA 2LDIA 2WRMA 4NRUA 5ETNA 2KRRA 2CDQA 2E66A 1PJ7A 3GXQA 1XTZA 2GV1A 1E6YB 4L3KA 4WBFA 1DJ0A 5HMYA 2KG1A 5G0RB 5E3QA 5HQMA 4B3TF 4P7TA 1DQ9A 5KFMA 2DNOA 2C1EB 1CBKA 1E6VA 1ELOA 2LP4A 3JSBA 3GYNA 2HFVA 1DTTA 2DXEA 1YX2A 3F44A 2JNJA 4M5KA 5KFLA 2GHPA 4TNOA 1AZSB 1JJCB 2L3MA 2W01A 4RWXA 1LOUA 1HFEL 4ZPCA 1HBMA 1REVB 3VAGA 4LRFA 1IVZA 1QAIA 2PSZA 4I7FA 2Z2YB 2BW7A 4L6V3 2P9CA 1JXVA 3RB0A 3DI6A 2LXFA 3TVZA 3FMTA 1E6YA 2EKNA 2CG8A 2W9CB 2CQ3A 2M0GB 2G2OA 2XNRA 2DY1A 4DL0C 4Y0FA 1NK7A 2GIFA 2OSRA 4QWCA 2IPOB 1CJKB 1HQ2A 2DNMA 2GMJA 4Y3CA 1TFYA 3UW1A 1TVRA 4X65F 4ED0A 1ZH5A 4CZCA 2PFDA 2R7XA 5GAHU 2OEKA 4ITSA 4ZJOA 2VQFJ 1L3SA 2D1CA 1XR5A 2PEBA 2EFVA 2CPHA 4EWTA 2OAUA 5AXNA 3KHHA 4MKYA 1RZMA 2RIJA 3KFWX 3M8PA 1PC4A 3KLIB 4KC5A 2AYMA 4J9PA 2JEFA 2NR0A 5K20B 4A47A 2ZM6J 1HBOA 5IXUA 2DITA 4DV7F 1SV5A 2QGFB 3CB4A 3HKWA 1WF1A 4DR1F 4PWDA 2G0IA 4CNZA 3PVXA 1RXOB 2WBRA 1ZS6A 2YY3A 3MPDA 3UVJA 4IFVB 1RWKB 3BPSP 3CDBA 3OFFA 2RAQA 5I3UA 5B0GA 1JQGA 5HMXA 1FE4A 4I6AA 2HIYA 4KAIA 4KB7A 4UZBA 1X5OA 2ZZTA 1S0MA 2XY5A 4MJWA 3RB3A 3VQSA 3HFKA 1T94A 1RT1A 3QQCD 4F4KA 1HL6A 3MEDB 2UXCJ 3IR5B 3M30B 2A2BA 4JP8A 2NQPA 4P2FA 3NNEA 3Q86A 3PY8A 1FFSB 4NMLA 3OUYB 2O1PA 2IJNA 1TKTB 2HEKA 2J9DA 3K2YA 4KGZB 1EKSA 4RPFA 1IKVB 3GQCA 3OT9A 4LUBA 4OZJA 1TV6B 4I0WA 4MK9A 1YITS 1IJEB 4FS2A 3FFIB 3GG0A 4ID5A 2WTFA 4IRKA 1XNQJ 2MDAA 3ISNC 3WBZA 3RB4A 3QNWB 3MM6B 3MTJA 2UVRA 2VOPA 1C1CB 2LEAA 1GEHA 3VV2B 2IRXA 2GMLA 1WJ9A 2X3GA 3CMES 3UQSA 4F0HA 1EQ0A 3TUJC 4F4WA 3FCHA 4J7CA 1M90T 4WK3A 5I3QA 4KIAA 1NLAA 2YKQA 2HQFA 3GYGA 1JLAA 5K8NA 1YZ6A 1S48A 2OI2A 4USTA 1XC9A 3CF5Q 1VQ8S 1BXNA 1XBWA 2XHCA 2L08A 4KHMA 3Q8YA 4LIRA 4X64J 2LQ9A 3DRPA 3I87A 5KFWA 1DTTB 3G6XA 2B4VA 4XK8C 4DX7A 4MKBA 1J5EJ 1XMBA 3SQGB 5KFTA 6AT1B 3DOKA 2D3ZA 3DLLQ 2AYBA 2W8LA 4HV0A 4KPYA 4FYVB 3HJFA 5FDLB 2DGWA 2OEJA 1C1BB 1BAZA 3MMBA 1KD1T 4IUFA 5CA5A 3CCVS 4DV5F 3CJRA 2XULA 4NCBA 2AU0A 2KVQE 4KR0B 2DNRA 1VLOA 1S12A 4K4VA 2HHVA 1JMTA 4PG4A 5LJ3Y 2KJVA 3PACA 4FVMA 4U9RA 5KT3A 3H59A 4P2MA 5D77A 1HLWA 2WSFC 1SXLA 1HHSA 2DJWA 1T8EA 4USVA 5L1IA 3PRVA 2HGMA 4YY3F 2KH9A 1S72S 3NEKA 5CQGA 4FBTA 2XCAA 3TVYA 2V8DA 3J7A1 4K50A 3L7UA 5I3PA 4B08A 3HFVA 2ZE2B 1W26A 5ETRA 2JVOA 3PX4A 4USHA 1BDVA 1RAJA 5MLCV 3B4DA 4J5OA 1N5YB 3QZ8A 1H2TZ 3CEDA 1QY7A 1Y11A 3O3LA 5KFAA 3OSNA 2D69A 3KLVA 1QAJA 3GONA 4DFJA 1UPMB 1BC6A 3OD2A 5I3UB 1R6YA 1VQ9S 1NBEB 1RAHB 4JI7J 2XMAA 3TEHB 2UUBF 2ZNZA 4H4OA 1WNEA 3QRQA 1WEXA 4UUXA 4CWBA 1UL3A 2MQOA 1JX4A 2N4CA 5DZ6A 2GQQA 3OJSA 3P96A 1HW8A 1HBOB 4KJIA 5D4NA 3EXYA 1FDDA 4C11A 4CI0B 5AE1A 2FVRA 5M2PA 4B9NA 3MF5A 5L38A 2AZ3A 5HN0A 3R3TA 4NZ7A 3SSQA 5FLXU 3L95X 3KK1A 2CVEA 1RTHB 4R25A 3AJ1A 1PBAA 5FLXY 2MGZA 5EN1A 3CJKA 4QU6A 2B5JB 4NRTA 3GPAA 3FMWA 4I56A 1FX2A 1RB0A 1U0HB 3DXSX 3BM7A 3QGGA 4NXNJ 1MW7A 2IAJA 4LBHA 3VALA 4OQJA 1B28A 3GFHA 3DOMB 5KT7A 3R5DA 3U1LA 3GIKA 5ETLA 3PX6A 3RW7A 2Z57B 5KFIA 4ZCIA 1HD1A 4MH8A 3G86A 3GV5B 4PXBA 2P8IA 2BJDA 3QT7A 5B08A 4XDDA 2BMBA 4DMZA 2ACMA 4V1Ak 4E8UA 2Q2KA 2HRUA 3FEYB 1S4EA 1KONA 1FWKA 3BSAA 2XYGB 1V3ZA 1LWXA 3ILOA 2R7TA 4ED5A 4PQUB 2H5EA 1EB0A 3OFHA 3HULA 1SPBP 2ZOFA 4TXSA 4M5HA 1ZETA 2OPSB 3Q8RB 2R2SA 2XHWA 4C3MA 5C24B 2Z4PA 5D0HA 3DFEA 1WEZA 3PR4A 1TR0A 2CAXA 4U7CA 3M6UA 4ID8A 4NEYA 1S6UA 1EP4A 1FTCA 4QPTA 4B9UA 3ILIA 3KNGA 2IRUA 4OL8A 4ER8A 1HI1A 2LVWA 3EPIA 2LXUA 1Y5IB 2VB6A 5E3AA 5L8RC 3Q23A 2FLNA 4BS2A 5AE2A 4RNHA 3UDLA 4GVBB 2QJ3A 2HS0A 1GK8A 3BPDA 3UDCA 5C5JA 3TZYA 3IFEA 2I2YA 4NYOA 1BE4A 2RUSA 1IBKJ 3QJPA 3VZIA 1U49A 4ZVSB 2L9WA 5HQ8A 3EGNA 1RAEB 4RBVA 1I1GA 3IR6B 4OX8A 3TWZA 2FYXA 3GSIA 1H3DA 3ZFVA 3NGDA 1NK8A 3CMQA 2WCXA 1UWBB 1X4CA 3ZZUA 2CG4A 2AGOA 3FBCA 1XR7A 1NXIA 4QBUA 1HYSB 3NNCA 5IM0A 4UQTA 3MECA 2VC1A 4DPUA 2BW2A 3BBFA 3IO1A 3KYLA 2LMIA 3MR6A 2W7OA 5G4DA 1YJRA 3MCOA 4M5IA 3GB0A 3FK4A 3P3DA 3K89A 3AOAA 4CH7A 4QU7A 2VDIA 4GO5X 2Y1IA 3D2WA 2ALZA 2PA8D 2R42A 3I0RB 2HNYA 2HVZA 3Q8SB 3O8WA 2XI2A 2GMHA 5H9EJ 2BR0A 1TL7B 1YQHA 3A1YG 5DDOC 1UVNA 3CULA 2D9OA 3NBPB 3FNNA 1M0SA 2QTWA 2ZITA 3M6WA 2AJ0A 1AZSA 3PRBA 2XG8A 4NMXA 3PZPA 4LRAA 2DHGA 1NH7A 2C28A 2VD3A 3Q8VA 3UN2A 4FF2A 3OXGA 1YLXA 3SV4A 3RR8A 2DXFA 1IBLF 4ANDA 2HGLA 4BWMA 2NXNA 3I55S 2LU2A 2LQ8A 3PW7A 5KT2A 3KJVB 4USMA 1EETA 1HR0J 4OYOA 4QIVA 2XS7A 2VKRA 4ZP6A 3NP5A 2SXLA 4ANEA 3DRXA 2FGCA 4ZVGA 4ILMA 1X4GA 4Y2KA 3VAFA 1B0TA 2BUNA 4DFMA 4HVZA 2DGOA 2JVRA 2BJEA 2H3AA 2DTJA 2OFGX 4K7QA 4DU7A 2DRAA 3QLHB 1Y0HA 5KG5A 4TQSA 2ZUAA 3UO0A 3T5KA 4LF8J 1LWEA 4OZ0A 1WHVA 2VV5A 3R2DJ 3T3FA 4F2SA 2HWHA 1P8GA 3VGVA 3W7BA 4IKAA 1RT6B 1V9OA 2CQIA 2JLFA 4K8RA 2QN6B 3JQMA 5LL6d 2KZMA 3D66A 1J5OA 4CLUA 5DQIA 4TU8A 1FKPB 4OZLA 3UVJB 3VF0B 2KXHA 1S6QA 4NOHA 3BGFA 1W7WA 4HL9A 4BCAA 3DOLB 5HVGA 4F4XA 3V6JA 2E9RX 3CJ5A 3LGNA 1B01A 2RF2B 3GG1A 3C2PA 2GJ2A 4M1KA 4B3OA 1JLGA 1PYOB 4BLGA 2A1BA 2APOA 4O23A 2QA1A 2FTRA 3I9ZA 4I2QA 1L3TA 2WK4A 4DR1J 3DRSB 4B9MA 3ETOA 2MB0B 1MROA 2RVJA 5GAGI 1FF2A 2HMIA 1YVFA 4KGMA 2V68A 1TMJA 2JLEA 1VQLS 2F65A 1TKZB 1RT4A 1RTIA 2QIFA 4X66F 3S6EA 4L74A 4QCLA 1N32F 4FXVA 3MAHA 1K1QA 4JI5J 1Q81T 1TKTA 4X4SA 1KS2A 3M2UA 1M1HA 4WJBA 4CM0A 4CH1A 4JV5J 3AODA 1B99A 1U1OA 1R8CA 1TV6A 1AROP 4MKVA 2ZEJA 9RUBA 1OHNA 3JSMA 2M4MA 1YTYA 1IKWB 2DKOB 2B4OA 3JB9k 1MMLA 2C2KB 3HSZA 5GAEU 3KHLA 1FFGB 4ZPWR 1VQSA 4USWA 5F0UA 1RA7A 4A46A 1ARRA 1CQNA 1F3VA 1WKKA 3ZC4A 5D15A 1KN6A 5THWA 3IM9A 4KBIA 1TKXB 2MTLA 1JLEB 1ZM9A 4RUBA 3ZTPA 1WC4A 3OSPA 3NGTA 1DFDA 4JOUA 3BSOA 2EK1A 1KQKA 5KFNA 2DRBA 1M5PC 5LM7E 3EPGA 2LCWA 1BY9A 4NEZA 4DR3F 3I4PA 5EHHA 3RBZA 1Y3KA 3GIRA 3J7ZT 2AYEA 3PCOB 2W7PA 2VFSA 1VC0A 1AFIA 3GMGA 4WFBQ 4DF4A 2VODA 3AJDA 4DZ6A 1AW0A 2J76E 4ATNA 1KLNA 1YK9A 2U2FA 1C0TB 3QYYA 5B0AA 1KTVA 2RDDA 5DO2A 3VTIA 3J7Z5 4DLGA 3QT8A 1G4CA 1R0CB 1RHUB 2BRLA 4K0KJ 2VBYA 3QT5A 2E9TA 1QJHA 2AF6A 2GQ2A 3PM9A 3R27A 3LWLA 4DQSA 3M8PB 4XIUA 4WP8A 1U6BA 4C8KA 4ZLPA 2OD4A 4DV1F 3T1HF 1UWAA 3D9BA 3HHLA 1YJWS 2FVSA 2JEJA 4ED6A 1F60B 4IR1A 4LVOP 1HPZA 4U7UD 2RD5C 1V3RA 1PO6A 4U67Q 2ASLA 2HLTA 2NCKL 4JI0F 2CPFA 1J27A 4F36A 4UQGA 1HNZF 1G7CB 4DR7J 4EGLA 1PARA 2XMKA 1HA1A 4KKOB 4FDFA 4X4UA 1WTBA 1VGYA 2KL8A 3M6XA 2QLXA 4FVCA 1HR0F 4LF7J 1C0UA 2KYZA 2PC6A 5AJ3J 2NXCA 3AA8A 1RISA 1I94F 3FZ2A 1IBLJ 4LRDA 2BRKA 2ZE2A 2FLOA 2FY8A 2R4FA 3J7YU 2AHOB 2MKKA 3FZBA 2YKNB 1RDRA 4BWJA 4DPOA 1S10A 4B3RF 7FDRA 1U1LA 5KFUA 5L46A 4ES1A 4W92B 4LFAJ 3TYTA 1N34J 3BDEA 1JB0C 4CIOA 1XNQF 1U26A 1EIYB 4OJ3A 2JZ5A 1RCXB 2YKAA 1SJ1A 4EBCA 4ELVA 3OTCA 3KLEA 3BKFA 4QIEA 4USIA 1ARQA 1UJ4A 1HWKA 4HACA 1ROFA 2DD8S 3MOJB 1XEZA 2CNKB 3AB2B 2FLPA 2KKEA 2KFYA 2V8HA 4J37A 1EA4A 1RHJB 2EW9A 2ZKTA 2QV6A 5GVQA 3TAMB 3TNVA 3QO9B 3C3LA 2FVQA 5GAHI 2B7CB 3IXQA 3JS9A 3MUVP 4LFBF 2DRDA 2J7UA 1WG1A 1LWFB 2MQ8A 4KFBA 5E0OA 1H98A 4UZCA 4DX6A 4DG1A 2XZWA 5KFBA 1UMJA 3KHGA 1OIAA 3H4DA 1MROB 5JJBA 1HBUB 2DIUA 4IRCA 5A8RA 1RE1B 5IQQA 2FUG9 2LFVA 3CXCR 4A8YA 2F8HA 3F73A 1N56A 4F4YA 2BNWA 2ILZA 4HHHA 1T95A 1JJHA 2N7YA 3H20A 4ZJQA 4XAKA 3BF4A 2DR6A 1RJJA 4OLPA 1WELA 4OJGA 4YUDA 2E5IA 3SDEB 1HNIA 1RWMB 3C6UB 4H4MB 3A8IA 4QR1A 1LQ9A 5IT0A 3CC7S 3A4TA 3ZTQA 5L39A 3T5HA 2IM3A 4ZVEA 2VJUA 2W4PA 4O0NA 1LEOA 4LSNB 2UUAJ 1CS4B 1NSKL 4ALZA 3J80U 2EFPA 3FGVA 2ZVIA 3G82A 4DEZA 3M30A 1UVMA 2MKHA 3MI7X 2E5HA 2FPHX 3E01A 3W63A 3OUYA 2ZJRQ 2R7RA 3FC9A 5E2QA 1X5TA 5HL7Q 5CZVA 1M1KT 1B4SA 3FBBA 4OV6A 4RBUA 2W1BA 4O4GB 3P5BP 4RW6A 5AXLA 5BYRA 5T41A 3W5XA 1D9DA 3G8QA 3MMAB 3OTEA 3P8BB 4DPYA 2F8MA 4RU9A 4ECYA 3CJ3A 2HZVA 3RRGA 4K2JA 2KT3A 5HAOA 4CQ1A 2OFHX 2VPZB 1NSAA 2RQ4A 3Q8UA 1LKZA 2WHOA 1GXTA 4WWSA 4ED7A 3N5FA 4OI4A 2K06A 4DOZA 1C1CA 3TW0A 3T1HJ 2KRBA 1X5PA 1OY9A 4ELTA 3IG1B 4NCGB 5DJBA 5SZTA 1UWBA 4ECSA 1SL1A 2K3KA 2VPXB 1U48A 4K2XA 2KTQA 4LF9J 1S1UA 3AOCA 4FXEA 2RMLA 3GJSB 3M2RA 3KK3B 3TP2A 1KHVA 2LDYA 4CLSA 2B9WA 5D3GB 2W2QP 3JQJA 4D3GA 3IAM9 5DM6Q 4NZ0A 2BABA 2DHAA 2ZBRA 4NI2A 4DUYF 4TU9A 2D3OR 5D8HB 4C98A 3IC1A 5HROA 4DQQA 4JI7F 4RW8A 5ETQA 3BJYA 1HI0P 1S1XA 5F8JA 3Q24A 1R8HA 1SCJB 1V6HA 2XNQA 1U0HA 1N4LA 