2BJ8A

Nikr in closed conformation and nickel bound to high and low-affinity sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEIISSLHVHMDEHNCLEVIVVKGEAKKIKMIADKLLSLKGVKHGKLVMTSTGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transcription
molecule keywords NICKEL RESPONSIVE REGULATOR
total genus 37
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bj8A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2bj8A02
2BJ8A 2K1OA 1ARQA 2BA3A 2CAJA 2HZVA 2JXGA 2CAXA 3OD2A 2BJ1A 2BJ3A 2K5JA 3BKTA 2BNZA 1MYLA 3PHTA 3LGHA 3FT7A 1Q5YA 3FMTA 2K6LA 4HV0A 1IRQA 2K29A 2Y3YA 2BNWA 1PARA 3BKUA 1MYKA 2GPEA 3QSIA 2NZCA 4D8JA 2BJ7A 1EA4A 1Q5VA 2CPGA 2WVCA 3QOQA 2JXIA 1P94A 2BSQE 2F1FA 2KELA 3VW4A 1B01A 4ME7E 3VEBA 2FGCA 2PC6A 1QTGA 2WVEA 1U9PA 2K9IA 3BKFA 3GXQA 1BAZA 2HZAA 2H1OE 2RBFA 1X93A 2WVFA 1B28A 2JXHA 1BDTA 1BDVA 2BJ9A 2WVBA 3H87C 1MNTA 4FXEA 3VEAA 2AY0A 1NLAA 2CA9A 2WVDA 2CADA 1ARRA
chains in the Genus database with same CATH superfamily
2GO8A 1A0OB 3RW7A 3ZTRA 1X31C 2MQ8A 5DS7A 3U02A 3ZC4A 3ZZRA 4ZHRB 4CRJA 2VONA 3JYTA 1K73T 1FVQA 2KU7A 4LSNB 4NLSA 2HG4A 2WB4A 4P7VA 4P72A 5A2QU 3EPIA 2DO4A 2XMVA 5LJ5Y 4QBUA 2BQUA 2W7PA 4EO8A 4LBHA 4Q7AA 3OSPA 3D0GE 1KLMB 5CA5A 4WPAA 4N8NA 2JXIA 1X4DA 5CYMB 4X4VA 4CH1A 3I4HX 4OYOA 4B3SJ 1IKYB 1TKXA 4WYWA 1PKUA 2FY1A 5HMWA 3D2WA 2HWTA 3J81Y 4WKRA 1S57A 2X51A 5FLXY 2AYGA 1WACA 1GMWA 2EK6A 1PCAA 1RQ0A 2XI2A 1XIQA 5KG6A 4CNZA 2RQMA 3BPSP 3CB4A 3B78A 4TY9A 5M2UA 5IS2A 2KM8B 1KC8T 3EMTA 1MNEA 4NXNJ 2J9DE 3QLHB 3RRKA 5IM0B 4BLGA 3NXZA 1X5PA 4F3QA 2JH3A 3VAJA 3SSSA 3NP5A 3PW0A 4XPCA 3OTCA 2D3ZA 2XSJB 4ZLJA 2EC0A 3SMZA 3C19A 4NL5A 3JB9k 4F36A 4NXMJ 1IKXA 3K2YA 1I94F 1A9NB 5J2NA 4I4BA 3I32A 1G6BA 1A7GE 1ROFA 4KHMA 2ATCB 3T5LA 4FPIA 4E0DA 4F2SA 1SJ4P 2B7CB 1SI9A 3GJRB 2KVIA 4NLDA 4Q0BB 2C42A 1Q81T 3V2UC 2YH1A 3D5MA 1T9XA 4N76A 3ZNUA 3TI0A 4AFFA 3KMQA 5F8MA 2CAJA 1JMTA 1N54B 3BJYA 4ZVQB 3MUVP 2L9WA 3N5BA 2HGMA 1WC3A 2K2PA 2VKZG 4DS5A 3TRGA 4DR6F 2EBGA 2QC3A 4G65A 2R8IA 2OGUA 2GPEA 4O3SA 3RB6A 3MCMA 3ONQA 2NXEA 3A3NB 3K8VA 3VWSA 4FBTA 3TANA 2DNQA 2HEKA 2AJ0A 2B43A 2QJ3A 5H9FK 3OXFA 4DR7F 4K50A 1RLCL 5D6GA 4C11B 1HW9A 2M88A 3F44A 1K9MT 3WC2A 2RRAA 1QY7A 2ZD1B 1JXEA 3H59A 2KDOA 1N5TA 4YMEA 3OL9A 2HHWA 1DBDA 1YJ9S 4K0KJ 1RAGB 4PUOA 3HJFA 4KFBA 3H5YA 1TUWA 3HKZD 1YKWA 2V2ZA 4O4RA 3HHLB 1RWWB 2CNNB 1JLFB 3OD2A 4ZPTR 2CQIA 3Q8PB 2X7IA 2P9CA 2OJ3A 5CHCB 5I42A 4EWTA 1FX4A 2ZITA 1TP7A 2F9DA 3RBXA 4F67A 1H38A 4UY8T 2MKYA 3Q0AA 1CBKA 3PW4A 1QVGR 4NWBA 1N6QA 1U0HB 3DRPA 3V6KA 3ILIA 4K2XA 2K7KA 4YS2A 1DRZA 4PG4A 2E9ZA 3DN9A 4DX7A 5E3RA 4CDIA 1UFWA 2CQ1A 3VW4A 2JHEA 3HP6A 1Q7LB 2BV3A 1QTMA 2HVIA 3DYAA 2AEMA 2XC9A 3GIIA 4KPYA 4DQRA 5KTQA 3M30B 2YPZA 3J7Z5 2XO7A 2BM0A 1TU0B 2EEYA 4IRKA 2V34A 2KJVA 3K89A 3MMBA 1RT7A 3MMBB 2R7XA 1RHJB 5DQIA 2A10A 1MMLA 5HQ8A 4OI4A 1TVRB 2M7SA 5KT7A 1SL2A 4B9NA 4EMDA 4DLGA 3BSOA 4KKOB 1YITS 2RQ4A 1XMBA 1F2HA 3MEGB 2NS1B 2IRUA 3PFEA 3TVKA 1F9EB 1PAUB 3GIKA 1A6LA 3GV5B 4MYUA 4BC9A 1H74A 3MM9A 1BHNA 3M8ZA 3POTB 4RUBA 2AV5A 1BQMB 4JV1A 1RXOB 4K5SA 3C66A 1T3NA 3VALA 3GZ7A 4DZ6A 3C6TA 2IMWP 3QATA 1J27A 3QYYA 2KG0A 1CEZA 2Y0SD 4DSIA 2V8GA 1RHUB 3ZZPA 4WBFA 4X4UA 3TQEA 2BE2A 2V4RA 2WVFA 1N34J 1AZSA 1SJ1A 4M5DB 1R0CB 4LRVA 4G6VB 2M9KA 1B28A 5DDQC 2DVIA 3CMES 4FKXA 5C2GA 4Q0BA 3UR0A 4CLWA 3RB4A 2BZ2A 3POTA 4R0JA 2HIYA 4EFAC 1HYSB 4FP9A 2B0GA 4NA3A 2GJFA 4RU9A 5KFWA 3G87A 2K29A 3SCIE 2F3JA 3IGVA 3TJAA 2RILA 1D3WA 1YJWS 1OY6A 2ZE2A 1QTNB 5KFTA 3W9IA 2OD4A 2UV8A 1SUQA 2W8LA 4ED6A 3UD5A 2EK1A 2CQ4A 3ZTSA 1ZM2A 4B3TF 2V2VA 8ATCB 4L75A 4ZJLA 4OHWA 4KTQA 2EFVA 2YQ3A 3W9HA 4QR2A 4M63A 2A2BA 4CTAB 1ZZNA 4J9KA 1VK8A 3QAUA 4ED3A 1HBNB 3BN7A 3MAAA 4LIWA 4Y00A 4FXEA 4EU0A 5E3AA 1JK9B 5HVHA 4OHVA 4B9UA 2B5JA 5BR8J 2V2QA 3GIMA 2DRAA 1X8DA 1VLYA 5EWEA 3NNCA 4OJ3A 5H9EK 4YEAA 4NYOA 1FX2A 2DHGA 3LGHA 2J76E 3BREA 3PRVA 4KT0C 3LALA 2HRUA 3U1MA 2MZTA 4LR8A 4ES3A 2E44A 2L48A 5C2CA 1RCOB 1VQ5S 3IAM9 2K06A 3G6XA 2QRRA 3GJQB 4QIEA 3J81U 2MGZA 1JXVA 3DHWC 1TAUA 2W1BA 1C1CA 1NK5A 2H65B 2W4CA 3VEBA 5D0EA 4DG1B 2GIQA 4JI4J 4DV4J 3LGNA 3RTVA 4LRCA 4Z2XA 1NRKA 2PD1A 4K2JA 1DQAA 3ZZ0A 4M5GA 1J5OB 4OYWA 3CCUS 1SL1A 2RIJA 3LP1B 4UOCA 2VJUA 4IOCQ 3W64A 4DR3J 1ITPA 2O66A 3PCOB 4TY8B 2W2PP 1WKKA 2VBZA 3M8PB 1M1KT 1Z4UA 4DBQA 2E1PA 4GVBB 5RUBA 1FEHA 3W2WA 3BKUA 1JJHA 4U9RA 5J1NA 1R8HA 2R8JA 1FEEA 4J9SA 2F4VJ 1XWLA 2MLYA 4FYYB 2BR0A 1HNWF 1NMEB 2NZ4A 3VAGA 2B4PA 2DY1A 2WOMB 3SCKE 4O3NA 1HBNA 1IM4A 2L08A 3C15B 1R3NA 1YI2S 1VRUA 2R7SA 1NHKL 1YJ7A 2QSFA 2DXDA 1M5SA 4F4AA 1YJTA 1UP1A 4P2MA 1JLGA 3DLKB 4WCEQ 3KK1A 3ZZTA 1NUEA 2J6TA 3LO3A 4ETZA 1VQLS 4B3TJ 2VOOA 3D1QA 2OFHX 1BWEA 1CS4B 3CD0A 3GILA 1YX2A 3VVTA 2POKA 3NCQA 2JVRA 1V3SA 2E66A 4KO0B 2J9EA 4M8LA 3J81j 1FF2A 2A3JA 4UUXA 4A4JA 5HANA 4DV0F 4DI6A 2UU9J 4A8SA 2DEIA 4OJGA 1XNQJ 4G1PA 2IM0A 3GYNA 5LMNF 4ZVSB 5F9LA 1Y0HA 2YNFB 1R8PA 1RBLA 3KK3B 3DMJB 3SV3A 1VQ4S 3THTA 2RKIB 2M52A 1L5UA 1NDCA 1VISA 1RT5A 1WOPA 2VASA 2LEAA 3FC9A 4R25A 1WEXA 4AXJA 4C98A 4J9OA 3BH7B 2OHDA 1VQNS 4Y0FA 2BANB 1WC1A 1I1GA 5J2MB 1VHFA 3HHLA 1RWOB 4LF8F 1F2GA 4CTAA 3HVAA 3OQ2A 2YKQA 5E3QA 5SUHA 4RNOA 3MR5A 2Y8YA 4WZMA 1R7IA 5B0EA 5AXNA 3L3CA 2HNDA 1RHMB 5CYQB 3CPWR 2UXCJ 1JIHA 3Q8RB 5GAEU 3M9NB 1Q8LA 1WJ9A 2KI2A 3GMGA 1ZBTA 4YY3F 2VU5A 1IQTA 1DARA 1TL3B 2MKHA 4NLQA 4OX7A 3QT8A 3IP0A 1HBOB 5IC4B 3M30A 4L73A 2QT7A 1YRXA 4I68A 4NE9C 3TVYA 1TV6B 4DR1J 3HVRA 2AP6A 2DNRA 3K58A 1C2PA 2WSCC 4ID5B 5KFGA 4OYMA 1N36F 4NA2A 2A1BA 1N4LA 1URNA 4RWXA 1MSWD 4Y3CA 1UTAA 1NK4A 4K4UA 1NH7A 1PC4A 1RTIA 2QL9B 2B4OA 3A8IA 4F0MA 4NLGA 3IWLA 1BQNB 4ED5A 3QIPA 4DXLA 3NNEA 3BB5A 4PWWA 4PXEA 2VFSA 2BW7A 2CPJA 4DPUA 4TU8A 1RKIA 3CD6S 2VUGA 4BWJA 1L3TA 1RAEB 4KAIA 4PWDA 3QJJA 4I0WA 4DCPB 2R2TA 1JLCA 3C6UB 5CXTA 4DL2A 2AJQA 2Z30B 1N34F 4C8OA 3L9ZA 2M8HA 2FHJA 4GC6A 4TYBA 4KC5A 5KG7A 2AU0A 2UUCJ 1KTQA 3HHKA 4CO4A 1RWMB 3PACA 5IT0A 4C11A 2QFJA 2BE7D 2J6UA 3CULA 2IFXA 3PYDA 4ZN1A 2J0SD 5KAKA 3MFIA 2JC1A 3DGPA 3O44A 5DDPC 2RRBA 2B8PA 4R8UA 2VQFJ 4DV7F 4H4KA 3GYGA 1ARQA 2WRMA 3M8QA 3NNAA 2XMTA 1UETA 1UZDA 4MJWA 2D9PA 3AXMA 2MDAA 2AYEA 1KVKA 3MGJA 4MFBB 3UWTA 4CLFA 5LSLA 5C25B 1HI8A 3KDNA 5HROB 3NCRA 3PR5B 4B9TA 4RBTA 1JLAB 3R5JB 3M32B 1UW4A 2CJQA 2GVZB 2OKQA 1P1TA 2A18A 5J1PA 1QUVA 3IS9B 1Q53A 2Z56B 4XTTA 1OQ3A 1M90T 2DR8A 3W3SA 1KLNA 3IRXA 1D9FA 3TYTA 1PJ6A 5C42B 1YJVA 4H4OB 4NLUA 4LRAA 2NCKL 5D4NA 5DQHA 5CZXA 3H20A 4DCJB 1FTRA 2MY7A 7FDRA 2IA6A 1LNQA 3DYAB 1VC5A 5J2MA 2ZD1A 2GQCA 3S1TA 4NLRA 2C3OA 1BDVA 2DHAA 2BJ9A 5HO4A 4A8MP 3BGRB 2XS7A 2VODA 2KRRA 2ZUAA 4NZ6A 3MM7A 1W2IA 1YQHA 2IYGA 2Q3PA 4M1KA 3CEDA 4NXMF 2WK4A 5D4PA 3E3XA 1RTZA 4X4SA 1F60B 4AL6A 3I5CA 2OSQA 2QMWA 1FXLA 3W8PA 1E6YA 4MT1A 3ISZA 3DCAA 1FESA 3G2XA 1TL4A 1S1XB 3KXDA 3U1NA 2DJWA 3GCXP 2Z2MA 3CDBA 2V5HG 2A2CA 3CCMS 2Q43A 2D3O1 2PI4A 4E2FB 4HI1A 2GQ2A 2XGQA 2DIUA 2HPUA 3CO9A 4DR2J 1VS3A 4K59A 4ME7E 1F5BA 4CLKA 5AJ3J 1VC0A 4DV1J 4ZCKA 1VBZA 3FMWA 3H4BA 4CWBA 1W26A 1IVZA 4G1IA 1C1CB 1LQ9A 2HGNA 3PDNA 3MAHA 3OSNA 2FTRA 3K5PA 4ZVUB 3JS9A 3CJ5A 1PBAA 1D8YA 3OJSA 2HQGA 2PO4A 3BEGB 4OZ3A 3L7OA 1OYDA 5C24B 4JB8B 3KLVA 2R3VA 2UXBF 2AMCB 3ETMA 5E7OB 4AAIA 2J8AA 2ABYA 1VQSA 1TR0A 2OEJA 2J0WA 2WB1D 2H5EA 3LAKA 4N5SA 3JYTB 1YSJA 2Y3YA 3M8PA 3AOCA 4KGMA 4X65F 1TL1B 3K5OA 1RWNB 1LWEA 2K1RA 3FEYB 4RKUC 4LF8J 3CJ4A 3KLEA 1X4CA 4DV7J 4MKYA 2UU9F 4QIVA 2LA4A 1S97A 1ZAVA 5L1KA 2QN6B 2ZUGA 3QWUA 3PKYA 3DLGB 1WHWA 3MD3A 5A8KB 4ED2A 2CQ0A 1EZZB 1RB0A 3UCUP 2B6AA 3BYPA 3UFCX 4WU2A 4TNOA 3CMQA 2Y1LB 5FIIA 4CLLA 3R1HA 4ILLA 1HQEA 5ETTA 4RNMA 1F3VA 3R27A 2ZM6F 5J2PB 1RK8A 2MB0B 1NLAA 1R31A 1TKZB 4NLPA 1UWAA 3T3FA 4LQ3A 1QAYA 1FJ7A 1IQZA 1MG7A 4RX6A 1S6PA 3DU5A 4O3PA 1ZZFA 3HXMA 4OYXA 4Z7CA 5KFEA 2H1YA 3SDEA 5AXKA 1SJ3P 5L39A 4P71A 4FF3A 1G1XA 1UVKA 3VR1A 2AT1B 2DNNA 2GGPA 1KBRA 1IM6A 5J2QA 