3DGVA 4WZQA 1RKIA 4GVLA 3W9HA 4CYUA 2P5VA 4KV8A 4JUZA 3BQ0A 2MHNA 1K44A 3F41A 5DQGA 4DR4F 2R7VA 4ZVHA 2AIRB 2RE1A 4FKXA 3UCUP 2IVMA 4O3NA 3BQ1A 2E1CA 2DR7A 1NM2A 1RHQB 4Q44A 1TL1B 3CCLS 3GJRB 3NS7B 2ACYA 1Y5LB 2B4UA 2UXBF 1AT1B 2HHHJ 1FK9B 3HD1A 4LJMA 3RRHA 2FHKA 5IWAF 4QWAA 4TLQA 4LF4J 3EXCX 2RKIB 2VG6B 4I64A 4I6YA 1YJUA 5GAGU 3ENAA 5KG7A 2V2KA 5E3RA 1DHMA 1PBUA 4OYIA 1W25A 1SBRA 1RTZA 2QYGA 2BA3A 1IWAA 1HQEA 2RRBA 3DXBA 3AJ2A 3FBFA 3QPIA 1JNRB 2FHOB 2QA4G 4P75A 4N77A 2KM8C 2G1HA 2YBVA 2QMUB 4B3SF 3C16A 2XYHB 2BE9B 2COLA 1S49A 3MMAA 4MTPA 1BUXA 2PA3A 2QMWA 2ROGA 1SKSA 3LGHA 2XC9A 5E5NA 2A18A 2YQ1A 2KHCA 1YIJS 1OJ4A 2V4JA 4P6QA 4PZVA 3C19A 3KK1B 1D3WA 2KJWA 3Q22A 3GP9A 3HHDA 4EI2A 4TKTA 1BLUA 2BOPA 1L3UA 1T9YA 2EFGA 3IS9B 2VFVA 4QW8A 3VR1A 4D8JA 3PIOQ 4ZS6A 1Q16B 2MLYA 5ETSA 1RYRA 5FDLA 2ZBCA 2C3YA 1T9UA 3IWLA 3N79A 4C8MA 3W2WA 5LT5A 5DG8A 4DSFA 4DUYJ 2DH9A 3HHNB 2HQIA 1CULA 2B0GA 2CRLA 3ISND 2NXEA 3QGHA 4KV8B 5HI7A 5K8MA 5EX0A 1VQKS 1SH2A 2V5HG 5EDWA 3CIMA 3CJ2A 4WK1A 4ICLA 4GC7A 2J8SA 3TAQA 1TK5A 3MZIA 2HQCA 4USKA 1U8SA 4DV0J 2H4YB 1RTHA 2KOEA 2M2BA 2U1AA 5IC4B 3S1TA 3ZZRA 3HXMA 4J9QA 2IMWP 4LVNP 3PFOA 3FEZA 4DPTA 3MFIA 3QWUA 4YB7A 3R7SB 1YJNS 3KXDA 1X60A 4FYXB 1N0UA 5A0YB 2VG6A 4J9NA 2R8GA 2K5JA 5DRKA 3W3SA 2Y1LB 4YR2A 3SI8A 3NNHA 3JTPA 1Y10A 3ZZZA 4YHHF 2MSTA 3C14A 3G2XA 4UOGA 2HK2A 4Q7AA 2XSJA 2UXCF 1KR4A 2ROEA 3G9CA 1FRXA 1X4EA 2CPJA 2Y1RI 4QYRA 3TUIC 2BM1A 3D7SB 4R8UB 3ZTRA 4S0MA 2VASA 1MN7A 2D74B 2HIQA 3GCWP 2C3MA 3QRRA 1N33J 1I6JA 3TA2A 4IDKB 4A8WA 4J91A 3VQTA 4R5PB 1Q86T 1X7VA 3EZUA 2Q66A 4JV5F 1CC7A 1RTDB 2W4DA 1NEEA 4PYAA 3CJKB 3HHLC 2MSSA 1XMOF 3MUTP 3ISZA 4H54A 1G2EA 2VA2A 1UKUA 1DARA 3U1NA 2G9OA 1S57A 1WF2A 4K5RA 2WSEC 3C14B 5F8NA 3BH7B 1N88A 1YBAA 4PPDA 2JHEA 3KK3A 3PX0A 1VOMA 2R8KA 1IKXB 2F40A 5F0WA 2X1GA 4N47A 1QTMA 4RNFA 2QLWA 1DTQB 1FO1A 2E5LJ 2A0FB 4WPAA 4K4TA 3FKBA 2YXLA 1U1NA 3NG8A 2LLZA 1PJ5A 1IR0A 2H51B 1FKPA 4P10A 3C66A 4QWDA 3CT9A 3LANA 2RBFA 1DQ8A 2CPIA 4ZA1A 2DO0A 2YH0A 2OMLA 4LR8A 4PXDA 2EG1A 5AXKA 5C2CA 2N7CA 2FJXA 3T1YJ 3MM5B 4DV3J 2ASDA 1JLGB 1RT2B 4I67A 2YWWA 5L1KA 4KKOA 2W9BB 1M1GA 5J1NA 3QJJA 1MLAA 4CLTA 1P1LA 3GIIA 3GWCA 4L76A 2OEMA 3NWGA 4MIAA 5ETOA 5HATA 3AY0A 5I4MA 2JLGA 1JXLA 4YB5A 4DR6J 1K0TA 4ZPVR 5KG6A 1N5TA 3AQPA 1MU2A 1PSDA 1SV5B 4QQBA 3PJXA 5GADI 1XMQF 1RUSA 1NK4A 4I69A 2ZH8A 4LMZA 2CQ2A 4OI6A 4ZCLA 3E8OA 1KWMA 4IQXA 4HTJA 1NDLA 3DLJA 4CLWA 1RT2A 3RAMA 4LQ9A 4CLZA 4C9DA 4U7UK 1X4AA 3BN4A 1P9YA 3VAIA 2HNDA 1Q7YT 3LP2A 2NYIA 4WU3A 3LALA 3ZZPA 5HBMB 2V6AA 3DKDA 2IBKA 1VR6A 1TELA 2UU9J 4JI3F 2WOMB 3FCWA 4ZDNA 5AJ3F 1HNXF 2IA6A 1VQ6S 2M88A 4YHHJ 4NX9A 1TL5A 2DO4A 1Q79A 1UEKA 2EFOA 5ADZA 3DM2A 1S6QB 1NHUA 1UVLA 4TY8B 4LF1A 2J0WA 4X62J 4Y34A 4Y2AA 2D3UA 2QL9B 3SCIE 1LWFA 3IMQJ 4KFBB 5HMZA 1VQMS 1U25A 3CCQS 3GJQB 1CJVB 1TUWA 2CPDA 4HR2A 4NLTA 4DX8H 5DQHA 1UJ6A 1YSJA 1S9EB 1DLOB 1MG7A 3R2CJ 3FQLA 2IRYA 3GU0A 5CYMB 4G1IA 3ILJA 4J9MA 1XWLA 1M5OC 3V4IA 4O3SA 4OI3A 1NPPA 1RWUA 4J90A 5C42A 5HVHA 5F41A 4F7VA 3K5LA 3CCES 3HT0A 2GS8A 3PYDA 2HS4A 4JI1F 2J6SA 4XPEA 3HM9A 4PWUA 2DVIA 3KOAA 5H9FK 5ETMA 4RLEA 4TYBA 3TJAA 3TANA 2BQ3A 3UR0A 5D4OA 4NLYA 3N9UC 4NXMJ 1Y00A 2DGQA 5EGYA 3QWPA 2BA9A 3G6VA 2G0JA 3NLCA 2QRRA 1G6BA 2XO6A 4G1QA 4N76A 3DRSA 4O3RA 3AH6A 3AOBA 3W9IA 4QIGA 4NLWA 1NAQA 2H1OE 1RK8A 1S1VB 4MJKA 2FJWA 1JJ2R 4C0BA 1HBMB 3C46A 1GTHA 3CE8A 5A2QU 4DQIA 5ETTA 2F1FA 4Q8FA 1RAGB 2LEPA 4RW9A 1KQFB 5LMUF 4A8KA 2LQJA 1AUSL 4G3IA 3CWJA 1T9VA 3G96A 2CQHA 4WFYA 1YWXA 2FD2A 5KG4A 3N5BA 1FK9A 1TQLA 4HDGA 3UD3P 3OQ2A 3BKUA 3M05A 3J80Y 3KKFA 2ADLA 4DF8A 1LWEB 1RT3B 1FRIA 1HIYA 2MKIA 1N48A 4A8QA 1RBOB 4PG5A 3KDNA 4FN5A 1S7IA 3NKYA 2FZCB 1MSWD 1X9SA 1S9GB 1FA0A 3PYEA 2GZOA 5A6WA 1Z4UA 1HD0A 3D1OA 2JEGA 2OPRB 3GV7B 4NASA 5KAKA 1U47A 1NO8A 2CXEA 3DDKA 2QLBB 2ZH2A 8ATCB 2A6OA 1Q0NA 2YKPA 2ZC4A 1LK5A 3KG4A 2OPPA 4DZDA 4X62F 1FWLA 1TTHB 1DLOA 3ICLA 2NZ4A 2VFUA 2MZTA 3RZAA 2E1RA 4AT1B 3O2IA 2MHEA 1IQTA 1O8BA 1U8WA 3KWMA 3R5AA 5HK4A 4F67A 3TZXA 2OELA 1VCTA 3DMJB 1S4FA 1TKZA 2CQBA 1OQ3A 3EE3A 3NRBA 4H4OB 5B0CA 4DLEA 4FS1A 3TZWA 3SSRA 4ZMMA 4NA3A 1UA1A 2YNGA 3MHYA 5HLFB 1FKAF 5DGAA 1KVJA 1R6VA 1MNEA 2VU5A 4UUWA 3FDSA 2H4WB 2FHJD 3BGUA 4NYZA 3RGIA 2FHJA 4LF9F 2MQPA 4JI6J 1QSYA 1FVSA 1HPZB 2LQBA 3GYXB 2XCPA 2D9PA 3GCXP 3MDFA 5E7OB 1FD8A 5D0EA 1QD1A 4Q43A 2QE5A 2RSQA 3DHWC 3NY0A 5T7LA 1RKJA 1HHTP 4OHYA 5K9FA 1IKWA 2Y0SD 2C22A 2GHVC 2FLLA 3OVBA 4DL6A 2C3UA 4QJVA 4DQPA 1F5BA 2YWKA 5U47A 3V4MA 1RT5A 3PR5B 1KVIA 3T5LA 2BANA 2GGPA 4DBQA 4P72A 2RDJA 1C0TA 2I9SA 3EMTA 4HH1A 4RWWA 3LJPA 2PO4A 1IUJA 4KYZA 5KFXA 1RADB 4LBIA 3VVTA 3M9MB 4X84A 3QATA 4RZRA 4DV2F 4AQYF 4DS4A 5CAAA 4OI0A 4AAIA 1OPIA 4J9UE 5A76A 4WKRA 3D3CJ 4ZN1A 4RW4B 1WF0A 4GKKJ 2I5JA 3M8SA 3T9NA 3NMAA 3QIDA 2QZ8A 2J0QD 3DLHA 3T5JA 1UVIA 4Q8EA 1B7YB 4P71A 5A8KB 4JBCA 2UXDF 3SYZA 1X31C 1Q78A 2A2DA 4M5MA 3C6TA 5T14A 2BANB 2GGPB 2KHDA 3B82A 4LF6F 4UW2A 5C24A 3KHRA 2CJQA 1PAEX 4ZVUB 5K14A 2QSFA 1H72C 2QL7B 2LQ5A 3IG1A 4NCGA 5CYQA 3H7HB 3RUBL 5KFPA 1C0UB 2ZH6A 4MMOA 3NCPA 1RLCL 5KT4A 3RTVA 2MY7A 3B78A 3S01A 1IM6A 1ZOTA 3US5A 2BNZA 2HBZB 2XMJA 3TJ8A 1U24A 3MEGA 4ZIVA 5A8KA 2EEYA 4X64F 3I56S 4I1TA 1LW2A 1MYKA 4F4AA 3UN5A 3UNGC 1LW0B 3D54A 2QMXA 3W2VB 2V0NA 2I8EA 2V9KA 1ZAXA 4E0DA 2CADA 3PKMA 4C48A 3CD5A 4AL5A 3SZ2A 1Q4RA 2ZWPA 3ETMA 3OXLA 3Q8QB 1DY3A 4KE5A 4HEA9 2EKYA 3HI9A 2ZH5A 1ITPA 2XSJB 5C7PA 2HVHA 4FF1A 4HACB 3LPEA 1YDLA 2CYYA 1X4BA 1P27B 2AJ2A 2J7WA 2NUHA 2QFIA 2XSFA 2Z2LA 1YJVA 4M5JA 1VI7A 1FT8A 1WORA 1UZHA 2DEIA 4PG7A 1CJVA 5KFDA 1NZ8A 4ZVPB 5L1JA 2HNYB 3TUPA 3DU5A 2HHPA 2OTJS 1BQXA 1TL7A 4KSEB 2C42A 2E1AA 1A0OB 2JXIA 4LSZB 4PCQA 4PYDA 2QFJA 3P4UB 3KLGB 3SQGA 1CG2A 3R5JB 1SVDA 1K1SA 2RILA 3PW5A 2KFZA 4FNHA 2IA0A 5LMNJ 1KRPA 4ECZA 4A8XA 4LQ3A 2JL9A 4UY8T 3LH2S 4DV1J 4JI1J 3IRXB 1QAYA 3D1QA 1B70B 5J2PB 5C25A 2Q43A 4CLFA 4DV4F 2FJBB 2P9GA 4C3LA 3DCAA 3LW5C 3W8PA 2DPIA 1HNZJ 4DV0F 4ZVQB 4O4RA 4URGA 3PV8A 2IDLA 4CTAA 3V6HA 3HVWA 1FRMA 1N5SA 3BR8A 3W65A 2R8HA 1S9FA 2GA7A 4WE1B 2H1YA 4ZVRB 5IV4A 2DGVA 3QOQA 2B6AA 2GIQA
chains in the Genus database with same CATH topology
3LGHA 2K6LA 1EA4A 2JXIA 2BSQE 1Q5YA 1MYKA 3QSIA 4ME7E 3FMTA 3FT7A 4HV0A 1B01A 2BJ7A 1BDVA 3VW4A 1BAZA 2K1OA 2WVBA 4FXEA 1BDTA 1MYLA 2CAXA 2JXGA 2CADA 2K5JA 2H1OE 4D8JA 2Y3YA 1MNTA 2CA9A 3GXQA 1B28A 1ARRA 2BJ1A 1X93A 1QTGA 2FGCA 3H87C 3OD2A 1IRQA 2F1FA 3BKFA 3PHTA 2K9IA 2KELA 1NLAA 2BJ9A 2WVFA 2RBFA 2K29A 2BA3A 1P94A 2BJ3A 2BJ8A 2CAJA 3VEAA 3BKTA 1U9PA 2GPEA 3VEBA 1PARA 2AY0A 2HZVA 2WVEA 1Q5VA 2WVCA 2JXHA 3QOQA 1ARQA 2BNWA 2NZCA 2HZAA 3BKUA 2BNZA 2WVDA 2CPGA 2PC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGH A;  2K6L A;  1EA4 A;  2JXI A;  2BSQ E;  1Q5Y A;  1MYK A;  3QSI A;  4ME7 E;  3FMT A;  3FT7 A;  4HV0 A;  1B01 A;  2BJ7 A;  1BDV A;  3VW4 A;  1BAZ A;  2K1O A;  2WVB A;  4FXE A;  1BDT A;  1MYL A;  2CAX A;  2JXG A;  2CAD A;  2K5J A;  2H1O E;  4D8J A;  2Y3Y A;  1MNT A;  2CA9 A;  3GXQ A;  1B28 A;  1ARR A;  2BJ1 A;  1X93 A;  1QTG A;  2FGC A;  3H87 C;  3OD2 A;  1IRQ A;  2F1F A;  3BKF A;  3PHT A;  2K9I A;  2KEL A;  1NLA A;  2BJ9 A;  2WVF A;  2RBF A;  2K29 A;  2BA3 A;  1P94 A;  2BJ3 A;  2BJ8 A;  2CAJ A;  3VEA A;  3BKT A;  1U9P A;  2GPE A;  3VEB A;  1PAR A;  2AY0 A;  2HZV A;  2WVE A;  1Q5V A;  2WVC A;  2JXH A;  3QOQ A;  1ARQ A;  2BNW A;  2NZC A;  2HZA A;  3BKU A;  2BNZ A;  2WVD A;  2CPG A;  2PC6 A; 
#chains in the Genus database with same CATH topology
 3WC2 A;  2JC0 A;  1LXJ A;  2DXD A;  4YDX A;  2K6L A;  5AT1 B;  2UUT A;  1WC5 A;  2DCL A;  5MAO A;  5HQL A;  4ME7 E;  3D1H A;  1T11 A;  2IVY A;  3A3N B;  3MEG B;  2O3D A;  2J6T A;  4UOC A;  3RYL A;  1IXK A;  2BXJ A;  2YNH B;  1KP6 A;  3EWG A;  2ZHB A;  5CCL A;  3CDE A;  3HHL D;  5F3T A;  2RF2 A;  3VVU A;  1FJE B;  2R8J A;  1SQE A;  1F2G A;  5GMD A;  1FRJ A;  3GR0 A;  4KGV B;  2VPW B;  2XY6 A;  5B0D A;  3QJL A;  1VIS A;  4J9R A;  5B0B A;  4ZPT R;  1RAB B;  4CH0 S;  1GMW A;  1TFW A;  4DR7 F;  2MKY A;  6FD1 A;  1AA1 B;  2UU9 F;  1RAA B;  3O44 A;  3MUM P;  2XWX A;  3D6H B;  3HVA A;  2HAF A;  2DGX A;  2IHR 1;  1JLF A;  2NUU G;  1R89 A;  5L9X A;  5J1E A;  3V81 A;  3M9O B;  3KNA A;  2IYI A;  4DI6 A;  1QLN A;  1RAC B;  5KFF A;  1K47 A;  4DSJ A;  3KUE A;  2DNK A;  3MWB A;  4PR6 A;  3CJQ A;  4FF3 A;  2IAJ B;  4YEA A;  3AD7 C;  4B3T J;  1MMD A;  2CUY A;  2Z58 B;  3JSM B;  1QUV A;  1LW0 A;  2CVI A;  3MEK A;  3R7N B;  5KG3 A;  4CNY A;  2OUG A;  3CO9 A;  5LSR A;  5M2U A;  1T05 B;  1IM4 A;  2HNZ A;  2QLF B;  4AE5 A;  5CD4 A;  2Q1L A;  1ZTW A;  3H2L A;  2GQC A;  2UUW A;  4DCJ B;  3VAJ A;  2J9D E;  3AT1 B;  4URQ U;  5IS2 A;  2C2N A;  2NZC A;  2CZV C;  2HZA A;  2V4J B;  5HVF A;  4ZK7 M;  4LF6 J;  1Q8L A;  1Y5N B;  4RR5 A;  1WEY A;  4C97 A;  2B8Q A;  2BSQ E;  1GFW B;  1GT8 A;  4KH1 B;  1B0P A;  2VQF F;  4MFB A;  5KFY A;  2GW8 A;  2XQC A;  1FXL A;  3RG6 A;  2XBP A;  1GQE A;  1WG5 A;  3VAK A;  4AL7 A;  1QSS A;  3NGU A;  2X3D A;  1EAR A;  3PIP Q;  5I42 A;  5GAE I;  3POT B;  3UDE A;  1ZM4 A;  3QFH A;  5C2G A;  3VAH A;  1HWU A;  4N5S A;  2R7O A;  4DL5 A;  4BC9 A;  4WII A;  3I0S B;  4CLK A;  5LSL A;  1BMQ B;  1DQA A;  2RH3 A;  1N5V A;  2I5J B;  3A8J A;  3DLE B;  4ES2 A;  2CWK A;  4RW9 B;  5H9F J;  3LP0 A;  1SH3 A;  1FDA A;  4YFU A;  1R31 A;  2EI5 A;  4WP3 A;  5BXI A;  1X5S A;  1XK8 A;  1RHK B;  4J9V A;  2X1F A;  2JXH A;  1EET B;  2FJD B;  2B43 A;  4PAA A;  2BE2 A;  1YJ7 A;  1WOS A;  2J6U A;  3BEG B;  1JKH A;  4FBU A;  4M5G A;  5IOL A;  3CCS S;  1JLC A;  5ETP A;  3OL8 A;  5EWF A;  4MYT A;  1UA0 A;  4X4T A;  1R0B G;  4L73 A;  1H2V Z;  2PGC A;  4XTT A;  4X4Q A;  2QO3 A;  2B6A B;  4RUA A;  1GTE A;  4RNN A;  2E9Z A;  2HWI A;  3HK2 A;  3MM9 A;  3MMB B;  3EDR B;  4N7T A;  3CJ8 A;  1TAU A;  1D9F A;  3NCQ A;  1RI7 A;  1KTQ A;  4B9L A;  4FXW A;  1R27 B;  2KYX A;  1KQS R;  1DRZ A;  4NLS A;  2EFN A;  2H9Z A;  3MR7 A;  2DNG A;  4OYP A;  3CNQ P;  4USU A;  1LW2 B;  4ZVT B;  4OX9 F;  4BHQ A;  4KO0 A;  2V2Q A;  3A3P B;  5IT4 A;  4U6P A;  1PIE A;  2WVF A;  3FSI A;  2FJV A;  4JYA J;  3DRP B;  4YOE A;  3VEB A;  3LPY A;  2ASY A;  2HUR A;  1T3N A;  4LF8 F;  7AT1 B;  1REG X;  2EBG A;  2OP5 A;  3LP1 B;  3SMZ A;  4JI4 F;  4KY3 A;  1H73 A;  3U27 A;  2RS8 A;  1NSQ A;  5JUM A;  1F9E B;  2PMW A;  1K9M T;  4HHU A;  4LSN A;  4YR0 A;  4X4O A;  1XNR F;  5A8W B;  3M8R A;  2M9K A;  4EYI B;  2ZJP Q;  1L3V A;  3RBD A;  1IKY A;  2BAC A;  1U1P A;  4FF4 A;  5G0R A;  1SC1 B;  1T0T V;  2XM3 A;  4O44 B;  3MFH A;  1RTD A;  3RR7 A;  2FC8 A;  3SDE A;  4A8S A;  4NLU A;  2GAH C;  2HWT A;  1LFP A;  3GZ7 A;  4O3P A;  3UCG A;  5KFK A;  3CC4 S;  2X1B A;  1MNT A;  4CT9 A;  3HVR A;  1S7H A;  3O6Q A;  4L3N A;  4K0K F;  2FB0 A;  3OR2 B;  2EPI A;  3BB5 A;  1F9F A;  1ICE B;  1J2V A;  3HPO A;  1YKW A;  3G8S A;  1R0A B;  1FNM A;  2UVW A;  2AJQ A;  3M8Z A;  4OYM A;  1M5S A;  4LIW A;  3K58 A;  3DDN A;  4ED1 A;  1R8B A;  3EGV A;  3U02 A;  1XIQ A;  4RO0 A;  1GAO A;  3A12 A;  2CPY A;  3BO2 A;  3NNA A;  2AZ1 A;  1R8P A;  4G6V B;  4UT4 A;  3TI0 A;  5IWA J;  4DL3 A;  2HHQ A;  2VPY B;  3MED A;  2AT1 B;  2ABY A;  2BOA A;  3B54 A;  4QIW D;  3MR5 A;  2ZHA A;  3KJN B;  1F5A A;  2ATL A;  5HO4 A;  1VC5 A;  4DN9 A;  4DL2 A;  3I0R A;  3KMQ A;  4OI1 A;  3CMA S;  5CH7 B;  1TVR B;  2BDP A;  2OTL S;  4JI0 J;  2YWF A;  1XQI A;  1PAU B;  3H42 A;  4ETX A;  5KG1 A;  2XLJ A;  4EO6 A;  3LO3 A;  2F4V J;  1IN0 A;  3ET6 B;  2H5J B;  2IM0 A;  4AYB D;  1R7I A;  4RUC A;  4U8V A;  1WKJ A;  2PMH A;  3CC2 S;  5BYS A;  4YB6 A;  3MM6 A;  1RAF B;  2ZUG A;  1VC6 A;  3J81 U;  3FSY A;  5ITH A;  4RNO A;  2BJ3 A;  1X4F A;  2MQL A;  3HT3 A;  4AL6 A;  1NDP A;  5IV3 A;  2EWH A;  4PWW A;  4DR5 F;  1XJW B;  5F8I A;  3MMC B;  4Y6I A;  3JTO A;  4ZJL A;  2OIH A;  3JTN A;  3K5P A;  1VRT B;  3NGS A;  2CJB A;  1V3S A;  4ES3 A;  1N8R T;  5J1P A;  3KG1 A;  4OHV A;  4DV2 J;  2B4P A;  1CQM A;  3R7B B;  7FD1 A;  1AXQ A;  1FES A;  1KKH A;  4AQY J;  2C2Z B;  1SJF A;  1NJX A;  1N36 J;  3DLG A;  1A7G E;  2HGN A;  4R5P A;  2UVV A;  3WX8 A;  3VCD A;  4KTQ A;  5CYM A;  2HHT A;  2RU9 A;  4ILL A;  1EZZ B;  4U8Y A;  5KFS A;  5CD4 H;  2L41 A;  4IOA Q;  2PE8 A;  1D8Z A;  4RKU C;  1UPP A;  2W9C A;  2WW4 A;  4O44 A;  1VJW A;  3NS6 A;  1AFJ A;  1FKO A;  2KN4 A;  1Y4Z B;  1IRQ A;  5J1E B;  1Q53 A;  1SIW B;  3V81 B;  3MMJ A;  4B9V A;  3OTB A;  3EDQ B;  4P7V A;  4ILR A;  1VRQ C;  3BGR B;  4IQM A;  1S1W A;  1VRT A;  1WKL A;  4Y2C A;  5HSP A;  4C11 B;  4JI6 F;  1K0V A;  3A3O B;  1Z2L A;  2ZH9 A;  1H7X A;  4DG1 B;  4QYZ K;  1CVJ A;  5T7L B;  3AD9 C;  1HAR A;  3M1V A;  2BYC A;  2CPG A;  3H5X A;  1U2R A;  5A0Y A;  3ZNU A;  1SL2 A;  2NPI A;  2HZC A;  2XTJ P;  4WU2 A;  2HNZ B;  4P74 A;  1WTF A;  1FX4 A;  1XMQ J;  1TL4 A;  3A8E A;  3K57 A;  1FI4 A;  2H5I B;  2DHH A;  5AE3 A;  2HK3 A;  2G4B A;  3UCZ P;  1NDK A;  4WXW A;  4Z7Y A;  2X1A A;  2UV8 G;  1U0S A;  2ZM6 F;  2PD1 A;  2UUA F;  5H1S V;  4J9O A;  3ENV A;  1JLQ A;  2NPF A;  4C8O A;  3EYZ A;  2ZH7 A;  1KBR A;  2DR9 A;  2JC1 A;  4RW4 A;  4A8O A;  2V69 A;  3C8Y A;  4WXO A;  5HRO B;  2IYG A;  2BX6 A;  2MKJ A;  1IR2 A;  2MMY A;  2AJ1 A;  4ZIW A;  3W2W B;  5LXY A;  2MZ1 A;  4ECT A;  4P2X A;  1RA6 A;  1RU1 A;  1SJQ A;  4CTA B;  4LRC A;  2UP1 A;  1CS4 A;  1WHX A;  3SSS A;  2RQC A;  2PFF B;  1REV A;  5KFR A;  3JYT B;  3KLH B;  2ZDO A;  2MPU A;  3KJQ B;  3QSI A;  5ETK A;  2UVU A;  1S97 A;  2C2R A;  4F2R A;  5EWE A;  2WBM A;  3VGU A;  5K14 B;  1RWN B;  2A3J A;  3E3X A;  3QGI A;  4HYK A;  5BYQ A;  3K0J A;  4K5S A;  2W24 A;  4GKJ F;  2DHS A;  3LA0 A;  4OZ3 A;  4DSE A;  1QAX A;  1WC3 A;  3M4X A;  4FKY A;  4WYL A;  2O01 C;  4HI1 A;  3Q0A A;  3RB6 A;  4DS5 A;  1T7P A;  4CLL A;  1JK9 B;  2DNY A;  3LTO A;  5K8O A;  2HQG A;  2YH1 A;  1DBD A;  1NHK L;  2VBW A;  3P45 B;  3ZNJ 1;  3QRP A;  1HQU A;  5K5M A;  2YPY A;  3MCM A;  3C15 B;  5JXS A;  3BYP A;  4CO3 A;  4ZLN A;  2FVC A;  3M1V B;  4M63 A;  4EBE A;  4F3O A;  3M2R B;  2NXJ A;  4TQR A;  4KH0 B;  2UUC J;  3M7V A;  1JXE A;  2CNL B;  2PN6 A;  1UW4 A;  3TZZ A;  4AFF A;  1SL0 A;  3G5O A;  3MM7 B;  4HHJ A;  4OYB A;  1I51 B;  1QVG R;  2Z30 B;  1YI2 S;  2MLX A;  1RHR B;  3M2V B;  1NB7 A;  1BHN A;  4KO0 B;  1C1B A;  1Q8K A;  2FZG B;  3TAM A;  4ZVF A;  4Y2M A;  1YHQ S;  2IC3 A;  3D5M A;  3DOL A;  4G1P A;  4C6A A;  3UPF A;  4OFZ A;  2AWZ A;  2DEJ A;  5HMW A;  2W8K A;  3BSN A;  2OH2 A;  1RWO B;  3IM8 A;  1PIL A;  3EIC A;  2AV5 A;  2HND B;  2CA9 A;  1SI9 A;  2EC2 A;  1DAX A;  2ALY B;  2BJ1 A;  4OYX A;  4OHZ A;  2E7V A;  3PKY A;  5KG0 A;  4V19 J;  3BH6 B;  2AEJ A;  2Y9H A;  3DI6 B;  1SC4 B;  2JFD A;  3D67 A;  2HG4 A;  2LA4 A;  2XEX A;  3D6M B;  3KLG A;  1S0V A;  4OYW A;  4TN2 A;  5AXM A;  3M9N B;  2DNP A;  1NKB A;  5L1L A;  3CUN A;  1KFD A;  5LSO A;  3KK2 B;  2CQG A;  5D3G A;  3N01 A;  3MAQ A;  4DPW A;  4LFC F;  2V34 A;  3NGR A;  4CO5 A;  3OBI A;  2H54 B;  3OXF A;  4DR5 J;  3KJV A;  1S1T B;  3X1L B;  2ZH4 A;  1DZ5 A;  4Z7C A;  4RNM A;  3LAK A;  3FRZ A;  1IJF B;  2CPZ A;  3SIP B;  1JNZ B;  4OZ2 A;  2YX1 A;  4L72 B;  3TAR A;  1B7F A;  2XB2 D;  2ILY A;  1FE0 A;  4C2M A;  3V6D A;  3CJS A;  1NJI T;  4LF2 A;  3H98 A;  3CTR A;  3B4M A;  4CRJ A;  4ZCK A;  4ECU A;  3IWN C;  2R9L A;  5J2M A;  5KG2 A;  1F3F A;  2HVD A;  2HBY B;  2DB1 A;  1N54 B;  1D09 B;  1NUE A;  1VQ7 S;  5HBM A;  1U45 A;  2C3P A;  3H2U B;  1BQN A;  4YME A;  1JLQ B;  2MQQ A;  3BO4 A;  2C2M B;  3M2V A;  4NZ6 A;  1KEK A;  3IS9 A;  3DGP A;  2MXY A;  3NAH A;  2JOQ A;  2XGQ A;  2KI2 A;  3MAA B;  4DFK A;  4ZVO B;  3KUG A;  3VGT A;  1QTN B;  3PDN A;  4X66 J;  5GMK a;  5CXT A;  4B3O B;  2RQM A;  5B09 A;  4X2B A;  3D28 A;  1FTR A;  3DN9 A;  2ROP A;  3Q89 A;  1VBX A;  5KT5 A;  2NRE A;  2BJ7 A;  1X8D A;  2QC3 A;  4Q0B A;  4W98 A;  2K1O A;  2W9A A;  3I96 A;  4P73 A;  4WTY A;  1OWX A;  2ZJQ Q;  2CQD A;  2YQ3 A;  3ADA C;  3LWM A;  3ZZ0 A;  1N32 J;  2ZKU A;  