2NZCA 4O3RA 2Q66A 3M6WA 2DGTA 2YWHA 2RHSB 2XYHB 3MPWA 1RACB 2J7WA 3BR8A 3VGTA 1S6UA 1WHYA 2GZOA 1MWZA 2YKOA 2H1OE 5IV4A 3QZ8A 3T5JA 4OX9J 5BR8F 4K4WA 1QAXA 1WG5A 2HHPA 2OPRA 5A0YB 4LJMA 4WK1A 4HDHA 4DPXA 3RR7A 3FQKA 4OZNA 1QD1A 2VFRA 2WBMA 3D1HA 4RPFA 2AQ4A 1RHQB 1NK0A 2UVWA 4F3OA 1KVJA 1IKVB 1LWFB 3B82A 1MU2B 3DC2A 5K8MA 1B70B 1X5SA 2V8VA 5KFNA 4F2RA 1SQFA 1M0SA 3MEGA 3WC0A 4LSNA 3HCXA 5C25A 5I42B 2MKIA 3KLFA 5I3UA 2VC0A 2E5JA 1UWBB 2KZMA 1TVRA 1EP4B 3PO5A 1RZMA 4HH0A 3JSMB 2FC9A 1P9QC 3LTOA 2EKYA 5A8KA 2EG2A 3SBMA 1KWMA 1S77D 4EGLA 4O44B 1ICEB 4CM2A 2OO4A 3QNWB 1KSPA 1T9WA 4KQZA 4DV4F 2ZC3A 2GO9A 3IBCB 1NO8A 2YKMB 2W2OP 2OUGA 2WVEA 1JLEA 2VDHA 3J7A1 3HULA 1IKWA 5D3GA 2JNJA 4B9VA 4U7UD 1BDTA 2AYBA 4X66J 1HBUB 3DLHA 6FD1A 3ADAC 4ED4A 2C2KB 2CVIA 5F0UA 1E6VB 2BA3A 1V5VA 2HURA 4M5JA 1XQIA 2UV8G 3GE9A 4OQJA 3BGLA 5B0FA 3AJ2A 3W63A 8RUCA 5IZHA 1UEUA 5HK4A 4AUKA 3A8JA 3A8KA 4ZVFA 2E7VA 4V19X 3FCVA 1BQNA 3DFEA 3CJ8A 1X0PA 1GEHA 1IUJA 1LWCA 2ROGA 4U8YA 2R7WA 3FDSA 1HKAA 1CC7A 1U7LA 3KNGA 1R6YA 3MTJA 3H42A 1SL0A 4X4QA 1D8ZA 1GTEA 2KL8A 1OS5A 3CD7A 3EGVA 3E2EA 5FJ4A 2GA7A 2OSRA 1I3OB 3P3DA 3MPYA 4RUAA 2R2UA 5D77A 1HHSA 2VBYA 1U47A 3LWLA 5L9XA 3FEXB 3F0NA 3AD8C 3ILLA 3EUNA 4YR2A 2QEXS 1IBMJ 2HVHA 4C6AA 2CJKA 4O4GA 4LMZA 3OLAA 2E1RA 2ROEA 1K8AT 3BSNA 1RTDB 2CJAA 4ZDNA 1DZ5A 2IYIA 1S9FA 1KHVA 3AB2B 5F8HA 5KFQA 1U1KA 2QYGA 1UW9A 2C3YA 4NRTA 4OX9F 2KXHA 2JLEA 3R9LA 2A6OA 2CNOB 4F04B 3R5BA 1S0MA 4HV0A 4F25A 1JLFA 1SB6A 2HHHF 4M94A 3VHQA 2VPZB 4IQXA 2DCLA 2CYYA 2W24A 4EK2A 4EYHB 4ELUA 4ED8A 3CD5A 4DV2F 4IG0B 3EDRB 3R7NB 1RAOA 1T03B 2LYVA 4PRFA 2XLIA 2MMYA 3IS9A 4DUYJ 4J91A 2EW9A 1ZAXA 1S6OA 3PJ9A 4N7TA 2ZHBA 1HPZA 2BQRA 2MZQA 4UOFA 1FNOA 2IVYA 1U1RA 2MLZA 3LWMA 1SKWA 1Q7YT 5L8RC 4DQSA 1YRTA 2OFGX 3OXGA 3MMCB 2RJZA 3FSXA 4JOUA 3T1AA 3OJUA 4IH7A 5DRKA 1HR0F 2CADA 2BJ8A 2RAQA 2RUGA 1SJRA 3RG6A 4C0OC 1RTDA 4LF7J 1WHXA 1OSCA 4K4ZA 2KZZA 4OI3A 2C2MB 3RU0A 1SBRA 1B0PA 2BNZA 1RCXB 5HMYA 4QWDA 4ECRA 3SSRA 2K3KA 2YBVA 3OLBA 1VQ6S 2DGOA 3TP2A 3D7SB 3LA0A 2DNKA 2BNWA 1CSJA 4NLVA 4QIFA 4NA1A 4PEOA 1DQ8A 4EI2A 6FDRA 5B08A 5F8LA 4X66F 4ITSA 3CCRS 4LVNP 2AD9A 2FLPA 4DSLA 2MSTA 2JC0A 1W7WA 4HYKA 2HS0A 3MDFA 3KJNB 2UUAJ 3FQLA 2DGWA 4QU7A 2IA0A 3SQGA 4A8WA 2IM3A 3EVWA 3QGPA 4OV1A 1RYSA 2WVBA 1TKTA 1U25A 2E29A 4Y2MA 2RMLA 4RJVA 3DOLA 1H2UX 3OR1A 4DV5J 4W92B 4ZOSA 5IWAJ 3V4IA 2HKEA 2KHDA 2DH7A 3D4JA 3UDEA 5ETKA 3UI3A 1WD6A 3VVUA 3CCWA 3R5DA 3ZZUA 4IUFA 3P8BB 1JB0C 2LQBA 3UQSA 2MEWA 3DI6B 3NL0A 3HZGA 3UR3C 1D09B 1UJ5A 2YVSA 2YY3A 4HT5A 4LR7A 1HWIA 3RBEA 3DLGA 3PZPA 5IWAF 3IO1A 5J2QB 2P6SA 2CPXA 3E01A 4ES2A 4QWAA 2KN4A 3KYLA 3R3TA 3G8SA 4EBCA 5KFFA 1I51B 4LF5J 2IM1A 1CC8A 2QX0A 1PYTA 3PX4A 1QAJA 2HW3A 4UUWA 4U6PA 1FJEB 5GMKa 3OR2A 4HHUA 5HAOA 1N5YA 2H5IB 3PNIA 2AGQA 1GX5A 5A8RA 1FKOB 4MKVA 1ZA2B 5CYMA 3KJQB 3V4IB 1XR5A 1MYKA 2GJIA 2IAJB 2ZVIA 1VQ8S 5FDLB 1O8BA 3SEOA 9RUBA 3OR1B 1Z1ZA 3NLCA 4AQYJ 2XS2A 5ETVA 3BH6B 2ZH6A 3RAMA 4KV8A 3GJTB 5HP1A 2JEGA 1WC6A 1YDLA 1UVJA 1ZM9A 4BC7A 3TZYA 2MKJA 1Y5NB 4EZ9A 4FF1A 1IBCB 3VV2B 4NEZA 1HR0J 1WDTA 2LECA 3O1LA 1RAFB 2FVQA 2VPYB 3TX8A 1YJRA 1U24A 4LF7F 4QWEA 2W25A 5I3QA 2YKAA 3CJQA 4TQSA 1UMJA 1TFYA 1WG1A 4DQIA 3DMJA 5C7PA 4TU7A 3OTDA 1FI4A 2RQCA 5KFZA 3EGZA 2DHSA 1BGXT 3GLJA 2FJWA 1MROA 1RT1A 1U1PA 2XCAA 2ZNYA 4E98A 2QA1A 4ZN3A 1C4CA 2QGFB 3QGIA 5DZ7A 3KUGA 3QBCA 4O4GB 4Y28C 1HL6A 2CJ9A 4DF8A 1JLQA 1B7YB 1U09A 1ZYQA 2XSFA 3PXGa 3PX6A 3MM7B 3AD7C 4ATNA 2XB2D 2V69A 7FD1A 2JXGA 1IWGA 5FLXU 2EBEA 1N33J 1BC6A 2AEJA 3BGUA 2EG1A 2FIUA 2GVDA 2MZSA 2HNYB 3MMCA 2ZH5A 4N56A 1QVFR 3QT7A 4ZLPA 2RNEA 4YB7A 3OXLA 3PIPQ 3VAIA 2DNPA 3PRDA 4O3OA 3T41A 4U7CA 2VG5B 1NKCA 2ZH9A 4DOZA 2CJXB 3M05A 4H4OA 2U2FA 1SJFA 4O23A 1GTHA 4FS2A 2BJ7A 2J0XA 3PFOA 4PWDB 3BS9A 3EGNA 4ENOA 1N52B 3HX9A 5CD4H 3BGFA 4KB7A 4O0NA 2DGUA 1H3DA 2BQ3A 1RADB 4LF9F 4JI4F 2XI3A 1E6VA 2XNQA 4J7CA 1YRUA 5GAHI 