2P9E A;  3G6Y A;  3SBM A;  1RGV A;  3RBE A;  4J9L A;  4RW7 B;  1JLF B;  1QM9 A;  3EM1 A;  1SC3 B;  5D4L A;  3HHK A;  1U09 A;  1HBN B;  2HFN A;  2MLZ A;  4K4Y A;  3JSR A;  3ITH B;  2EC0 A;  2Z56 B;  1L5U A;  1RWP B;  5HJX A;  3A8K A;  1TUV A;  5F8M A;  4DUZ J;  3T19 A;  1NCL A;  2VFR A;  3PRD A;  2CJ9 A;  3KLH A;  1Q16 A;  2W2N P;  2DR5 A;  4KHP J;  1ULR A;  2H3E B;  3M6V A;  2MJU A;  4URS A;  3T6B A;  2CJK A;  5CYJ A;  1M5K C;  2M70 A;  2PT0 A;  1RT7 B;  1WOO A;  4ZIT A;  2VQE J;  1OSC A;  2HQD A;  3OLA A;  3PJW A;  1KLM B;  2CQ1 A;  2IMO A;  1U2C A;  2IY5 B;  3I32 A;  3I5B A;  1CLF A;  2ZWO A;  3BN7 A;  1RYS A;  2J5A A;  4PEO A;  1CJK A;  3SCJ E;  4IYQ A;  1SJR A;  3ITH A;  4DHV A;  1UTA A;  1BQN B;  3UN3 A;  3W2V A;  2V2V A;  3Q83 A;  2QLJ B;  2N82 B;  1XMO J;  1KC8 T;  2EK6 A;  1JJ4 A;  2XGP A;  4GKK F;  3FFI A;  2M7S A;  4NLG A;  2CAJ A;  3IR7 B;  1RBA A;  4R0E A;  4I2Q B;  1VQO S;  1D1U A;  1WSV A;  2VG5 B;  2YNG B;  5HLF A;  1JLE A;  2J9E A;  3C16 B;  1Y9O A;  3Q8P B;  1KDN A;  2XZD B;  3HFZ B;  2WOM A;  3J81 j;  2YNF A;  4F04 B;  5A6P A;  2W4C A;  1TZ0 A;  4KQZ A;  4ELU A;  4PQA A;  4K4S A;  3UWT A;  4Z2X A;  2AMC B;  3FUY A;  4OX6 A;  3R97 A;  4C7Q A;  3S8S A;  4XPC A;  4DSK A;  1HYS A;  2DNZ A;  3FMB A;  3DDI A;  2O67 A;  1LWC A;  2XS2 A;  1E6V B;  1GX6 A;  3N6L A;  4EFA C;  4B3M F;  2JFK A;  4C8Z A;  1VYA A;  5LXR A;  1GH8 A;  4KT0 C;  2F3J A;  4RX6 A;  1BQM A;  3HZG A;  3MM8 A;  2BVZ A;  2IJR A;  1QDU B;  1F2H A;  1FEH A;  1OS5 A;  3AXM A;  3OR1 B;  3KUH A;  3N6M A;  3PJ9 A;  3QMQ A;  3DU6 A;  3IR7 A;  2DGT A;  3PG9 A;  5JMN A;  4JV0 A;  1IR1 A;  2O5D A;  4DV5 J;  2LEB A;  1Y7P A;  1LXN A;  2MKS A;  1NJY A;  1WHW A;  1J5E F;  2XS5 A;  2DH8 A;  4NLR A;  3GIM A;  2K9I A;  1TK8 A;  1N6Q B;  1WSR A;  3J7A N;  1T9X A;  1N0V C;  1RAO A;  2ZC3 A;  5J2M B;  4WFA Q;  3R1L A;  4X4V A;  4RW7 A;  1KNZ A;  1ZYQ A;  4K4W A;  3H90 A;  3HF5 A;  5DG9 A;  4X4N A;  2YKM A;  1WAC A;  4RJV A;  3MM8 B;  3OR1 A;  2IIH A;  2Q79 A;  1R0A A;  2GO8 A;  1NB2 A;  4DQR A;  4NI2 B;  4LRV A;  4C0H A;  1HQE B;  1NDC A;  1TAQ A;  3D6T B;  1N34 F;  2VG7 B;  1YBU A;  2VZ9 A;  2ZH3 A;  1SC6 A;  4F8R A;  3DRR B;  2P2C B;  5DS7 A;  4ZPA A;  2E1P A;  2WB1 D;  2XI3 A;  2A10 A;  2BV3 A;  1ZZF A;  3THT A;  3KJF B;  3U1M A;  5F9N A;  2CKW A;  1RWV B;  2JSX A;  3CD7 A;  4QOT A;  4HTI A;  4DU8 A;  5I42 B;  1APS A;  3TQE A;  2GO9 A;  4N8N A;  3MD3 A;  3NWR A;  2G2Y A;  3NGK A;  4ED3 A;  1UVJ A;  2R7U A;  3BGR A;  1I94 J;  3NAI A;  2AGQ A;  1F0X A;  1TL1 A;  1W2B R;  2VL1 A;  2OSQ A;  1Q95 G;  4O4G A;  4DWI A;  2HBR B;  2JJ4 D;  4LR9 A;  1PC5 A;  2G13 A;  1Q5V A;  1B3T A;  1X4D A;  3WX4 A;  4U96 A;  1FER A;  3DRR A;  3HVT B;  1RAI B;  3JQK A;  4NYP A;  2DK2 A;  2R7Q A;  2JRS A;  4CCH A;  1UZD A;  2VON A;  3GIJ A;  1S77 D;  5DDR C;  3BV8 A;  3W9J A;  3C6T B;  2CQ0 A;  2YNI B;  1LV5 A;  1KFS A;  4ECW A;  2XZT B;  1BDT A;  2AEF A;  2MJN A;  2OPR A;  4GMK A;  3O1L A;  1RHM B;  2OD6 A;  2CIM A;  2GCF A;  2ZOG A;  3MGJ A;  3NCR A;  2Y8W A;  1FXD A;  2HHX A;  3ZTO A;  1WC1 A;  1BQM B;  4RW6 B;  4ZOS A;  1SIZ A;  4BC7 A;  4LSL A;  1RTI B;  3CJT A;  2MZQ A;  2VKZ G;  3W5Y A;  4CO0 A;  4CDI A;  3MUR P;  1ZZN A;  2ERR A;  1OPZ A;  2KEL A;  1IBC B;  2OGU A;  5LJ5 Y;  4W90 B;  2HRT A;  3BDP A;  3DM2 B;  3VEA A;  1YJ9 S;  3CCU S;  2GJF A;  3TAP A;  4AXI A;  1RTJ B;  4MK8 A;  2AY0 A;  3BZQ A;  1EP4 B;  2VBX A;  3GLJ A;  4K59 A;  1HHQ A;  3NXZ A;  2HBQ B;  2XMT A;  3A13 A;  3ET6 A;  4A8M P;  1SJ3 P;  1RT5 B;  3M8Y A;  3UD5 A;  4F3M A;  4C0O C;  2AGP A;  5F8L A;  4V19 X;  3QFW A;  3WHI A;  3FBE A;  4IG0 B;  1RT6 A;  4DPX A;  2MZJ A;  4F3Q A;  3EVM A;  4ED4 A;  3IRW P;  1J5O B;  2GIR A;  4ZKA A;  4DCP B;  4DUZ F;  1TMM A;  1N5Y A;  1HNX J;  4Y65 A;  4X65 J;  1UEV A;  2XY7 A;  1RTJ A;  4NPO A;  2A2C A;  4AXJ A;  3H5U A;  4HDH A;  3HSG A;  5HJY A;  4N8O A;  1YRU A;  2B8P A;  1VIX A;  1WI8 A;  2QT7 A;  1UW9 A;  2F8E X;  3EGW B;  4IH7 A;  3CCR S;  3PEJ A;  3E01 B;  4DR3 J;  3MEC B;  3QGP A;  1FNO A;  3R5B A;  4OYA A;  4ECR A;  2KZZ A;  4OLO A;  2B7B B;  1VQ5 S;  3TX8 A;  3TQ1 A;  2VC0 A;  3HLU A;  2YPZ A;  2AX1 A;  2LA6 A;  1YRX A;  5KFG A;  4EZ9 A;  4L75 A;  4K4X A;  2JH3 A;  3G8T A;  1JLB A;  2LKZ A;  3OR2 A;  2RKI A;  5B0F A;  3K5O A;  3VHQ A;  1MN9 A;  2FY1 A;  1FCA A;  3NBP A;  3WQP A;  4YS2 A;  4QR2 A;  2I0X A;  1LFW A;  1PYS B;  4G65 A;  1YZ7 A;  3CCZ A;  4UOF A;  3T1A A;  4DUT A;  3AD8 C;  1TUG B;  3MOZ A;  4MT1 A;  3VZH A;  3G71 S;  3PW0 A;  1RT1 B;  2DIV A;  2YVS A;  1O51 A;  1MWY A;  3OVA A;  4GRS A;  3N0V A;  2B3T B;  4WP9 A;  4JI8 F;  2M52 A;  2QX0 A;  4B9S A;  4MKA A;  1HI8 A;  2AJ4 A;  1A6L A;  2MYF A;  4OJ1 A;  2X51 A;  3GJT B;  5EWG A;  4DR2 F;  1EHW A;  2WVC A;  2YWH A;  2F5G A;  4ICL B;  2DPJ A;  4ED8 A;  4B9T A;  1S6O A;  1UP1 A;  1CC8 A;  1V5V A;  4ZCM A;  1ZA1 B;  3GSD A;  3MPY A;  1S1X B;  4DL4 A;  2V8G A;  2NSB A;  2ZZN A;  3N6N A;  4PQU A;  2RJZ A;  2VH7 A;  1RWW B;  3W1Y C;  3D68 A;  4KRW A;  2OPQ A;  2HPU A;  2OPP B;  1H6K X;  1NHV A;  3DLG B;  3SFG A;  3IAS 9;  2EBE A;  3ONQ A;  3TX0 A;  2V50 A;  5BJR A;  5DDP C;  4EYH B;  5IFM A;  2BEF A;  4LFC J;  3MM7 A;  3CDA A;  3MEE B;  3PO4 A;  1YG0 A;  4NLO A;  4ZLJ A;  4NLV A;  2LEC A;  2XMV A;  4DR6 F;  2P6T A;  2RHS B;  2YKN A;  4Q2M A;  3H87 C;  3W8G A;  2R2U A;  5JVG Q;  5J2Q B;  2R7W A;  2RRA A;  1U4B A;  3KMS A;  2IBO A;  1S1W B;  2Z2M A;  3CJ4 A;  4USJ C;  4HT5 A;  1K8A T;  2HLU A;  1QE1 B;  2DHX A;  3IWX A;  2V4Q A;  1ZM2 A;  4LBP A;  4MAK A;  2WVE A;  2DCU B;  2LXI A;  2YQ0 A;  5KTQ A;  1NKC A;  4JI3 J;  3GIL A;  4QWB A;  2JWN A;  4OJH A;  2WZ1 A;  4IG3 B;  1X4H A;  1FXR A;  1W2I A;  3E51 A;  4LF7 F;  2FQQ B;  2GNK A;  2DNN A;  2QA4 S;  1WC6 A;  3HSD A;  3H0P A;  1HNW J;  3GFY A;  5KFQ A;  1M5V C;  5BR8 J;  4EUV A;  5FD1 A;  1LNQ A;  2KXN B;  3EVO A;  2OLW A;  2Y0B B;  2HW3 A;  1U1Q A;  4X4P A;  1C4C A;  3M2U B;  4Q45 A;  2KT5 A;  2CFX A;  3QSY B;  1PGZ A;  1QTG A;  1QE1 A;  4M5L A;  3RBX A;  5JVH Q;  2FHM A;  2IFX A;  1HNW F;  5IT9 U;  4RBT A;  2Z8Q A;  4NLQ A;  1HKA A;  2L48 A;  3I6P A;  3GV8 B;  4OHX A;  3SCK E;  1LK7 A;  1RLD A;  2K1R B;  2AQ4 A;  2HFS A;  2EXU A;  3DYA B;  4QZV B;  1UEU A;  2VHG A;  2E29 A;  1FRL A;  4F0M A;  4DV6 F;  3OHB A;  2B9X A;  1T02 A;  4A48 A;  4IO9 Q;  2P6S A;  2DBB A;  5D78 A;  1TU0 B;  3ZO7 A;  2CQP A;  3LF0 A;  2PDA A;  4FNI A;  1AYE A;  4WE1 A;  3HX9 A;  3M32 B;  5IQ6 A;  3E2E A;  1GNK A;  2QYC A;  2FVP A;  1GMW D;  3HMJ G;  1NK0 A;  3NO7 A;  2KT2 A;  3CDW A;  4XO0 A;  2KG0 A;  3GE9 A;  2R2R A;  2ZBP A;  1RCO B;  1CJU A;  3W64 A;  1SKW A;  2XYP B;  3G87 A;  1PJ6 A;  3R9L A;  3DC2 A;  1SJ4 P;  1HMV A;  4OZN A;  3PFE A;  1H0H B;  2FDN A;  3L4B C;  3THP A;  4IFY B;  4TVA B;  2YX4 A;  2MY8 A;  4DSI A;  5F8H A;  1KHW A;  3WIU A;  1VRU A;  1YJT A;  2IJF A;  4B02 A;  4BBY A;  3SQO P;  4Q5V A;  1VQN S;  4K4U A;  1V5I B;  1HQU B;  2CQ4 A;  3TRG A;  4PXC A;  1WUU A;  2E1M C;  2V4R A;  5DG7 A;  3QLH A;  2ATC B;  4FZV A;  1EX8 A;  1FKO B;  2CPX A;  3IN5 A;  3PHE A;  3CCM S;  2KVI A;  4PPZ A;  3HP6 A;  4JV1 A;  2XMW A;  3M8Q A;  4ENO A;  3J7Y I;  2ZHO A;  5M2R A;  2AKW B;  2DGS A;  2DH7 A;  2YWG A;  3B6B A;  3ULH A;  3OTO F;  2Y1J A;  2BBE A;  3I82 A;  1VK8 A;  2V8V A;  3MTK A;  1FDN A;  2V2Z A;  4DSL A;  1FHT A;  3HZE A;  1HWL A;  1UVK A;  4C8Y A;  3BGL A;  2WVB A;  5EUH A;  1URN A;  2YKO A;  2KB2 A;  4NXN F;  1UFW A;  1R43 A;  3R5C A;  1U7L A;  2BE7 D;  2NXU A;  3V4I B;  3F56 A;  1X93 A;  1BWV A;  2AN7 A;  3IBW A;  4I6W A;  1S1U B;  4EMD A;  2HS3 A;  1UCN A;  3GR1 A;  3MCN A;  3BR9 A;  1BWE A;  4IG0 A;  1NND A;  3SEO A;  5CYQ B;  1VDH A;  2QL5 B;  4M94 A;  3M32 A;  4N56 A;  2CDR B;  4PAB A;  3ILL A;  1GMV A;  4DL7 A;  1VHF A;  2OO4 A;  1P9Q C;  2B56 A;  3N28 A;  3QZ7 A;  4RU2 A;  3OTD A;  2IC3 B;  3OV7 A;  1OYE A;  1VIO A;  3JYT A;  5E3C A;  1CPZ A;  3T9Z A;  1XER A;  3HDS A;  4M5N A;  2EVZ A;  4OZ1 A;  4QYZ J;  1N36 F;  1NK6 A;  1N52 B;  1U6Z A;  1VK3 A;  4O3O A;  1F1B B;  2W7A A;  5L9N A;  4J9K A;  4IFY A;  4YN3 B;  4AUK A;  1Q7L B;  3L7O A;  3ZZO A;  1JIH A;  5RUB A;  1CJT B;  3KDO A;  1VRU B;  4WYW A;  3VAM A;  1JKH B;  3M8W A;  3BSC A;  4OIX A;  5D6G A;  4CO2 A;  2F4V F;  2Z0G A;  4TLR A;  5KT6 A;  4N41 A;  1C2P A;  2RQK A;  1SB6 A;  2LYV A;  1RSC A;  2ZVS A;  6FDR A;  3KLI A;  3MXH P;  3G4S S;  2ZH1 A;  4I2P A;  4YQW A;  3W5Z A;  2F9J A;  4OYZ A;  2W2M P;  2QA2 A;  3KTQ A;  3IBC B;  2OKQ A;  3HD2 A;  5CHC B;  4YY3 J;  3H5Y A;  3U7J A;  5CCM A;  1Z1Z A;  2E7X A;  2YNH A;  1Q8B A;  2NSC A;  3B8H A;  4IFV A;  1VHI A;  3K7R A;  3UI3 A;  1FDB A;  2ADB A;  1TKD A;  4RW8 B;  2E7W A;  2N3O A;  1R8A A;  3D0G E;  1N6Q A;  2DR8 A;  4WCE Q;  1Q5Y A;  8RUC A;  2CJX B;  2VUG A;  1RBL A;  2HHS A;  1NZA A;  5KFH A;  3ELH A;  3JSY A;  3T41 A;  2DNL A;  2C2E A;  1S9E A;  3HHE A;  4NLX A;  3I31 A;  4ZP8 A;  1MYL A;  1ZM3 A;  3OPK A;  4KHR A;  3OTO J;  2X7I A;  4EO8 A;  2RDI A;  1HNV B;  3EZO A;  3IA0 A;  4MK7 A;  3OW2 R;  3IP0 A;  2M3D A;  3I9V 9;  4JV2 A;  5J2N A;  2V67 A;  2VA3 A;  4LRB A;  2BJ9 A;  4UTG A;  1AB8 A;  2BKP A;  2BZ2 A;  3QO9 A;  1ZAW A;  4FPI A;  5E33 A;  3UNY A;  2UUC F;  4F25 A;  3TOQ A;  3TEG A;  4W4M A;  1U02 A;  2YWE A;  3CGI A;  2LU1 A;  4OX7 A;  5D0G A;  5KFO A;  3CCJ S;  1D9A A;  1EAY C;  2WB4 A;  3LAM A;  3GFZ A;  1B64 A;  1T9T A;  4Y2I A;  4P2S A;  4UOH A;  4JYA F;  1F5C A;  1GX5 A;  2ZOM A;  1MWZ A;  2GVD A;  3J81 Y;  3BQ2 A;  3WIV A;  3H25 A;  2DYA A;  2GJI A;  2UZA A;  5E3P A;  2NS1 B;  2DIS A;  5GME A;  4JI4 J;  3BGO P;  3RW6 A;  2CJY B;  2C2O B;  2BE2 B;  5KOW A;  3KLF B;  4JI2 F;  2DT9 A;  4C3K A;  1U1R A;  4G1Q B;  1IWG A;  2MGZ B;  2GFF A;  3O5T B;  4ETZ A;  3V6D B;  4NXM F;  3P6Y C;  3RAQ A;  1ZA2 B;  3RJM B;  2VJV A;  3FVY A;  2VF3 A;  1HNI B;  3C6U A;  4H4M A;  4OX9 J;  3K8V A;  2XLK A;  3BYR A;  1FRK A;  1F6T A;  3CVK A;  1EQM A;  2Q6C A;  2K7K A;  4NWB A;  2N3L A;  3POT A;  1VQP S;  1PKU A;  2HSE B;  4BDP A;  1A9N B;  1TL3 B;  2F7V A;  5C42 B;  3L7P A;  3H8Y A;  3TO8 A;  3JXO A;  1UFK A;  4KPC A;  2RRN A;  1TKX A;  3OL6 A;  1LWC B;  1EJ7 L;  4P9S A;  4RL1 A;  1D8Y A;  2IDE A;  2KDO A;  3BS9 A;  2GHW A;  3UFC X;  3ZTS A;  4CLP A;  2KFN A;  1HWI A;  3LP1 A;  2FGO A;  4PG8 A;  2UXD J;  1X9W A;  4HT7 A;  4Q0B B;  3LP2 B;  2JX2 A;  3EUN A;  2PMZ D;  1OY8 A;  2G0C A;  4Z37 A;  4A4J A;  4IOC Q;  1M5H A;  2M5Y A;  4IR9 A;  2ZZM A;  1VBY A;  3WC0 A;  1JLC B;  2PI4 A;  2BJ8 A;  1ZPW X;  2GC8 A;  3K8W A;  4HLB A;  5SUH A;  4WKY A;  3UD4 P;  3LOU A;  2K3I A;  4QR0 A;  4NCA A;  1Q1K A;  4DV7 J;  3MPV A;  3MM9 B;  4C8N A;  4ZPB A;  2HVI A;  1HWJ A;  1NLK L;  3IGV A;  3IRX A;  2B5J A;  4R8U A;  4KHP F;  3FJ2 A;  1KLM A;  5KFV A;  5K8P A;  4OMF G;  5ETV A;  4PUO B;  4ID5 B;  4H4K C;  4TY9 A;  1WHY A;  3MAA A;  2OJ3 A;  1C4A A;  3P49 B;  3ZZY A;  1T05 A;  1NSP A;  4FXD A;  3M8Q B;  1AUD A;  2JXG A;  1QSL A;  2V8P A;  4NA2 A;  5F3Z A;  2AJF E;  1MU2 B;  1NJZ A;  3MCS A;  2HKE A;  4M5D A;  5D4P A;  1FNX H;  2E5L F;  2V9W A;  2VQE F;  3DLE A;  4JI8 J;  3NL0 A;  4ZHR A;  1JLB B;  1UJ5 A;  1JLA B;  4DV3 F;  3R6L B;  2R7S A;  2GPE A;  2E5G A;  2I1R A;  2K7J A;  2MKC A;  4LF5 F;  1FJG F;  5DDQ C;  2JEI A;  2MZS A;  1HMV B;  2FIU A;  4PKD B;  4M95 A;  3JAM Y;  2JDJ A;  3V2U C;  3QIP B;  2WVD A;  4ZP7 A;  1O6X A;  2VG5 A;  2RB7 A;  3FSX A;  4Y00 A;  2A6M A;  2BM0 A;  2POK A;  3BRE A;  5B0E A;  3UR3 C;  3HKZ D;  3MPU B;  2B9E A;  4P52 A;  2Q6B A;  5A8R B;  3HO1 A;  3DLK B;  1FFW B;  4YP3 A;  4HH0 A;  4F4Z A;  4OZ5 A;  3V6K A;  2GAG C;  3DOM A;  3TVK A;  1IKX A;  2R2T A;  3EGZ A;  4NLD A;  4WF9 Q;  1G3O A;  1YGY A;  2K8G A;  1IKV A;  4M8L A;  2HFU A;  1KQG B;  2D41 A;  2HHU A;  1TK0 A;  4ZLL A;  4Q2L A;  3L9Z A;  4WTO B;  1U2F A;  4WFN Q;  3ENW A;  4LFA F;  3IBF B;  3HVT A;  1QUP A;  1S59 A;  3CDU A;  2YKM B;  1U9P A;  2YX7 A;  3BKT A;  3FEX B;  3H2V E;  3NOC A;  4FYY B;  4H4K A;  3WZ0 A;  5C25 B;  3T1Y F;  2AW0 A;  4I4B A;  3G6E S;  2VBZ A;  2G2Z A;  4ECQ A;  5IC6 B;  1HW9 A;  2ADC A;  5B7W A;  1RQ0 A;  1UET A;  3QAU A;  3S7R A;  1S9G A;  1RU2 A;  2MQM A;  3K59 A;  1PCA A;  2QEX S;  3Q2T C;  3OL7 A;  4UF4 A;  4J9S A;  5E41 A;  4CO1 A;  5D0R A;  4I2P B;  5LMU J;  3PW2 A;  3D3B J;  4RUH A;  3AB4 B;  4O0I A;  5A8W A;  5CZX A;  1KOO A;  1VQY A;  1CJU B;  1UFL A;  2YTC A;  3D6F B;  4ECV A;  1WG4 A;  4IOB A;  2R3V A;  4ZP9 A;  4PUO A;  1SH0 A;  3PXG a;  3FQK A;  3L3C A;  5F8G A;  3EZ5 A;  1NPR A;  2WSC C;  1Q82 T;  1H7W A;  2F9D A;  1D0E A;  4TY8 A;  1JWW A;  4XDC A;  2BQU A;  1O5J A;  4YR3 A;  4GKJ J;  3WDO A;  2KO1 A;  4QW9 A;  4DV4 J;  1NJW A;  1YBT A;  2VDH A;  3IGN A;  2J8A A;  2MZR A;  3OFE A;  3F0N A;  1ZPV A;  2GVZ B;  3N4W A;  1S0N A;  2H65 B;  1PYT A;  4U95 A;  3ENQ A;  1SQF A;  2MQN A;  3H5S A;  2H48 B;  4ZPD A;  3MPW A;  4F26 A;  2WON A;  5LMN F;  4DR2 J;  3AA9 A;  3AXK A;  3HJV A;  1NK5 A;  1RT4 B;  4OHW A;  1WI6 A;  2M8H A;  3W61 A;  5J2Q A;  1S79 A;  2F63 A;  5IZH A;  2VIC A;  2K1R A;  2W2O P;  2VIH A;  1U1K A;  4B3S J;  2XO7 A;  2HHW A;  2DNH A;  1ACM B;  1RT3 A;  1I3O B;  1VFJ A;  1WDD A;  2N4D A;  1ZAV A;  4IH5 A;  4NLP A;  2AX0 A;  1L3K A;  3MR3 A;  5J2P A;  4MYU A;  2PEH A;  2W25 A;  3BBB A;  1GMU A;  2UV8 A;  3DRY A;  3PYF A;  2OMO A;  3AHP A;  4FPR A;  4X4R A;  2W9B A;  4EEY A;  2NLW A;  2OPS A;  4LT6 A;  4FYD A;  2BKO A;  3W66 A;  4DJB A;  5IM0 B;  3V5R A;  1SQG A;  2WAQ D;  3OLB A;  4LF4 F;  2EG2 A;  1NPK A;  1IQZ A;  3I5A A;  4TU7 A;  1NH8 A;  1PG5 B;  1CUL B;  5LOQ A;  1KVK A;  4M5D B;  2UUB J;  2KKH A;  3W62 A;  2ZNY A;  3KK2 A;  4JI5 F;  4QWE A;  3NMR A;  2B9Y A;  2CQC A;  3QT6 A;  4DR4 J;  1S5Z A;  1GXU A;  3EJM A;  3PNI A;  1FJC A;  2C3O A;  3ZXW A;  2W2P P;  2XMU A;  2OPQ B;  2V63 A;  3GTY X;  3NOG A;  2UXB J;  1UAW A;  1YRT A;  5DLF A;  1VS3 A;  3H40 A;  3RAX A;  2XLI A;  3PYG A;  4LF5 J;  1FJG J;  4HKQ A;  3MEE A;  2ZDP A;  4MIW A;  2YNI A;  4C8L A;  4Y28 C;  4E98 A;  1SIW A;  3OJU A;  3UDV A;  1MWQ A;  2GVZ A;  4C4W A;  4K4Z A;  4FP9 A;  3R1H A;  2PI5 A;  2ZD1 A;  2HYI B;  2BQR A;  5KOX A;  1F9H A;  1SUQ A;  3R6G B;  3MR2 A;  2F4F A;  3DGP B;  1QVF R;  1S0O A;  4ANC A;  4PG6 A;  4PXE A;  2RS2 A;  4F02 A;  3PW4 A;  4MIB A;  3D0H E;  1HBN A;  3OVS A;  1S76 D;  4FYW B;  3SV3 A;  4ECX A;  1S6P B;  2J0X A;  3CD6 S;  3DLK A;  3R5G A;  1O0P A;  5DLG A;  2AYG A;  1RP5 A;  1SKU B;  4IRD A;  5HP1 B;  3THV A;  2QSW A;  1N33 F;  2HHH F;  2CWX A;  4EBD A;  3VWS A;  3EX7 B;  2C2D A;  4A8F A;  4IO1 A;  3ZZT A;  5F9L A;  4DV6 J;  4AD6 A;  1OQ6 A;  2QG9 B;  3TA0 A;  4O3Q A;  2AEM A;  8AT1 B;  2HAI A;  2E44 A;  4R0J A;  1TP7 A;  5A2Q Y;  1ZTT A;  4ERD A;  1SUQ B;  3AQO A;  1U1M A;  3I4H X;  1S1T A;  5J2N B;  4YB1 P;  4EU0 A;  5DM7 Q;  4OV1 A;  1VBZ A;  1N5Q A;  2AP6 A;  2K29 A;  1WD6 A;  2RHQ B;  3TA1 A;  3OFG A;  1VBK A;  3SFU A;  4IG3 A;  1WWH A;  1P1T A;  2DY9 A;  2Y8Y A;  3VGS A;  2HFO A;  1OSD A;  2V94 A;  4GO7 X;  2J7K A;  1BGX T;  2CZ4 A;  4CT8 A;  2EFQ A;  2ZBQ A;  3HSJ A;  1NU4 A;  4CM2 A;  4CYU B;  1CEZ A;  4WIQ A;  2DNQ A;  3CJ0 A;  5GAD U;  1URR A;  1H2U X;  1KOH A;  2ZFH A;  3HCX A;  1FRH A;  4GVB A;  1X9M A;  1FEE A;  2GVD B;  1VLY A;  4IH6 A;  2FZK B;  4NA1 A;  2WON B;  3FT7 A;  5EX3 A;  3UE2 A;  5DET A;  1U6F A;  2KXF A;  4CLY A;  1OG7 A;  2I6W A;  5KFC A;  1CSJ A;  2MEW A;  4IDK A;  2L9D A;  2Y3Y A;  3MMC A;  3QIP A;  3PO5 A;  1Y3J A;  2Q3P A;  1P6T A;  2R8I A;  3CW2 C;  2ZBI A;  2FJA B;  1IBM F;  4WZM A;  2ASJ A;  4WFX A;  1WOP A;  2I38 A;  4HI2 A;  1T03 B;  1EKR A;  4I7F B;  3W60 A;  1X0F A;  4JI2 J;  3TJ9 A;  2RU3 A;  1CJT A;  3DNC A;  3OHA A;  2CNO B;  2YNF B;  3JAM U;  1HNV A;  1OO0 B;  2CNN B;  1NME