4L3NA 4CLUA 3FFIB 4ZIVA 2V0NA 3KLGB 3HT3A 5D8HB 4LFCJ 5CCMA 1EA4A 1FTCA 3TUZC 3OFHA 3M8QB 1XMQJ 1WNEA 4HKQA 4LVOP 5ETMA 3I31A 1VQ9S 4WE1B 1C0TB 3NNHA 2QLFB 3ZTOA 2F8EX 5KT6A 2HNZA 2KXFA 2CZ4A 5D0RA 2NSCA 2CUYA 3DRRB 1RAHB 5F8NA 4K4YA 4IYQA 3W5ZA 1FXDA 3UDLA 1WKJA 2WHOA 5A76A 2L3MA 1SUQB 2FVCA 3QT6A 3UCZP 1IBLJ 2YKNA 2NUUG 4EUVA 2ZZNA 1EP4A 1P94A 1NBEB 2V68A 1PYOB 1Q95G 1SJQA 2EC2A 1HNXJ 4IR9A 2JOQA 4NCAA 4OZ0A 5HBMB 1KQFB 3M7VA 2M2BA 5ETSA 1XR7A 2E1AA 3D9BA 5L1JA 4F50A 4JI7F 1NXIA 2HBZB 2ROPA 3I0SA 4CLSA 5EWGA 2MKCA 5ITHA 2GS8A 4PAAA 4EBEA 2MTLA 2YWWA 5DJBA 2DHHA 4DU7A 2GJ2A 1AZSB 3MCSA 4PZVA 4F3MA 3KHLA 2IC3B 3NWGA 3CJ2A 2X1BA 1RJJA 4F4KA 1RTHA 1ZM3A 5U47A 2MQQA 5LL6d 3AOBA 1S7IA 2K3IA 2XTJP 2HLTA 4CQ1A 4G1QB 1U26A 4AL5A 4TU9A 3PKMA 2GFFA 2HFZA 5KFVA 2F8MA 2FVSA 2GGPB 2B9XA 3PM9A 1KOHA 3ZNJ1 2HHSA 2H51B 3NWRA 4IQMA 1RWUA 3MM9B 2UVRA 1IXKA 1U1NA 2C1EB 2NUHA 2IJRA 2JEFA 3LP2B 4DPTA 2WSEC 2ZH8A 4JV5J 3CIZA 5D4OA 4WZQA 1R27B 4YDXA 4GKKJ 4WK3A 1HBMA 3C14B 3M8WA 2EFGA 3EZOA 4NLWA 5J1EA 4I6YA 2CG8A 3B8HA 3UDVA 3KNAA 1R6VA 4Q2MA 1BQXA 5ETQA 3HM9A 4U7UK 1HQEB 4PWUA 3DRRA 2VF3A 3W5YA 2XYGB 3C16A 1G2EA 4MKAA 3MEDB 3SXLA 4B3RF 1RBAA 2J7UA 1RT2A 1RAAB 3SFGA 2IJFA 3A8EA 2V50A 3AAWB 4EYIB 3Q8YA 3PW5A 1VGYA 1Y10A 2RDJA 3PW2A 3QFWA 3R1LA 1NDPA 1SKSA 3SFUA 4W90B 2CIMA 2JSXA 3KLEB 2DXFA 3R8YA 4ZVRB 4ILRA 4P74A 3CDAA 1GNKA 4DX5A 4C8LA 4EZ6A 4CO0A 2HFSA 1ZTWA 2HS3A 1Y3JA 5ETLA 3DRXA 2PN6A 3KHGA 3IC1A 4HTJA 4NLXA 2KXNB 2VJVA 1R0AA 1O6XA 3OBIA 4I7FA 3TZWA 3WQPA 2VG6B 4QPTA 4V19J 3DLBA 1NDKA 2OAUA 4OLOA 3G82A 5HBMA 1QE1A 1UKUA 3HO1A 2CVEA 2YXLA 3QT5A 5L46A 4PKDB 4DR3F 4IFVB 1G4CA 4OI1A 4UY85 2LXIA 1D9AA 1Q8BA 4RLEA 2CAXA 1K44A 2DNOA 4QIWD 4OYBA 5J2PA 2UXBJ 4BWMA 1FWPA 1S1VB 4JI0F 2FUG9 4LF5F 5AT1B 5DM7Q 3Q22A 2U1AA 3A13A 3DOMB 2KT3A 2FJXA 3V6DA 2VICA 1Q82T 7AT1B 2XMWA 4DV0J 2FHKA 1RT3B 2RDDA 3Q8UA 3CUNA 2R7TA 4C8YA 4QJVA 4A8OA 3UCGA 1Q4RA 3N6NA 1OPZA 1S9EA 4DR4F 3RRHA 3QIDA 2MPUA 4I64A 1AFJA 1EB0A 3UE2A 5HQMA 4U95A 2QL5B 5LXRA 4ZCLA 3W61A 1NSPA 2G2ZA 3G71S 1TQLA 2E5IA 1FRHA 4YB6A 2NREA 2C2EA 2PMWA 1N8RT 3TAPA 2N82B 1JLGB 3DLKA 4CO3A 1U1OA 4JI3F 4A8QA 2I5JB 2BJ3A 3W62A 3WDOA 2C22A 3HFVA 2PFDA 3I87A 3MEEA 3MUMP 5JUMA 3AODA 2E9TA 3N6LA 3PEHA 3FGVA 1LFWA 2RQKA 3M4XA 2YWFA 1P9YA 1HI1A 1HARA 4DL7A 1VRTA 2YWGA 4ZKAA 2FVPA 4OJHA 3M32A 4UT4A 2ERRA 1NK7A 1REVA 2LEPA 1S1WA 2VC1A 3I9V9 2XQCA 3CDWA 1U49A 4QR1A 5F8JA 4PPDA 4AE5A 5KG0A 3RAXA 3UN2A 3TAMA 3PJWA 3GPAA 3ZZOA 2IY5B 4QW8A 2BA9A 2CFXA 5KG2A 3FZBA 4LBPA 4P9SA 3NGRA 3FMBA 4JI6F 2XMUA 1CULB 4USKA 2ZJPQ 3V6DB 3D28A 4FYVB 3EWGA 4X4OA 2BMBA 1WC4A 4Y2IA 4ZP7A 3B6BA 3O3LA 3KMSA 2E9RX 4GKJF 2FDNA 2AN7A 1GK8A 1G3OA 3D6HB 1CJTA 2FJDB 2BKOA 3C16B 1GXTA 2V8HA 4FXVA 5CAAA 3LP0A 3KJVA 1HQ2A 5CCLA 2ZVSA 1HMVA 4QW9A 4I69A 3AQOA 4V1Ak 5K5MA 3IRXB 4C8NA 1AW0A 3CWJA 3QOQA 4TXSA 1TL5A 1LXJA 1VJWA 4OX6A 1FK9B 1T9UA 2QLWA 2XSJA 1VQOS 3TJ8A 1JKHA 3P5TL 1VBXA 2ZH2A 4DV1F 2V6AA 2B56A 3I5BA 4P75A 3NGTA 1WKLA 4IO9Q 4ZA1A 1P1LA 2VPWB 3IAS9 5JXSA 3W9JA 2F4FA 3M9OB 3Q24A 3CC4S 2ZJRQ 1U6BA 1CLFA 4C0HA 4QU6A 1H73A 3CCZA 3DRSB 3VF0B 2OH2A 4TY8A 2DYAA 1D0EA 3M1VB 3KOAA 4G1QA 1T02A 5F0WA 3IRWP 1MYLA 2BACA 3FUYA 2DHXA 5F9NA 3IWNC 1Q16A 2F65A 1RTHB 2P9EA 3Q89A 4PG8A 2QFIA 4DL6A 3IR7A 1S1VA 5KFYA 3T6BA 4LREA 3DLEA 3TEGA 2BBEA 1V6HA 3GIJA 2Y0BB 1F9HA 4F8RA 2P2CB 5T14A 4OL8A 1BWVA 1SCJB 3H0PA 2CPEA 1X9SA 1VJQA 2YPYA 1QSLA 3CJKB 2JL9A 1IBKJ 2MJUA 3MXHP 2PE8A 1SVDA 2C3MA 3IMQJ 3K8WA 1QJHA 2FGOA 3BM7A 3FBBA 3VQSA 1HWKA 1CG2A 1WF2A 5BXIA 1IR1A 1M5HA 2GIFA 1CJVB 2ATLA 2Y8WA 2EI5A 3X1LB 2C3UA 2X3GA 2HNYA 3M6XA 2FJBB 3KG1A 2GVDB 4YN3B 5K14A 5ADZA 2RRNA 3V6JA 2KOEA 2FQQB 5KT4A 2Z2YB 1CULA 4BDPA 4Q8FA 1ZAWA 5HJYA 2OP5A 3OUYB 4ECWA 2H48B 3HHEA 1TK5A 4NMLA 3DOKA 2ZBIA 1BD6A 4LT6A 5LMUJ 3QQCD 4Y65A 4ED1A 1JX4A 3BO2A 4DJBA 4C8KA 3T1YF 2H4YB 4NLOA 4PR6A 2JEJA 1U0HA 3NAHA 3DRPB 4USMA 