B;  1IKY B;  3KG0 A;  1WC0 A;  1XR6 A;  4JB8 B;  3CD0 A;  2GX8 A;  1VQ4 S;  4NE9 C;  3L09 A;  3X3U A;  3PEH A;  4CO4 A;  1T3O A;  2RUG A;  2CJA A;  2DGU A;  2FJE B;  3TR5 A;  1X0P A;  2HRY A;  1OY6 A;  2XWY A;  4LFB J;  3QAE A;  3VW4 A;  4E2F B;  2CPE A;  4QIF A;  4LSL B;  2FC9 A;  1MMN A;  3H4B A;  1IBK F;  3OL9 A;  3GFX A;  1T03 A;  2KM8 B;  2VG7 A;  1OYD A;  3DYA A;  3FCV A;  5KFE A;  1RWX B;  3CCW A;  2K2P A;  2HVE A;  4B3M J;  3PHT A;  2IM2 A;  3BBC A;  4LRE A;  1RT7 A;  4YDD B;  1B0V A;  2D7S A;  5BR8 F;  1P94 A;  3DOK B;  3G82 B;  1NKE A;  3Q2S C;  3RRK A;  3R8Y A;  4DCO B;  1DUR A;  4NL5 A;  1G1X A;  3CCT A;  3CSK A;  3KLF A;  1NK9 A;  2CZ9 A;  5FJ4 A;  2HQ3 A;  4I68 A;  1DTQ A;  4KGK A;  3LP0 B;  3LGM A;  1FVQ A;  4PRF A;  4QPX A;  2G1D A;  4ZN3 A;  2RNE A;  3K5M A;  4DXL A;  4B3R J;  2NYH A;  4OI2 A;  3QBC A;  3K5N A;  2D3O 1;  1ZBT A;  4LR7 A;  3C15 A;  1R3N A;  4D3H A;  3TUZ C;  5IT9 Y;  2RT3 A;  4KGX B;  3BO3 A;  1HBU A;  1VJQ A;  2IM1 A;  1T9W A;  2L9N A;  3MM5 A;  1S6P A;  3D0I E;  3DHX A;  2AD9 A;  2J0S D;  4F0K A;  1S1V A;  1VMB A;  1H74 A;  1TL3 A;  3EVW A;  2WW8 A;  1S99 A;  3DMJ A;  2PII A;  2XMM A;  3LQV A;  3P5T L;  1I5O B;  4TYA A;  5HP1 A;  1SKR A;  2BKN A;  1WDT A;  3AFG A;  4EK2 A;  4ED2 A;  5KFJ A;  4UY8 5;  1KSP A;  1FJ7 A;  3DLB A;  4CP5 A;  1XNR J;  1XN9 A;  4ZHR B;  1H38 A;  2ZD1 B;  2IVF B;  3AAW B;  1BD6 A;  4WFZ A;  4PWD B;  3HHL B;  3MD1 A;  3LUY A;  2KU7 A;  2HFZ A;  5CAB A;  1Q8I A;  5H9E K;  2J9C A;  5KFZ A;  1GXL A;  4MFB B;  5FII A;  3PTW A;  1NRK A;  2JBV A;  3CIZ A;  3CPW R;  4F50 A;  3FRY A;  3RU0 A;  3CO0 P;  3KLE B;  5DGB A;  1IBM J;  1OMS A;  3K17 A;  2VOO A;  2OHD A;  3D4J A;  2B51 A;  3SCL E;  9ATC B;  1Z2Z A;  4DFP A;  2HMI B;  5DZ7 A;  1FD2 A;  2O66 A;  5HAN A;  4B17 A;  4GC6 A;  2E5J A;  1K73 T;  4EZ6 A;  3I5C A;  3NS5 A;  2VFT A;  3I0S A;  4DDF A;  3SXL A;  2Z2Z A;  3T6J A;  4DN0 A;  4DX5 A;  2M8D B;  1FWP A;  2LDI A;  2WRM A;  4NRU A;  5ETN A;  2KRR A;  2CDQ A;  2E66 A;  1PJ7 A;  3GXQ A;  1XTZ A;  2GV1 A;  1E6Y B;  4L3K A;  4WBF A;  1DJ0 A;  5HMY A;  2KG1 A;  5G0R B;  5E3Q A;  5HQM A;  4B3T F;  4P7T A;  1DQ9 A;  5KFM A;  2DNO A;  2C1E B;  1CBK A;  1E6V A;  1ELO A;  2LP4 A;  3JSB A;  3GYN A;  2HFV A;  1DTT A;  2DXE A;  1YX2 A;  3F44 A;  2JNJ A;  4M5K A;  5KFL A;  2GHP A;  4TNO A;  1AZS B;  1JJC B;  2L3M A;  2W01 A;  4RWX A;  1LOU A;  1HFE L;  4ZPC A;  1HBM A;  1REV B;  3VAG A;  4LRF A;  1IVZ A;  1QAI A;  2PSZ A;  4I7F A;  2Z2Y B;  2BW7 A;  4L6V 3;  2P9C A;  1JXV A;  3RB0 A;  3DI6 A;  2LXF A;  3TVZ A;  3FMT A;  1E6Y A;  2EKN A;  2CG8 A;  2W9C B;  2CQ3 A;  2M0G B;  2G2O A;  2XNR A;  2DY1 A;  4DL0 C;  4Y0F A;  1NK7 A;  2GIF A;  2OSR A;  4QWC A;  2IPO B;  1CJK B;  1HQ2 A;  2DNM A;  2GMJ A;  4Y3C A;  1TFY A;  3UW1 A;  1TVR A;  4X65 F;  4ED0 A;  1ZH5 A;  4CZC A;  2PFD A;  2R7X A;  5GAH U;  2OEK A;  4ITS A;  4ZJO A;  2VQF J;  1L3S A;  2D1C A;  1XR5 A;  2PEB A;  2EFV A;  2CPH A;  4EWT A;  2OAU A;  5AXN A;  3KHH A;  4MKY A;  1RZM A;  2RIJ A;  3KFW X;  3M8P A;  1PC4 A;  3KLI B;  4KC5 A;  2AYM A;  4J9P A;  2JEF A;  2NR0 A;  5K20 B;  4A47 A;  2ZM6 J;  1HBO A;  5IXU A;  2DIT A;  4DV7 F;  1SV5 A;  2QGF B;  3CB4 A;  3HKW A;  1WF1 A;  4DR1 F;  4PWD A;  2G0I A;  4CNZ A;  3PVX A;  1RXO B;  2WBR A;  1ZS6 A;  2YY3 A;  3MPD A;  3UVJ A;  4IFV B;  1RWK B;  3BPS P;  3CDB A;  3OFF A;  2RAQ A;  5I3U A;  5B0G A;  1JQG A;  5HMX A;  1FE4 A;  4I6A A;  2HIY A;  4KAI A;  4KB7 A;  4UZB A;  1X5O A;  2ZZT A;  1S0M A;  2XY5 A;  4MJW A;  3RB3 A;  3VQS A;  3HFK A;  1T94 A;  1RT1 A;  3QQC D;  4F4K A;  1HL6 A;  3MED B;  2UXC J;  3IR5 B;  3M30 B;  2A2B A;  4JP8 A;  2NQP A;  4P2F A;  3NNE A;  3Q86 A;  3PY8 A;  1FFS B;  4NML A;  3OUY B;  2O1P A;  2IJN A;  1TKT B;  2HEK A;  2J9D A;  3K2Y A;  4KGZ B;  1EKS A;  4RPF A;  1IKV B;  3GQC A;  3OT9 A;  4LUB A;  4OZJ A;  1TV6 B;  4I0W A;  4MK9 A;  1YIT S;  1IJE B;  4FS2 A;  3FFI B;  3GG0 A;  4ID5 A;  2WTF A;  4IRK A;  1XNQ J;  2MDA A;  3ISN C;  3WBZ A;  3RB4 A;  3QNW B;  3MM6 B;  3MTJ A;  2UVR A;  2VOP A;  1C1C B;  2LEA A;  1GEH A;  3VV2 B;  2IRX A;  2GML A;  1WJ9 A;  2X3G A;  3CME S;  3UQS A;  4F0H A;  1EQ0 A;  3TUJ C;  4F4W A;  3FCH A;  4J7C A;  1M90 T;  4WK3 A;  5I3Q A;  4KIA A;  1NLA A;  2YKQ A;  2HQF A;  3GYG A;  1JLA A;  5K8N A;  1YZ6 A;  1S48 A;  2OI2 A;  4UST A;  1XC9 A;  3CF5 Q;  1VQ8 S;  1BXN A;  1XBW A;  2XHC A;  2L08 A;  4KHM A;  3Q8Y A;  4LIR A;  4X64 J;  2LQ9 A;  3DRP A;  3I87 A;  5KFW A;  1DTT B;  3G6X A;  2B4V A;  4XK8 C;  4DX7 A;  4MKB A;  1J5E J;  1XMB A;  3SQG B;  5KFT A;  6AT1 B;  3DOK A;  2D3Z A;  3DLL Q;  2AYB A;  2W8L A;  4HV0 A;  4KPY A;  4FYV B;  3HJF A;  5FDL B;  2DGW A;  2OEJ A;  1C1B B;  1BAZ A;  3MMB A;  1KD1 T;  4IUF A;  5CA5 A;  3CCV S;  4DV5 F;  3CJR A;  2XUL A;  4NCB A;  2AU0 A;  2KVQ E;  4KR0 B;  2DNR A;  1VLO A;  1S12 A;  4K4V A;  2HHV A;  1JMT A;  4PG4 A;  5LJ3 Y;  2KJV A;  3PAC A;  4FVM A;  4U9R A;  5KT3 A;  3H59 A;  4P2M A;  5D77 A;  1HLW A;  2WSF C;  1SXL A;  1HHS A;  2DJW A;  1T8E A;  4USV A;  5L1I A;  3PRV A;  2HGM A;  4YY3 F;  2KH9 A;  1S72 S;  3NEK A;  5CQG A;  4FBT A;  2XCA A;  3TVY A;  2V8D A;  3J7A 1;  4K50 A;  3L7U A;  5I3P A;  4B08 A;  3HFV A;  2ZE2 B;  1W26 A;  5ETR A;  2JVO A;  3PX4 A;  4USH A;  1BDV A;  1RAJ A;  5MLC V;  3B4D A;  4J5O A;  1N5Y B;  3QZ8 A;  1H2T Z;  3CED A;  1QY7 A;  1Y11 A;  3O3L A;  5KFA A;  3OSN A;  2D69 A;  3KLV A;  1QAJ A;  3GON A;  4DFJ A;  1UPM B;  1BC6 A;  3OD2 A;  5I3U B;  1R6Y A;  1VQ9 S;  1NBE B;  1RAH B;  4JI7 J;  2XMA A;  3TEH B;  2UUB F;  2ZNZ A;  4H4O A;  1WNE A;  3QRQ A;  1WEX A;  4UUX A;  4CWB A;  1UL3 A;  2MQO A;  1JX4 A;  2N4C A;  5DZ6 A;  2GQQ A;  3OJS A;  3P96 A;  1HW8 A;  1HBO B;  4KJI A;  5D4N A;  3EXY A;  1FDD A;  4C11 A;  4CI0 B;  5AE1 A;  2FVR A;  5M2P A;  4B9N A;  3MF5 A;  5L38 A;  2AZ3 A;  5HN0 A;  3R3T A;  4NZ7 A;  3SSQ A;  5FLX U;  3L95 X;  3KK1 A;  2CVE A;  1RTH B;  4R25 A;  3AJ1 A;  1PBA A;  5FLX Y;  2MGZ A;  5EN1 A;  3CJK A;  4QU6 A;  2B5J B;  4NRT A;  3GPA A;  3FMW A;  4I56 A;  1FX2 A;  1RB0 A;  1U0H B;  3DXS X;  3BM7 A;  3QGG A;  4NXN J;  1MW7 A;  2IAJ A;  4LBH A;  3VAL A;  4OQJ A;  1B28 A;  3GFH A;  3DOM B;  5KT7 A;  3R5D A;  3U1L A;  3GIK A;  5ETL A;  3PX6 A;  3RW7 A;  2Z57 B;  5KFI A;  4ZCI A;  1HD1 A;  4MH8 A;  3G86 A;  3GV5 B;  4PXB A;  2P8I A;  2BJD A;  3QT7 A;  5B08 A;  4XDD A;  2BMB A;  4DMZ A;  2ACM A;  4V1A k;  4E8U A;  2Q2K A;  2HRU A;  3FEY B;  1S4E A;  1KON A;  1FWK A;  3BSA A;  2XYG B;  1V3Z A;  1LWX A;  3ILO A;  2R7T A;  4ED5 A;  4PQU B;  2H5E A;  1EB0 A;  3OFH A;  3HUL A;  1SPB P;  2ZOF A;  4TXS A;  4M5H A;  1ZET A;  2OPS B;  3Q8R B;  2R2S A;  2XHW A;  4C3M A;  5C24 B;  2Z4P A;  5D0H A;  3DFE A;  1WEZ A;  3PR4 A;  1TR0 A;  2CAX A;  4U7C A;  3M6U A;  4ID8 A;  4NEY A;  1S6U A;  1EP4 A;  1FTC A;  4QPT A;  4B9U A;  3ILI A;  3KNG A;  2IRU A;  4OL8 A;  4ER8 A;  1HI1 A;  2LVW A;  3EPI A;  2LXU A;  1Y5I B;  2VB6 A;  5E3A A;  5L8R C;  3Q23 A;  2FLN A;  4BS2 A;  5AE2 A;  4RNH A;  3UDL A;  4GVB B;  2QJ3 A;  2HS0 A;  1GK8 A;  3BPD A;  3UDC A;  5C5J A;  3TZY A;  3IFE A;  2I2Y A;  4NYO A;  1BE4 A;  2RUS A;  1IBK J;  3QJP A;  3VZI A;  1U49 A;  4ZVS B;  2L9W A;  5HQ8 A;  3EGN A;  1RAE B;  4RBV A;  1I1G A;  3IR6 B;  4OX8 A;  3TWZ A;  2FYX A;  3GSI A;  1H3D A;  3ZFV A;  3NGD A;  1NK8 A;  3CMQ A;  2WCX A;  1UWB B;  1X4C A;  3ZZU A;  2CG4 A;  2AGO A;  3FBC A;  1XR7 A;  1NXI A;  4QBU A;  1HYS B;  3NNC A;  5IM0 A;  4UQT A;  3MEC A;  2VC1 A;  4DPU A;  2BW2 A;  3BBF A;  3IO1 A;  3KYL A;  2LMI A;  3MR6 A;  2W7O A;  5G4D A;  1YJR A;  3MCO A;  4M5I A;  3GB0 A;  3FK4 A;  3P3D A;  3K89 A;  3AOA A;  4CH7 A;  4QU7 A;  2VDI A;  4GO5 X;  2Y1I A;  3D2W A;  2ALZ A;  2PA8 D;  2R42 A;  3I0R B;  2HNY A;  2HVZ A;  3Q8S B;  3O8W A;  2XI2 A;  2GMH A;  5H9E J;  2BR0 A;  1TL7 B;  1YQH A;  3A1Y G;  5DDO C;  1UVN A;  3CUL A;  2D9O A;  3NBP B;  3FNN A;  1M0S A;  2QTW A;  2ZIT A;  3M6W A;  2AJ0 A;  1AZS A;  3PRB A;  2XG8 A;  4NMX A;  3PZP A;  4LRA A;  2DHG A;  1NH7 A;  2C28 A;  2VD3 A;  3Q8V A;  3UN2 A;  4FF2 A;  3OXG A;  1YLX A;  3SV4 A;  3RR8 A;  2DXF A;  1IBL F;  4AND A;  2HGL A;  4BWM A;  2NXN A;  3I55 S;  2LU2 A;  2LQ8 A;  3PW7 A;  5KT2 A;  3KJV B;  4USM A;  1EET A;  1HR0 J;  4OYO A;  4QIV A;  2XS7 A;  2VKR A;  4ZP6 A;  3NP5 A;  2SXL A;  4ANE A;  3DRX A;  2FGC A;  4ZVG A;  4ILM A;  1X4G A;  4Y2K A;  3VAF A;  1B0T A;  2BUN A;  4DFM A;  4HVZ A;  2DGO A;  2JVR A;  2BJE A;  2H3A A;  2DTJ A;  2OFG X;  4K7Q A;  4DU7 A;  2DRA A;  3QLH B;  1Y0H A;  5KG5 A;  4TQS A;  2ZUA A;  3UO0 A;  3T5K A;  4LF8 J;  1LWE A;  4OZ0 A;  1WHV A;  2VV5 A;  3R2D J;  3T3F A;  4F2S A;  2HWH A;  1P8G A;  3VGV A;  3W7B A;  4IKA A;  1RT6 B;  1V9O A;  2CQI A;  2JLF A;  4K8R A;  2QN6 B;  3JQM A;  5LL6 d;  2KZM A;  3D66 A;  1J5O A;  4CLU A;  5DQI A;  4TU8 A;  1FKP B;  4OZL A;  3UVJ B;  3VF0 B;  2KXH A;  1S6Q A;  4NOH A;  3BGF A;  1W7W A;  4HL9 A;  4BCA A;  3DOL B;  5HVG A;  4F4X A;  3V6J A;  2E9R X;  3CJ5 A;  3LGN A;  1B01 A;  2RF2 B;  3GG1 A;  3C2P A;  2GJ2 A;  4M1K A;  4B3O A;  1JLG A;  1PYO B;  4BLG A;  2A1B A;  2APO A;  4O23 A;  2QA1 A;  2FTR A;  3I9Z A;  4I2Q A;  1L3T A;  2WK4 A;  4DR1 J;  3DRS B;  4B9M A;  3ETO A;  2MB0 B;  1MRO A;  2RVJ A;  5GAG I;  1FF2 A;  2HMI A;  1YVF A;  4KGM A;  2V68 A;  1TMJ A;  2JLE A;  1VQL S;  2F65 A;  1TKZ B;  1RT4 A;  1RTI A;  2QIF A;  4X66 F;  3S6E A;  4L74 A;  4QCL A;  1N32 F;  4FXV A;  3MAH A;  1K1Q A;  4JI5 J;  1Q81 T;  1TKT A;  4X4S A;  1KS2 A;  3M2U A;  1M1H A;  4WJB A;  4CM0 A;  4CH1 A;  4JV5 J;  3AOD A;  1B99 A;  1U1O A;  1R8C A;  1TV6 A;  1ARO P;  4MKV A;  2ZEJ A;  9RUB A;  1OHN A;  3JSM A;  2M4M A;  1YTY A;  1IKW B;  2DKO B;  2B4O A;  3JB9 k;  1MML A;  2C2K B;  3HSZ A;  5GAE U;  3KHL A;  1FFG B;  4ZPW R;  1VQS A;  4USW A;  5F0U A;  1RA7 A;  4A46 A;  1ARR A;  1CQN A;  1F3V A;  1WKK A;  3ZC4 A;  5D15 A;  1KN6 A;  5THW A;  3IM9 A;  4KBI A;  1TKX B;  2MTL A;  1JLE B;  1ZM9 A;  4RUB A;  3ZTP A;  1WC4 A;  3OSP A;  3NGT A;  1DFD A;  4JOU A;  3BSO A;  2EK1 A;  1KQK A;  5KFN A;  2DRB A;  1M5P C;  5LM7 E;  3EPG A;  2LCW A;  1BY9 A;  4NEZ A;  4DR3 F;  3I4P A;  5EHH A;  3RBZ A;  1Y3K A;  3GIR A;  3J7Z T;  2AYE A;  3PCO B;  2W7P A;  2VFS A;  1VC0 A;  1AFI A;  3GMG A;  4WFB Q;  4DF4 A;  2VOD A;  3AJD A;  4DZ6 A;  1AW0 A;  2J76 E;  4ATN A;  1KLN A;  1YK9 A;  2U2F A;  1C0T B;  3QYY A;  5B0A A;  1KTV A;  2RDD A;  5DO2 A;  3VTI A;  3J7Z 5;  4DLG A;  3QT8 A;  1G4C A;  1R0C B;  1RHU B;  2BRL A;  4K0K J;  2VBY A;  3QT5 A;  2E9T A;  1QJH A;  2AF6 A;  2GQ2 A;  3PM9 A;  3R27 A;  3LWL A;  4DQS A;  3M8P B;  4XIU A;  4WP8 A;  1U6B A;  4C8K A;  4ZLP A;  2OD4 A;  4DV1 F;  3T1H F;  1UWA A;  3D9B A;  3HHL A;  1YJW S;  2FVS A;  2JEJ A;  4ED6 A;  1F60 B;  4IR1 A;  4LVO P;  1HPZ A;  4U7U D;  2RD5 C;  1V3R A;  1PO6 A;  4U67 Q;  2ASL A;  2HLT A;  2NCK L;  4JI0 F;  2CPF A;  1J27 A;  4F36 A;  4UQG A;  1HNZ F;  1G7C B;  4DR7 J;  4EGL A;  1PAR A;  2XMK A;  1HA1 A;  4KKO B;  4FDF A;  4X4U A;  1WTB A;  1VGY A;  2KL8 A;  3M6X A;  2QLX A;  4FVC A;  1HR0 F;  4LF7 J;  1C0U A;  2KYZ A;  2PC6 A;  5AJ3 J;  2NXC A;  3AA8 A;  1RIS A;  1I94 F;  3FZ2 A;  1IBL J;  4LRD A;  2BRK A;  2ZE2 A;  2FLO A;  2FY8 A;  2R4F A;  3J7Y U;  2AHO B;  2MKK A;  3FZB A;  2YKN B;  1RDR A;  4BWJ A;  4DPO A;  1S10 A;  4B3R F;  7FDR A;  1U1L A;  5KFU A;  5L46 A;  4ES1 A;  4W92 B;  4LFA J;  3TYT A;  1N34 J;  3BDE A;  1JB0 C;  4CIO A;  1XNQ F;  1U26 A;  1EIY B;  4OJ3 A;  2JZ5 A;  1RCX B;  2YKA A;  1SJ1 A;  4EBC A;  4ELV A;  3OTC A;  3KLE A;  3BKF A;  4QIE A;  4USI A;  1ARQ A;  1UJ4 A;  1HWK A;  4HAC A;  1ROF A;  2DD8 S;  3MOJ B;  1XEZ A;  2CNK B;  3AB2 B;  2FLP A;  2KKE A;  2KFY A;  2V8H A;  4J37 A;  1EA4 A;  1RHJ B;  2EW9 A;  2ZKT A;  2QV6 A;  5GVQ A;  3TAM B;  3TNV A;  3QO9 B;  3C3L A;  2FVQ A;  5GAH I;  2B7C B;  3IXQ A;  3JS9 A;  3MUV P;  4LFB F;  2DRD A;  2J7U A;  1WG1 A;  1LWF B;  2MQ8 A;  4KFB A;  5E0O A;  1H98 A;  4UZC A;  4DX6 A;  4DG1 A;  2XZW A;  5KFB A;  1UMJ A;  3KHG A;  1OIA A;  3H4D A;  1MRO B;  5JJB A;  1HBU B;  2DIU A;  4IRC A;  5A8R A;  1RE1 B;  5IQQ A;  2FUG 9;  2LFV A;  3CXC R;  4A8Y A;  2F8H A;  3F73 A;  1N56 A;  4F4Y A;  2BNW A;  2ILZ A;  4HHH A;  1T95 A;  1JJH A;  2N7Y A;  3H20 A;  4ZJQ A;  4XAK A;  3BF4 A;  2DR6 A;  1RJJ A;  4OLP A;  1WEL A;  4OJG A;  4YUD A;  2E5I A;  3SDE B;  1HNI A;  1RWM B;  3C6U B;  4H4M B;  3A8I A;  4QR1 A;  1LQ9 A;  5IT0 A;  3CC7 S;  3A4T A;  3ZTQ A;  5L39 A;  3T5H A;  2IM3 A;  4ZVE A;  2VJU A;  2W4P A;  4O0N A;  1LEO A;  4LSN B;  2UUA J;  1CS4 B;  1NSK L;  4ALZ A;  3J80 U;  2EFP A;  3FGV A;  2ZVI A;  3G82 A;  4DEZ A;  3M30 A;  1UVM A;  2MKH A;  3MI7 X;  2E5H A;  2FPH X;  3E01 A;  3W63 A;  3OUY A;  2ZJR Q;  2R7R A;  3FC9 A;  5E2Q A;  1X5T A;  5HL7 Q;  5CZV A;  1M1K T;  1B4S A;  3FBB A;  4OV6 A;  4RBU A;  2W1B A;  4O4G B;  3P5B P;  4RW6 A;  5AXL A;  5BYR A;  5T41 A;  3W5X A;  1D9D A;  3G8Q A;  3MMA B;  3OTE A;  3P8B B;  4DPY A;  2F8M A;  4RU9 A;  4ECY A;  3CJ3 A;  2HZV A;  3RRG A;  4K2J A;  2KT3 A;  5HAO A;  4CQ1 A;  2OFH X;  2VPZ B;  1NSA A;  2RQ4 A;  3Q8U A;  1LKZ A;  2WHO A;  1GXT A;  4WWS A;  4ED7 A;  3N5F A;  4OI4 A;  2K06 A;  4DOZ A;  1C1C A;  3TW0 A;  3T1H J;  2KRB A;  1X5P A;  1OY9 A;  4ELT A;  3IG1 B;  4NCG B;  5DJB A;  5SZT A;  1UWB A;  4ECS A;  1SL1 A;  2K3K A;  2VPX B;  1U48 A;  4K2X A;  2KTQ A;  4LF9 J;  1S1U A;  3AOC A;  4FXE A;  2RML A;  3GJS B;  3M2R A;  3KK3 B;  3TP2 A;  1KHV A;  2LDY A;  4CLS A;  2B9W A;  5D3G B;  2W2Q P;  3JQJ A;  4D3G A;  3IAM 9;  5DM6 Q;  4NZ0 A;  2BAB A;  2DHA A;  2ZBR A;  4NI2 A;  4DUY F;  4TU9 A;  2D3O R;  5D8H B;  4C98 A;  3IC1 A;  5HRO A;  4DQQ A;  4JI7 F;  4RW8 A;  5ETQ A;  3BJY A;  1HI0 P;  1S1X A;  5F8J A;  3Q24 A;  1R8H A;  1SCJ B;  1V6H A;  2XNQ A;  1U0H A;  1N4L A;  3DGV A;  4WZQ A;  1RKI A;  4GVL A;  3W9H A;  4CYU A;  2P5V A;  4KV8 A;  4JUZ A;  3BQ0 A;  2MHN A;  1K44 A;  3F41 A;  5DQG A;  4DR4 F;  2R7V A;  4ZVH A;  2AIR B;  2RE1 A;  4FKX A;  3UCU P;  2IVM A;  4O3N A;  3BQ1 A;  2E1C A;  2DR7 A;  1NM2 A;  1RHQ B;  4Q44 A;  1TL1 B;  3CCL S;  3GJR B;  3NS7 B;  2ACY A;  1Y5L B;  2B4U A;  2UXB F;  1AT1 B;  2HHH J;  1FK9 B;  3HD1 A;  4LJM A;  3RRH A;  2FHK A;  5IWA F;  4QWA A;  4TLQ A;  4LF4 J;  3EXC X;  2RKI B;  2VG6 B;  4I64 A;  4I6Y A;  1YJU A;  5GAG U;  3ENA A;  5KG7 A;  2V2K A;  5E3R A;  1DHM A;  1PBU A;  4OYI A;  1W25 A;  1SBR A;  1RTZ A;  2QYG A;  2BA3 A;  1IWA A;  1HQE A;  2RRB A;  3DXB A;  3AJ2 A;  3FBF A;  3QPI A;  1JNR B;  2FHO B;  2QA4 G;  4P75 A;  4N77 A;  2KM8 C;  2G1H A;  2YBV A;  2QMU B;  4B3S F;  3C16 A;  2XYH B;  2BE9 B;  2COL A;  1S49 A;  3MMA A;  4MTP A;  1BUX A;  2PA3 A;  2QMW A;  2ROG A;  1SKS A;  3LGH A;  2XC9 A;  5E5N A;  2A18 A;  2YQ1 A;  2KHC A;  1YIJ S;  1OJ4 A;  2V4J A;  4P6Q A;  4PZV A;  3C19 A;  3KK1 B;  1D3W A;  2KJW A;  3Q22 A;  3GP9 A;  3HHD A;  4EI2 A;  4TKT A;  1BLU A;  2BOP A;  1L3U A;  1T9Y A;  2EFG A;  3IS9 B;  2VFV A;  4QW8 A;  3VR1 A;  4D8J A;  3PIO Q;  4ZS6 A;  1Q16 B;  2MLY A;  5ETS A;  1RYR A;  5FDL A;  2ZBC A;  2C3Y A;  1T9U A;  3IWL A;  3N79 A;  4C8M A;  3W2W A;  5LT5 A;  5DG8 A;  4DSF A;  4DUY J;  2DH9 A;  3HHN B;  2HQI A;  1CUL A;  2B0G A;  2CRL A;  3ISN D;  2NXE A;  3QGH A;  4KV8 B;  5HI7 A;  5K8M A;  5EX0 A;  1VQK S;  1SH2 A;  2V5H G;  5EDW A;  3CIM A;  3CJ2 A;  4WK1 A;  4ICL A;  4GC7 A;  2J8S A;  3TAQ A;  1TK5 A;  3MZI A;  2HQC A;  4USK A;  1U8S A;  4DV0 J;  2H4Y B;  1RTH A;  2KOE A;  2M2B A;  2U1A A;  5IC4 B;  3S1T A;  3ZZR A;  3HXM A;  4J9Q A;  2IMW P;  4LVN P;  3PFO A;  3FEZ A;  4DPT A;  3MFI A;  3QWU A;  4YB7 A;  3R7S B;  1YJN S;  3KXD A;  1X60 A;  4FYX B;  1N0U A;  5A0Y B;  2VG6 A;  4J9N A;  2R8G A;  2K5J A;  5DRK A;  3W3S A;  2Y1L B;  4YR2 A;  3SI8 A;  3NNH A;  3JTP A;  1Y10 A;  