1QTGA 5E3CA 3D54A 1HNIB 5J1EB 1YK9A 2HFVA 4QYRA 2CPZA 2MZJA 3FBEA 4RW9A 4RW4A 3JSBA 1HHQA 4A8YA 2PGCA 3TVZA 1OJ4A 1CJVA 2BUNA 3NRBA 5GADI 3CDUA 4RU2A 3G6VA 2KT2A 2LQ5A 4FF2A 1VBKA 3B4DA 3HI9A 3CCLS 2PEHA 4YQWA 1GFWB 2J5AA 4RW7B 3CSKA 3VAFA 4Q44A 2HBRB 1HLWA 3DKDA 3JQMA 4I2PB 2XMAA 1MMNA 1AB8A 2DNHA 4KIAA 3UN3A 4DSFA 2OPQB 3GWCA 1K47A 4HTIA 5LMUF 2F4VF 3D6TB 5IFMA 1IJEB 2Y1RI 2LLZA 2QA4G 3KUEA 1GAOA 5K8PA 1M5VC 1UVNA 4PG5A 5HL7Q 3EVOA 3IR7B 1DURA 3S7RA 1HD0A 5LJ3Y 2XY5A 3RBDA 4Q43A 1HNZJ 2WSFC 4HL9A 3J7ZT 4LF4J 2PA3A 3CCSS 4NXNF 3TA1A 5KOXA 1ZPWX 2HBQB 4RUHA 2ZM6J 3D6MB 5JJBA 4NPOA 3M2RB 4TYAA 3T6JA 4J9UE 4X62F 1HNVA 3W8GA 5IXUA 4ED0A 1UPPA 2CA9A 2H3EB 1U6FA 4ZVPB 2RS2A 3GTYX 3QGGA 4ZJOA 1NU4A 3DOMA 3P5BP 2KTQA 5KFXA 2DGXA 4F0HA 2JBVA 1KR4A 3EXCX 3PIOQ 2HFNA 3AJDA 5GAHU 2CPYA 2BDPA 2XMKA 2DKOB 4FZVA 3DM2B 4WTYA 4Y6IA 5D0GA 3W65A 2WAQD 4IG3B 4KV8B 4X65J 1GMVA 1KLMA 2ASLA 3ZTQA 4TQRA 4M5MA 5B0BA 3KKFA 4ECSA 4KYZA 2WOMA 4P52A 5BJRA 2V4JB 4MTPA 1VLOA 1CPZA 2CNLB 1URRA 4CLPA 5LXYA 1X7VA 5KFPA 3WX4A 4RW8B 4LF9J 1Z2ZA 3HSDA 1N5YB 2Z57B 4JI7J 1FFGB 1NNDA 2AGOA 2DH9A 3UVJB 3G8TA 2LDYA 2WONB 2WW8A 2VD3A 2ZKTA 3O5TB 3K57A 4W4MA 3EVMA 1RP5A 3MM6A 5CYJA 5HVGA 1OSDA 3MEDA 3P6YC 4K5RA 4J90A 3FBCA 4BS2A 4B17A 2G13A 4LFAJ 2PI5A 4A8FA 4QCLA 2UXCF 5I3UB 1S1TA 3HMJG 3T9ZA 4I56A 3IR6B 3M6UA 4WFYA 4I6AA 2PEBA 1U4BA 1FJGJ 5LSOA 2YQ0A 4D8JA 2VG7B 3CIMA 3N4WA 2VG7A 4DN0A 5KT2A 3G96A 5DG7A 3KTQA 4MMOA 1CJUB 3RUBL 3HD2A 4C0BA 2C2NA 1NPRA 5KFBA 2B6AB 3CC7S 4DV2J 1NH8A 2LXFA 4I7FB 1VQKS 4GKJJ 3IM8A 1FKPA 1RT1B 2PA8D 3CJRA 3GFHA 3VZIA 1FRKA 3TZXA 4DR1F 4OI2A 3FZ2A 3HD1A 5LSRA 2VFUA 4LUBA 3FCWA 1QDUB 1PAEX 2RS8A 2AY0A 1H72C 2QA4S 2W2QP 2HYIB 4YHHJ 1X5OA 2VQFF 3I5AA 3L95X 1OWXA 1HNZF 4WFXA 2DPJA 1XR6A 2V4QA 1VC6A 2YNGB 2R9LA 4DV6F 3CJTA 1BXNA 2OMLA 2AJFE 3VGVA 2JLFA 1HWUA 4H54A 4D3HA 5DETA 1SXLA 1UJ4A 2FC8A 2QMUB 3C6TB 4MIWA 1FRJA 4DPWA 5AE2A 1Q1KA 3OL6A 1VYAA 2G9OA 4J9QA 4OHXA 2DISA 4NRUA 2CPHA 4OJ1A 5H1SV 1KNZA 2QZ8A 1S76D 1IKXB 1DQ9A 1SIZA 4USUA 4YR3A 4FYWB 3ZXWA 1AYEA 1XBWA 2J9DA 4QIGA 3UNYA 1UZHA 3IGNA 4LF6J 4JV5F 2QIFA 4I1TA 2V94A 2R7VA 3P45B 1HPZB 2VKRA 4ZCIA 2I38A 4FYDA 3KHHA 3ENWA 1HQUA 3I0RA 1WI6A 1T3OA 2CQBA 2D3UA 2W2MP 3H87C 1TMJA 2O1PA 4IFYB 4MYTA 2LQJA 2CWKA 3MHYA 2BXJA 3R7BB 4NASA 1TAQA 2KYXA 1SPBP 2KT5A 1OY9A 1WHVA 1WF1A 2G2YA 4P2SA 4FS1A 3PX0A 3AB4B 2E1MC 3HVWA 2Q6CA 3RB0A 3G86A 1TK8A 4DUZJ 5DLFA 2CKWA 2RE1A 2NR0A 2JRSA 3KK2B 2CXEA 1EETB 2MSSA 2P5VA 4B3OA 3H8YA 3H40A 3JAMU 1PIEA 1OG7A 1FDAA 1M1GA 2CQ2A 2I9SA 3MMAA 4HHHA 1DLOB 1RT4A 2OPSB 1AUDA 2HWHA 1VQ7S 2XNRA 2K9IA 2QYCA 4ZP8A 2IHR1 2VZ9A 3I6PA 2BE9B 3AT1B 2JZ5A 4ZPBA 3SQGB 5C42A 4RZRA 1N32J 3K17A 2MY8A 3MM5A 4RW6B 3BV8A 2R2RA 2D41A 2H4WB 1XNRJ 4PUOB 1L3KA 1RT6B 1LK5A 2AJ4A 3MURP 4ECTA 3KJFB 3C3LA 4J9LA 1WEZA 5HN0A 4DL5A 2Z2ZA 4ZS6A 3OPKA 3EJMA 4WIQA 4MFBA 2AWZA 3LH2S 5KFOA 1FKAF 1SKUB 3DLLQ 1RTJA 2ADLA 2AKWB 3W66A 4DLEA 3JTOA 4ERDA 3EICA 4ZP6A 2HMIB 3AOAA 1B3TA 2ZH3A 4KR0B 2F7VA 3CF5Q 1UPMB 3IG1A 1Q78A 4PXDA 5IQQA 3QMQA 3W1YC 1K0TA 1XK8A 4LRFA 4WP8A 1S6QB 1WG4A 2IJNA 4GO5X 1S1UA 2HZAA 4H4KC 5E2QA 2W9CA 3FRYA 3G6ES 1TFWA 1FJCA 2RF2B 2HIQA 3TQ1A 3J7AN 2BX6A 1Z2LA 3PTWA 1GH8A 2EVZA 1RHKB 3RJMB 1ZH5A 2B9EA 3CJKA 2PT0A 2R7OA 4JI6J 5EN1A 5IT9Y 2ASDA 5HP1B 4ZPWR 3LJPA 1ZM4A 2A0FB 2F63A 2WZ1A 4TKTA 3KLFB 2EFPA 3WIVA 2K6LA 3H5SA 4MK7A 4RO0A 2AF6A 4DS4A 2IVMA 2XS5A 4QYZK 3OTBA 3FSIA 4PYAA 1KOOA 1UEVA 3NG8A 3UNGC 1ZA1B 3OVBA 2Y9HA 2FB0A 1Y3KA 3HSZA 1JJCB 2C2RA 1ZETA 2QO3A 3ULHA 2OLWA 3NBPA 3KDOA 3MCNA 5HSPA 2OELA 4ZPVR 2NQPA 1VCTA 2JDJA 3NGUA 1OO0B 1DJ0A 4DV3F 1WOOA 2H54B 3N28A 4K4XA 2HHUA 2XZTB 3KUHA 2XLKA 2F8HA 4IFYA 4RNFA 2ZH1A 2MYFA 3IBFB 3ILOA 3MAQA 4B9LA 2XEXA 4TN2A 2UXDF 2NPIA 3JSYA 4NOHA 4USWA 1XMOF 4NZ7A 4DPOA 1UWBA 4URSA 1KONA 4ED7A 3Q2TC 4RWWA 2HNDB 2AW0A 1LW2B 3BF4A 5CYQA 4RUCA 1IKVA 1LWFA 2VV5A 4K7QA 2FYXA 1O51A 1SV5A 