3ZZZ A;  4YHH F;  2MST A;  3C14 A;  3G2X A;  4UOG A;  2HK2 A;  4Q7A A;  2XSJ A;  2UXC F;  1KR4 A;  2ROE A;  3G9C A;  1FRX A;  1X4E A;  2CPJ A;  2Y1R I;  4QYR A;  3TUI C;  2BM1 A;  3D7S B;  4R8U B;  3ZTR A;  4S0M A;  2VAS A;  1MN7 A;  2D74 B;  2HIQ A;  3GCW P;  2C3M A;  3QRR A;  1N33 J;  1I6J A;  3TA2 A;  4IDK B;  4A8W A;  4J91 A;  3VQT A;  4R5P B;  1Q86 T;  1X7V A;  3EZU A;  2Q66 A;  4JV5 F;  1CC7 A;  1RTD B;  2W4D A;  1NEE A;  4PYA A;  3CJK B;  3HHL C;  2MSS A;  1XMO F;  3MUT P;  3ISZ A;  4H54 A;  1G2E A;  2VA2 A;  1UKU A;  1DAR A;  3U1N A;  2G9O A;  1S57 A;  1WF2 A;  4K5R A;  2WSE C;  3C14 B;  5F8N A;  3BH7 B;  1N88 A;  1YBA A;  4PPD A;  2JHE A;  3KK3 A;  3PX0 A;  1VOM A;  2R8K A;  1IKX B;  2F40 A;  5F0W A;  2X1G A;  4N47 A;  1QTM A;  4RNF A;  2QLW A;  1DTQ B;  1FO1 A;  2E5L J;  2A0F B;  4WPA A;  4K4T A;  3FKB A;  2YXL A;  1U1N A;  3NG8 A;  2LLZ A;  1PJ5 A;  1IR0 A;  2H51 B;  1FKP A;  4P10 A;  3C66 A;  4QWD A;  3CT9 A;  3LAN A;  2RBF A;  1DQ8 A;  2CPI A;  4ZA1 A;  2DO0 A;  2YH0 A;  2OML A;  4LR8 A;  4PXD A;  2EG1 A;  5AXK A;  5C2C A;  2N7C A;  2FJX A;  3T1Y J;  3MM5 B;  4DV3 J;  2ASD A;  1JLG B;  1RT2 B;  4I67 A;  2YWW A;  5L1K A;  4KKO A;  2W9B B;  1M1G A;  5J1N A;  3QJJ A;  1MLA A;  4CLT A;  1P1L A;  3GII A;  3GWC A;  4L76 A;  2OEM A;  3NWG A;  4MIA A;  5ETO A;  5HAT A;  3AY0 A;  5I4M A;  2JLG A;  1JXL A;  4YB5 A;  4DR6 J;  1K0T A;  4ZPV R;  5KG6 A;  1N5T A;  3AQP A;  1MU2 A;  1PSD A;  1SV5 B;  4QQB A;  3PJX A;  5GAD I;  1XMQ F;  1RUS A;  1NK4 A;  4I69 A;  2ZH8 A;  4LMZ A;  2CQ2 A;  4OI6 A;  4ZCL A;  3E8O A;  1KWM A;  4IQX A;  4HTJ A;  1NDL A;  3DLJ A;  4CLW A;  1RT2 A;  3RAM A;  4LQ9 A;  4CLZ A;  4C9D A;  4U7U K;  1X4A A;  3BN4 A;  1P9Y A;  3VAI A;  2HND A;  1Q7Y T;  3LP2 A;  2NYI A;  4WU3 A;  3LAL A;  3ZZP A;  5HBM B;  2V6A A;  3DKD A;  2IBK A;  1VR6 A;  1TEL A;  2UU9 J;  4JI3 F;  2WOM B;  3FCW A;  4ZDN A;  5AJ3 F;  1HNX F;  2IA6 A;  1VQ6 S;  2M88 A;  4YHH J;  4NX9 A;  1TL5 A;  2DO4 A;  1Q79 A;  1UEK A;  2EFO A;  5ADZ A;  3DM2 A;  1S6Q B;  1NHU A;  1UVL A;  4TY8 B;  4LF1 A;  2J0W A;  4X62 J;  4Y34 A;  4Y2A A;  2D3U A;  2QL9 B;  3SCI E;  1LWF A;  3IMQ J;  4KFB B;  5HMZ A;  1VQM S;  1U25 A;  3CCQ S;  3GJQ B;  1CJV B;  1TUW A;  2CPD A;  4HR2 A;  4NLT A;  4DX8 H;  5DQH A;  1UJ6 A;  1YSJ A;  1S9E B;  1DLO B;  1MG7 A;  3R2C J;  3FQL A;  2IRY A;  3GU0 A;  5CYM B;  4G1I A;  3ILJ A;  4J9M A;  1XWL A;  1M5O C;  3V4I A;  4O3S A;  4OI3 A;  1NPP A;  1RWU A;  4J90 A;  5C42 A;  5HVH A;  5F41 A;  4F7V A;  3K5L A;  3CCE S;  3HT0 A;  2GS8 A;  3PYD A;  2HS4 A;  4JI1 F;  2J6S A;  4XPE A;  3HM9 A;  4PWU A;  2DVI A;  3KOA A;  5H9F K;  5ETM A;  4RLE A;  4TYB A;  3TJA A;  3TAN A;  2BQ3 A;  3UR0 A;  5D4O A;  4NLY A;  3N9U C;  4NXM J;  1Y00 A;  2DGQ A;  5EGY A;  3QWP A;  2BA9 A;  3G6V A;  2G0J A;  3NLC A;  2QRR A;  1G6B A;  2XO6 A;  4G1Q A;  4N76 A;  3DRS A;  4O3R A;  3AH6 A;  3AOB A;  3W9I A;  4QIG A;  4NLW A;  1NAQ A;  2H1O E;  1RK8 A;  1S1V B;  4MJK A;  2FJW A;  1JJ2 R;  4C0B A;  1HBM B;  3C46 A;  1GTH A;  3CE8 A;  5A2Q U;  4DQI A;  5ETT A;  2F1F A;  4Q8F A;  1RAG B;  2LEP A;  4RW9 A;  1KQF B;  5LMU F;  4A8K A;  2LQJ A;  1AUS L;  4G3I A;  3CWJ A;  1T9V A;  3G96 A;  2CQH A;  4WFY A;  1YWX A;  2FD2 A;  5KG4 A;  3N5B A;  1FK9 A;  1TQL A;  4HDG A;  3UD3 P;  3OQ2 A;  3BKU A;  3M05 A;  3J80 Y;  3KKF A;  2ADL A;  4DF8 A;  1LWE B;  1RT3 B;  1FRI A;  1HIY A;  2MKI A;  1N48 A;  4A8Q A;  1RBO B;  4PG5 A;  3KDN A;  4FN5 A;  1S7I A;  3NKY A;  2FZC B;  1MSW D;  1X9S A;  1S9G B;  1FA0 A;  3PYE A;  2GZO A;  5A6W A;  1Z4U A;  1HD0 A;  3D1O A;  2JEG A;  2OPR B;  3GV7 B;  4NAS A;  5KAK A;  1U47 A;  1NO8 A;  2CXE A;  3DDK A;  2QLB B;  2ZH2 A;  8ATC B;  2A6O A;  1Q0N A;  2YKP A;  2ZC4 A;  1LK5 A;  3KG4 A;  2OPP A;  4DZD A;  4X62 F;  1FWL A;  1TTH B;  1DLO A;  3ICL A;  2NZ4 A;  2VFU A;  2MZT A;  3RZA A;  2E1R A;  4AT1 B;  3O2I A;  2MHE A;  1IQT A;  1O8B A;  1U8W A;  3KWM A;  3R5A A;  5HK4 A;  4F67 A;  3TZX A;  2OEL A;  1VCT A;  3DMJ B;  1S4F A;  1TKZ A;  2CQB A;  1OQ3 A;  3EE3 A;  3NRB A;  4H4O B;  5B0C A;  4DLE A;  4FS1 A;  3TZW A;  3SSR A;  4ZMM A;  4NA3 A;  1UA1 A;  2YNG A;  3MHY A;  5HLF B;  1FKA F;  5DGA A;  1KVJ A;  1R6V A;  1MNE A;  2VU5 A;  4UUW A;  3FDS A;  2H4W B;  2FHJ D;  3BGU A;  4NYZ A;  3RGI A;  2FHJ A;  4LF9 F;  2MQP A;  4JI6 J;  1QSY A;  1FVS A;  1HPZ B;  2LQB A;  3GYX B;  2XCP A;  2D9P A;  3GCX P;  3MDF A;  5E7O B;  1FD8 A;  5D0E A;  1QD1 A;  4Q43 A;  2QE5 A;  2RSQ A;  3DHW C;  3NY0 A;  5T7L A;  1RKJ A;  1HHT P;  4OHY A;  5K9F A;  1IKW A;  2Y0S D;  2C22 A;  2GHV C;  2FLL A;  3OVB A;  4DL6 A;  2C3U A;  4QJV A;  4DQP A;  1F5B A;  2YWK A;  5U47 A;  3V4M A;  1RT5 A;  3PR5 B;  1KVI A;  3T5L A;  2BAN A;  2GGP A;  4DBQ A;  4P72 A;  2RDJ A;  1C0T A;  2I9S A;  3EMT A;  4HH1 A;  4RWW A;  3LJP A;  2PO4 A;  1IUJ A;  4KYZ A;  5KFX A;  1RAD B;  4LBI A;  3VVT A;  3M9M B;  4X84 A;  3QAT A;  4RZR A;  4DV2 F;  4AQY F;  4DS4 A;  5CAA A;  4OI0 A;  4AAI A;  1OPI A;  4J9U E;  5A76 A;  4WKR A;  3D3C J;  4ZN1 A;  4RW4 B;  1WF0 A;  4GKK J;  2I5J A;  3M8S A;  3T9N A;  3NMA A;  3QID A;  2QZ8 A;  2J0Q D;  3DLH A;  3T5J A;  1UVI A;  4Q8E A;  1B7Y B;  4P71 A;  5A8K B;  4JBC A;  2UXD F;  3SYZ A;  1X31 C;  1Q78 A;  2A2D A;  4M5M A;  3C6T A;  5T14 A;  2BAN B;  2GGP B;  2KHD A;  3B82 A;  4LF6 F;  4UW2 A;  5C24 A;  3KHR A;  2CJQ A;  1PAE X;  4ZVU B;  5K14 A;  2QSF A;  1H72 C;  2QL7 B;  2LQ5 A;  3IG1 A;  4NCG A;  5CYQ A;  3H7H B;  3RUB L;  5KFP A;  1C0U B;  2ZH6 A;  4MMO A;  3NCP A;  1RLC L;  5KT4 A;  3RTV A;  2MY7 A;  3B78 A;  3S01 A;  1IM6 A;  1ZOT A;  3US5 A;  2BNZ A;  2HBZ B;  2XMJ A;  3TJ8 A;  1U24 A;  3MEG A;  4ZIV A;  5A8K A;  2EEY A;  4X64 F;  3I56 S;  4I1T A;  1LW2 A;  1MYK A;  4F4A A;  3UN5 A;  3UNG C;  1LW0 B;  3D54 A;  2QMX A;  3W2V B;  2V0N A;  2I8E A;  2V9K A;  1ZAX A;  4E0D A;  2CAD A;  3PKM A;  4C48 A;  3CD5 A;  4AL5 A;  3SZ2 A;  1Q4R A;  2ZWP A;  3ETM A;  3OXL A;  3Q8Q B;  1DY3 A;  4KE5 A;  4HEA 9;  2EKY A;  3HI9 A;  2ZH5 A;  1ITP A;  2XSJ B;  5C7P A;  2HVH A;  4FF1 A;  4HAC B;  3LPE A;  1YDL A;  2CYY A;  1X4B A;  1P27 B;  2AJ2 A;  2J7W A;  2NUH A;  2QFI A;  2XSF A;  2Z2L A;  1YJV A;  4M5J A;  1VI7 A;  1FT8 A;  1WOR A;  1UZH A;  2DEI A;  4PG7 A;  1CJV A;  5KFD A;  1NZ8 A;  4ZVP B;  5L1J A;  2HNY B;  3TUP A;  3DU5 A;  2HHP A;  2OTJ S;  1BQX A;  1TL7 A;  4KSE B;  2C42 A;  2E1A A;  1A0O B;  2JXI A;  4LSZ B;  4PCQ A;  4PYD A;  2QFJ A;  3P4U B;  3KLG B;  3SQG A;  1CG2 A;  3R5J B;  1SVD A;  1K1S A;  2RIL A;  3PW5 A;  2KFZ A;  4FNH A;  2IA0 A;  5LMN J;  1KRP A;  4ECZ A;  4A8X A;  4LQ3 A;  2JL9 A;  4UY8 T;  3LH2 S;  4DV1 J;  4JI1 J;  3IRX B;  1QAY A;  3D1Q A;  1B70 B;  5J2P B;  5C25 A;  2Q43 A;  4CLF A;  4DV4 F;  2FJB B;  2P9G A;  4C3L A;  3DCA A;  3LW5 C;  3W8P A;  2DPI A;  1HNZ J;  4DV0 F;  4ZVQ B;  4O4R A;  4URG A;  3PV8 A;  2IDL A;  4CTA A;  3V6H A;  3HVW A;  1FRM A;  1N5S A;  3BR8 A;  3W65 A;  2R8H A;  1S9F A;  2GA7 A;  4WE1 B;  2H1Y A;  4ZVR B;  5IV4 A;  2DGV A;  3QOQ A;  2B6A A;  2GIQ A; 
#chains in the Genus database with same CATH homology
 3LGH A;  2K6L A;  1EA4 A;  2JXI A;  2BSQ E;  1Q5Y A;  1MYK A;  3QSI A;  4ME7 E;  3FMT A;  3FT7 A;  4HV0 A;  1B01 A;  2BJ7 A;  1BDV A;  3VW4 A;  1BAZ A;  2K1O A;  2WVB A;  4FXE A;  1BDT A;  1MYL A;  2CAX A;  2JXG A;  2CAD A;  2K5J A;  2H1O E;  4D8J A;  2Y3Y A;  1MNT A;  2CA9 A;  3GXQ A;  1B28 A;  1ARR A;  2BJ1 A;  1X93 A;  1QTG A;  2FGC A;  3H87 C;  3OD2 A;  1IRQ A;  2F1F A;  3BKF A;  3PHT A;  2K9I A;  2KEL A;  1NLA A;  2BJ9 A;  2WVF A;  2RBF A;  2K29 A;  2BA3 A;  1P94 A;  2BJ3 A;  2BJ8 A;  2CAJ A;  3VEA A;  3BKT A;  1U9P A;  2GPE A;  3VEB A;  1PAR A;  2AY0 A;  2HZV A;  2WVE A;  1Q5V A;  2WVC A;  2JXH A;  3QOQ A;  1ARQ A;  2BNW A;  2NZC A;  2HZA A;  3BKU A;  2BNZ A;  2WVD A;  2CPG A;  2PC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...