5H9FJ 5F8GA 3K5NA 1YBAA 1IBLF 2FVRA 2AZ1A 4YY3J 1HIYA 2H3AA 3MMAB 1TTHB 4USTA 2XM3A 1YHQS 2PDAA 2YNHA 4C3KA 1C1BA 3HPOA 4C4WA 4NCBA 1U8SA 3D67A 4KBIA 4DR4J 1HBUA 5ETNA 3H2UB 1Y11A 3AJ1A 2NPFA 4YFUA 5EHHA 1O5JA 1FE0A 2MZ1A 4PG6A 3NCPA 2QE5A 1ELOA 3I96A 3M1VA 1JJ4A 4OZ2A 4DSJA 5A2QY 1DFDA 1BUXA 2DNYA 4XAKA 1F9FA 1UVLA 2L9DA 4U96A 4ECQA 1PGZA 1EJ7L 5HATA 4H4MB 2E1CA 2XZDB 5JVHQ 3G5OA 3CTRA 3J7YI 4Z37A 1S6PB 4Z7YA 3D68A 3K59A 1B4SA 3DI6A 5AE1A 5DG8A 3ILJA 4KGKA 4B9MA 4L74A 1C1BB 1RUSA 1SKRA 4P2FA 2UVVA 1NK6A 1UCNA 4OIXA 2F5GA 1FFSB 1RWPB 5KT3A 3HVTA 4QYZJ 5CD4A 4IG3A 1WELA 1I6JA 4JI1J 1QSSA 1VI7A 1Q0NA 2J9CA 2GAGC 2NXNA 2VA3A 3O2IA 4C8ZA 3GR1A 3BQ1A 3HF5A 2AJ1A 5B7WA 1ZTTA 4E8UA 2WVDA 3QGHA 1AXQA 5L1LA 4K4TA 3PVXA 1QM9A 1T7PA 1N5VA 2HQFA 2HHVA 3V6HA 1Y5IB 4DF4A 1FKOA 3OT9A 4KRWA 1EETA 4HHJA 5BYSA 4MH8A 4DV3J 3TZZA 5E33A 4URQU 4NCGA 4AT1B 1M5PC 2MKSA 1FE4A 4QWBA 2APOA 5IOLA 3U7JA 4LF6F 4CH0S 3PYEA 4ZLNA 4N8OA 4JI2J 3QWPA 3MZIA 4Q2LA 1XMOJ 2J8SA 2V63A 2B8QA 4HVZA 4KSEB 4M5KA 5CH7B 2UXDJ 3W2VA 1XN9A 2GIRA 4Q45A 2FHMA 1AUSL 4L6V3 1IR2A 3QO9B 2D3OR 1FXRA 1LOUA 3MR3A 2BABA 2KO1A 1B64A 2MZRA 3FVYA 1DTQA 1S9GA 5H9EJ 1G7CB 3HHLC 3ZTPA 4LF1A 1T94A 1U1MA 1HNVB 3EGWB 1NJYA 4AL7A 1S48A 4IFVA 4X2BA 2YWKA 4GVLA 4NI2A 5HVFA 4LBIA 2C2DA 3KLIA 5IC6B 4ZIWA 4EEYA 4KHRA 2ZOMA 3ICLA 1SQEA 4OLPA 2B9YA 1EIYB 1XTZA 1Y7PA 5HROA 4IRDA 3ZZZA 1IRQA 2GMLA 4OI6A 5EWFA 2P8IA 1NJWA 3ET6A 3IG1B 3DDKA 3Q8VA 4OZ1A 2YTCA 3SQOP 4DQPA 2AX1A 2OPQA 1VK3A 1IBMF 3MD1A 4CIOA 4LQ9A 3QZ7A 2QV6A 2ZH4A 2VDIA 2EFNA 2FGCA 1WSRA 2HVEA 2ZDOA 3IWXA 4KGVB 5F41A 5L38A 3SZ2A 2XG8A 5LT5A 1GXLA 1OPIA 2HSEB 1HBOA 1DAXA 2W4PA 3TR5A 3Q8SB 2X3DA 4FXDA 3SSQA 5KFMA 4GRSA 2W01A 1RU2A 2R8KA 3GR0A 4IH6A 4B3MJ 2IM2A 2RHQB 3G8QA 4UOGA 4BBYA 2OIHA 2D7SA 5D4LA 4R5PA 2E5HA 1RLDA 3E8OA 4AYBD 1NHUA 2WBRA 2J6SA 1K0VA 1Q86T 3ITHA 4FPRA 4IKAA 3TEHB 4LF4F 1WUUA 5HJXA 2QG9B 2N3OA 2HAIA 1MWYA 1F3FA 3ETOA 3IM9A 3ZO7A 4J9RA 1NCLA 3QIPB 2LDIA 1MLAA 3N6MA 4LSLB 2BRKA 5E41A 2XY6A 2X1FA 2A6MA 2LU1A 4FVCA 3HHLD 3DLEB 4P7TA 3ZFVA 4HLBA 1EARA 2CPGA 2VQEJ 1SIWB 2XBPA 3SIPB 3M6VA 4B3OB 3AD9C 4HDGA 4I2QB 4YB5A 1NB7A 1RT5B 4LFBF 3GXQA 3SCLE 4CNYA 3TA2A 3PR4A 3ENVA 2DCUB 3UD3P 1P6TA 3M2VB 2GNKA 4YUDA 2JXHA 1TUGB 1DHMA 1RGVA 1FD2A 2V9KA 2W9BA 4X64F 1KD1T 1S0VA 3I0SB 4KPCA 4USJC 2M4MA 4KO0A 4DU8A 5GAGU 2DIVA 1N56A 1KTVA 1SV5B 4P2XA 2KRBA 2GV1A 1JNRB 1EKRA 2CDRB 5T7LA 2R42A 3T19A 4F0KA 1X4FA 3ITHB 1LW2A 2LP4A 3TUIC 2P6TA 3QPIA 4OYAA 4L72B 4OYPA 2QSWA 3DNCA 3LUYA 4ZK7M 5HQLA 1VDHA 2W8KA 2ILZA 1UA1A 2EPIA 1C0UB 4ID5A 3ISNC 2W9BB 1BE4A 2AJ2A 1VRUB 4DR6J 1TV6A 3M8SA 2GAHC 1NKBA 3IR5B 5HMZA 2K7JA 2EFQA 1XNQF 4B02A 4JI2F 5LMNJ 1TL7B 1RWVB 4CT8A 1C0TA 3D6FB 3FFIA 3OFEA 3THVA 1KS2A 1RKJA 2GX8A 2LA6A 4PXCA 2ASJA 3GSIA 4QOTA 1TKDA 2D74B 2CZVC 4IDKA 1JLCB 2MJNA 4AQYF 3LPEA 3PY8A 1RI7A 3TARA 4Y2AA 2BJDA 1HWJA 5IV3A 2ACMA 4F4ZA 4F4YA 3M9MB 1FT8A 4R5PB 2MHNA 1NKEA 1CS4A 1H0HB 1REVB 2IIHA 2C2ZB 3GJSB 4KKOA 1S4FA 2XLJA 2MQNA 3KJVB 4BCAA 1ULRA 3N01A 2N7YA 4O44A 5KG4A 3TNVA 4ANDA 4YR0A 4ANEA 3CCJS 3MECB 3LANA 4LF2A 3VQTA 4DQQA 4QQBA 4DN9A 5DG9A 4HACA 1VQYA 2BOAA 1DTQB 1S9GB 2FY8A 1S1UB 3C8YA 2XO6A 1S6QA 1WC0A 5L1IA 2UP1A 4YB1P 2RKIA 4TLQA 2UUWA 2V67A 2E5LF 3NOGA 1YIJS 3FRZA 4CYUB 1VRQC 5DZ6A 4RR5A 5K8NA 1YG0A 2BRLA 3DRSA 2W9AA 1JLBB 2LXUA 4MIBA 3BO3A 1U1LA 4CCHA 4DL0C 4JI3J 2XY7A 1T8EA 3JQKA 1YLXA 1WEYA 2M70A 4LFAF 3HZEA 4NCGB 1UFLA 4TLRA 1U6ZA 2DXEA 2HQCA 3HFZB 2I6WA 2R8HA 1FK9A 3NKYA 4PQAA 5A8WA 1P8GA 3GFXA 4A46A 5THWA 1CVJA 1Q8KA 3I4PA 1PJ5A 2NSBA 5DGAA 3RR8A 3GV8B 1V3RA 4JI8F 1DY3A 1DTTB 1SC4B 1FRLA 4NLYA 1IWAA 2EFOA 4KGZB 2BANA 4J5OA 5E5NA 1S10A 2LKZA 1LEOA 5J2NB 1L3SA 4F4XA 2AYMA 4ICLA 4RBVA 4DG1A 3QSYB 2FHJD 1V9OA 3PV8A 1BLUA 3NO7A 4UQTA 1JLQB 4WWSA 1N88A 4WFNQ 5G0RA 1TELA 3BQ0A 2O67A 4JYAF 1S1XA 3R5AA 3L7PA 4JI5J 1VMBA 3CGIA 5GADU 5D78A 1SC3B 4ES1A 4UZBA 2GQQA 3GB0A 1NM2A 1RT3A 3DDIA 2CPDA 4CZCA 4ECYA 2DR9A 3HJVA 3H5UA 2BE2B 1RBOB 2IVFB 3UO0A 1VOMA 3LF0A 1KQKA 4ELTA 4O0IA 2DGSA 4C3MA 1IN0A 3VAKA 2NLWA 1FKPB 1FFWB 2X1GA 5C5JA 2AHOB 5BYQA 5AXMA 2LU2A 5KFLA 2GCFA 3TOQA 4U8VA 3WBZA 2ZZTA 1ARRA 3VAHA 4MK9A 2KFZA 5KG5A 5CZVA 2L9NA 4YOEA 2FHOB 2DITA 2K5JA 1P27B 2HQDA 5KOWA 3OV7A 3T5KA 1FWKA 3T5HA 1VQPS 3MEKA 1EQ0A 3JAMY 3QLHA 4ZHRA 2G1DA 1HI0P 2ILYA 5K20B 5KFUA 4ALZA 4UQGA 5DGBA 3E51A 4DFKA 2G0CA 1ZOTA 4ZP9A 3MPUB 3NGDA 3G6YA 1QSYA 2DTJA 2DR6A 2XMMA 4ZLLA 4OYZA 2YQ1A 1H2VZ 2DBBA 2G0JA 2NXJA 2VBXA 3PG9A 4O3QA 4ZJQA 1LXNA 1EKSA 3DDNA 5CQGA 1EAYC 2ZC4A 3WZ0A 2ZBRA 5EDWA 3T1YJ 2WW4A 4F02A 3FK4A 3NBPB 2I8EA 1HWLA 4ECZA 2DH8A 1RWXB 3GG0A 3Q83A 3K7RA 4YHHF 2AIRB 3O6QA 8AT1B 2QTWA 3HSJA 4K4SA 4ICLB 3VGSA 3MMJA 4CLZA 1FNXH 3G82B 4ZPAA 1S72S 3LW5C 4F4WA 2CWXA 3V81A 4FXWA 4ZVEA 1O0PA 4I2PA 3NEKA 2DRBA 3MM6B 2NXCA 4X4RA 1PSDA 4GO7X 1NDLA 1S12A 1X4AA 2DD8S 1SH2A 2NYIA 3SV4A 2DNMA 2VHGA 2HVDA 4JI1F 1WWHA 2ACYA 3HHNB 4C3LA 3K5LA 3CC2S 3CE8A 1TL7A 3GQCA 3GFZA 3B54A 2B3TB 3MAAB 3HSGA 2W9CB 1S7HA 1JQGA 2RB7A 1FVSA 1LKZA 1S0NA 4IO1A 1S9EB 4WE1A 4DPYA 4XDCA 2R8GA 2RVJA 3NY0A 1MNTA 1NZ8A 2NYHA 1MN7A 3RRGA 1YJUA 4JV2A 3ENAA 2IRYA 3NOCA 4ANCA 4R8UB 1GMUA 3QRQA 4DX8H 5IT9U 4MKBA 1U2RA 3OW2R 1C4AA 1PILA 1RSCA 4P6QA 2KKHA 2R4FA 4ILMA 3PHTA 4JV0A 3NAIA 3MUTP 2JEIA 3A3PB 3WIUA 4AXIA 1RHRB 3RYLA 2CNKB 2EKNA 4K8RA 5AXLA 3R6LB 4PG7A 4A8KA 2CQHA 4X4TA 1HYSA 3EZUA 2FZCB 4ZPDA 4FF4A 1BY9A 3HKWA 1HMVB 1KQSR 2KB2A 2DNLA 2DGVA 3O8WA 2B7BB 3EM1A 4C48A 3VAMA 3B4MA 1U48A 2UUBJ 4NX9A 1NSKL 2RF2A 3M2RA 1H2TZ 4DMZA 4DR7J 4CO1A 1FERA 1LWXA 3LGMA 4CO2A 3KG0A 1TK0A 4IOBA 1B0VA 3PYFA 1JNZB 1RAIB 4DSKA 3KLGA 1HNIA 2G1HA 2XHCA 2JLGA 4IRCA 4P10A 2E5GA 2HHQA 4CP5A 2ZJQQ 1M1HA 2V2KA 1T95A 1S4EA 1ZS6A 4GVBA 4C7QA 4U67Q 2JWNA 4GMKA 1RTJB 1APSA 2CQ3A 3N79A 2QA2A 1YJNS 2VA2A 4YP3A 1REGX 3OL8A 4ZITA 4S0MA 1NHVA 1OQ6A 4JUZA 2UVUA 3Q23A 2Z58B 3CXCR 4HACB 1N5SA 1VRTB 1TL3A 1HNWJ 2YKNB 2JFKA 2ZBCA 2Q1LA 1LWCB 3D3BJ 3M8RA 1IKYA 1TKXB 2BKNA 2BSQE 2XGPA 3JSMA 1WTFA 2ZBQA 3C14A 5KFRA 3F41A 4HT7A 4C97A 3IN5A 2H5JB 1FD8A 4LIRA 2MQPA 1MW7A 1T9YA 1U0SA 1FWLA 3BSCA 3TW0A 2WTFA 1KVIA 1WDDA 2DO0A 4FVMA 3C15A 3GFYA 4ECUA 2HWIA 2KJWA 4IOAQ 1D1UA 3AY0A 2XCPA 2ZHOA 3BBBA 1TZ0A 4IH5A 3PJXA 4FDFA 4DUYF 2HZVA 1SQGA 3OFGA 1YVFA 2FLLA 4IR1A 4OI0A 3MM8B 4RNHA 3DHXA 2B4UA 4XO0A 5DDRC 3FCHA 2MLXA 4FBUA 4PQUB 1YBTA 3KWMA 2IC3A 1SIWA 4D3GA 3GONA 2RDIA 4A47A 1YZ6A 2GMJA 2R7QA 4Y2KA 1C0UA 2WVCA 2ALZA 3VTIA 1WTBA 2RSQA 1HQUB 3I0RB 4TVAB 2FJEB 3S6EA 1MN9A 3I55S 1U9PA 5KFCA 3HK2A 2W7OA 2ZOGA 1NPKA 1QLNA 4JI5F 4HEA9 1NSQA 1CJUA 3MF5A 3NS6A 5G0RB 3RAQA 1AA1B 4X62J 3QRPA 5EX3A 2N7CA 2MQOA 1JKHB 1L3VA 9ATCB 4B08A 5T7LB 3OFFA 2IBKA 3DOLB 2CQDA 1R8BA 2GC8A 3IXQA 5A8RB 3NMRA 2DK2A 2ZEJA 2N4CA 2HFOA 3H5XA 3MFHA 2HK2A 2G0IA 2X1AA 1Q16B 1GT8A 3OTEA 1GXUA 1X4GA 2VPXB 3R2DJ 1FRIA 2HRYA 1BMQB 1FDDA 2Q79A 2YNGA 4QZVB 2ADBA 3FSYA 3MWBA 2UUTA 4MAKA 2PFFB 4B3MF 4NLTA 1XMQF 3TUPA 4OFZA 1NAQA 4KJIA 1FA0A 4LFCF 3ET6B 5ETRA 4A48A 5KFJA 4OHYA 4M5HA 2PC6A 3WHIA 3G4SS 1RA7A 2BVZA 4RW8A 3BYRA 4CT9A 4X4NA 1Y5LB 4USVA 1I5OB 3R5GA 1TUVA 2I1RA 4LRDA 1FNMA 1WOSA 4OHZA 4ECVA 4M95A 1TKTB 3V81B 4CYUA 3J80Y 1WC5A 2BKPA 4L3KA 5LOQA 2GMHA 4RNNA 3FBFA 2KG1A 2PSZA 3DM2A 4MIAA 1NEEA 1CQMA 1YGYA 1HFEL 4LRBA 5JVGQ 2R7UA 2ZOFA 4QR0A 1S1TB 5T41A 4F26A 1XJWB 4LSZB 1KFSA 2EXUA 3X3UA 2FLNA 3KFWX 3E01B 2LVWA 3QAEA 4USIA 3CVKA 4ZVHA 4WIIA 3GV7B 1NSAA 2DNZA 2K1RB 1RISA 2E7WA 2FZKB 4KE5A 3ISND 3TAMB 1U02A 3GU0A 4CH7A 3UVJA 4WTOB 3KLHA 3Q2SC 1PC5A 5M2RA 1PYSB 3NMAA 2W2NP 5F3ZA 4ID8A 1FCAA 1H98A 5DO2A 1KEKA 3LOUA 5B0AA 1UVIA 2JJ4D 3UD4P 1X4BA 2XULA 1JLBA 4ZVGA 1MMDA 3HFKA 3WX8A 4DL3A 1HW8A 2LCWA 1PBUA 3GIRA 2C28A 4DV6J 2LEBA 5CABA 3V4MA 3U27A 3BZQA 1NLKL 3RW6A 1T9TA 4FNHA 4PPZA 2FJVA 2KHCA 2DR7A 1LK7A 2I5JA 2OEKA 3HT0A 3M2UB 4DX6A 1Q8IA 2VBWA 1L3UA 5KG1A 1QAIA 1HA1A 3QSIA 3GSDA 2YX7A 2BJEA 1JLAA 4W98A 5EX0A 1LFPA 1X4HA 4CLTA 4JI8J 1WF0A 3MOJB 3N0VA 3ZZYA 1RE1B 1QE1B 2VFTA 1F1BB 1Y4ZB 2GHWA 2JVOA 3I82A 5GVQA 1NJZA 3GP9A 2DB1A 4DSEA 1FJGF 1YZ7A 2DPIA 3CCTA 2ZWPA 2E5LJ 2IMOA 4WF9Q 3LQVA 3TUJC 1VR6A 1VBYA 2FPHX 5KFDA 3R97A 1SH3A 5I4MA 5EUHA 4JYAJ 4UF4A 5MAOA 2J0QD 2YNIA 1VIXA 4L76A 3BBFA 3OUYA 2BOPA 2YX4A 4KY3A 2I2YA 3BKTA 2PMZD 2GHPA 5K14B 4DUZF 4MJKA 1RYRA 1Q5YA 4ZCMA 4M5IA 3FMTA 3JXOA 4ZMMA 2GW8A 1WI8A 1ACMB 3OTOF 2G4BA 3R5CA 2HFUA 4J9PA 1W2BR 2ZKUA 1DTTA 2O01C 1F6TA 2EWHA 5D15A 4DV5F 3BDPA 5B0GA 2YKPA 4FYXB 1F5CA 1K1QA 2GVZA 3JTPA 5AJ3F 1VHIA 3IA0A 5A8WB 2DRDA 3A1YG 1KHWA 5DQGA 2QMXA 3D0HE 3I9ZA 5EGYA 3OTOJ 1IBKF 2M8DB 4I67A 4ETXA 3CMAS 1AROP 1V3ZA 4X4PA 1OYEA 4NZ0A 3BPDA 4JI0J 3S01A 4DCOB 1FRMA 2PIIA 2Z2LA 5MLCV 1RT7B 3CW2C 3DGVA 4XDDA 4FNIA 5B0CA 4N41A 2L41A 3UDCA 4CLYA 5IM0A 1S49A 4DR2F 3MI7X 3V5RA 2C2OB 2VL1A 2KVQE 3DOKB 3P96A 4DFMA 2HNZB 3BR9A 2KFYA 3BGOP 2MXYA 4K0KF 3PW7A 1RWKB 5ETPA 4KGXB 3VCDA 3F73A 3LAMA 1X5TA 4I2QA 3THPA 1H7XA 2ZBPA 1SH0A 1MWQA 2OI2A 2SXLA 2RU3A 2RUSA 5D0HA 3MECA 5F3TA 2F1FA 1B01A 4LSLA 1KDNA 1JXLA 2D69A 1T05B 1FHTA 1V5IB 3AA9A 1FO1A 3LP2A 2RBFA 4B3RJ 4G3IA 5K8OA 1XERA 3D0IE 2RD5C 1R0BG 2WCXA 3L4BC 4DR5J 1T03A 4KH0B 3OL7A 1NK9A 4M5LA 4IDKB 3BDEA 3EE3A 5FDLA 5A0YA 3W60A 1TMMA 2IAJA 4Q8EA 2COLA 3FKBA 4ECXA 2IDLA 3PEJA 2V9WA 3Q86A 4P73A 3J80U 3H98A 4DUTA 1NK8A 3A4TA 3EX7B 3W5XA 2CQPA 5L9NA 2GHVC 2CPIA 1FDNA 2XZWA 4WU3A 2AGPA 4GKKF 3F56A 2AEFA 3NS5A 2YNIB 3NS7B 4WP9A 2B4VA 2UZAA 4WFBQ 4Y2CA 2JFDA 2D9OA 4RBUA 2HMIA 4QPXA 2YNFA 1UL3A 3US5A 2ZHAA 5IT4A 4LFBJ 1TL1A 4KH1B 3H2VE 3QJLA 1YTYA 3JQJA 1CJKA 3UPFA 1MROB 1D9DA 4RL1A 1M5KC 4OV6A 3NGKA 1S1WB 2KYZA 1T9VA 5KFAA 3TA0A 2XYPB 1F5AA 2M0GB 3H7HB 5G4DA 3VEAA 5B09A 1HD1A 2UUBF 3KK1B 4PXBA 3I56S 3IBWA 2FJAB 3A3OB 3L7UA 4NYPA 4NI2B 1B99A 1FDBA 2OPPB 3MM5B 2HQIA 4RW6A 3TO8A 4ZPCA 2OPRB 1CJTB 2HS4A 3CDEA 4WFZA 4XPEA 5A6PA 3LP0B 3MEEB 4N77A 4GC7A 2KH9A 1OMSA 3FT7A 3MR7A 5A6WA 3AHPA 3TAQA 3MTKA 2HVZA 4HI2A 1NPPA 5E3PA 2KM8C 2Y1JA 2DNGA 2HQ3A 3QO9A 2YWEA 1LWEB 1UAWA 3RGIA 5GAGI 1EX8A 3NGSA 3W2WB 2LQ9A 4WKYA 5HMXA 2QLBB 2ZFHA 3DLJA 4BHQA 2XWYA 3QFHA 1LW0B 3BSAA 1CJKB 2C3PA 3OHBA 5HLFB 4UZCA 2BW2A 1S0OA 4I6WA 1U8WA 2V8PA 2AZ3A 1XNRF 2Z4PA 2YKMA 4OZJA 1UEKA 5GAEI 3LP1A 3MOZA 2KKEA 1X4EA 1X60A 2HRTA 1TKZA 4FN5A 5B0DA 5DM6Q 4KHPJ 4PABA 2VIHA 3P49B 1R43A 3AH6A 5JMNA 4JBCA 2CJYB 3JTNA 2VG5A 1J5OA 1HNXF 4DHVA 2HLUA 1RT6A 2N4DA 3FEZA 4URGA 2HGLA 3R2CJ 2VFVA 1M5OC 1PJ7A 5SZTA 3H2LA 2ZDPA 2DEJA 5K9FA 3ELHA 2RU9A 4IG0A 5GMDA 4YDDB 3EPGA 1J5EF 2DR5A 1U2FA 1N0VC 2G2OA 4PYDA 3D66A 2R7RA 2V8DA 3CNQP 3DU6A 3HVTB 2OPSA 4NYZA 3T9NA 2MGZB 3SI8A 2HHHJ 1B7FA 2CDQA 1OIAA 1S99A 3GCWP 4N47A 2M3DA 1N33F 1KRPA 3JSRA 1RABB 1S5ZA 2W4DA 3D3CJ 3U1LA 3CCES 1BAZA 5HLFA 4J9VA 2BM1A 5GMEA 1X93A 2MQMA 2YX1A 4USHA 5KFKA 3N9UC 1GMWD 2P9GA 3Q8QB 1Y00A 3BGRA 1NJIT 1N36J 2LFVA 1RA6A 3P4UB 5KT5A 4J9MA 1XEZA 2KFNA 3UW1A 3KLIB 5IQ6A 1AFIA 4MK8A 3VGUA 3BN4A 4XK8C 3PYGA 2VH7A 3VZHA 5KFHA 1R89A 6AT1B 2LMIA 2Q2KA 3EDQB 2DY9A 1ZPVA 5KG3A 4DR5F 1SC6A 3N5FA 2LQ8A 3RBZA 2ADCA 2ALYB 1X9MA 3QJPA 3RZAA 1UJ6A 1FRXA 5KFSA 3J7YU 2UUCF 2HZCA 3IFEA 1PG5B 3CO0P 2QL7B 4UOHA 3H90A 5E0OA 3W2VB 4WFAQ 4XIUA 2YH0A 3H25A 1UA0A 2ZZMA 4Y34A 2OD6A 4M5NA 1R0AB 4JP8A 2OTLS 1Q79A 2B51A 2VG6A 4NMXA 1KP6A 2JX2A 1S79A 1LW0A 1YBUA 3DGPB 2WONA 1I94J 3HHDA 2Q6BA 4FKYA 1VQMS 1R8AA 3M2VA 3MPVA 4DL4A 4M5DA 3AA8A 2IPOB 4OZ5A 4UW2A 2HBYB 2ZNZA 4WYLA 3S8SA 2AX0A 2H9ZA 2Z0GA 1RT2B 1WORA 3CJ3A 1UFKA 4A8XA 4DWIA 2MKKA 4HR2A 2BEFA 4RW7A 2QLXA 2V4JA 3BO4A 3C2PA 4EO6A 4WP3A 3EXYA 1BQMA 1EQMA 4CM0A 4KHPF 2CPFA 2VOPA 4OX8A 3FNNA 2K8GA 3TX0A 1U2CA 2ZE2B 1HBMB 1KFDA 2BYCA 3DXBA 2UUAF 1T05A 4LR9A 4RW4B 4RW9B 3C46A 2IBOA 4R0EA 3T1HJ 4B3SF 4DFJA 2CJBA 2ZWOA 3GG1A 1KQGB 3GYXB 2ZH7A 1U1QA 3QRRA 1J2VA 2CQCA 2QLJB 1KKHA 1K1SA 1GX6A 4NEYA 3PHEA 3MR6A 2OMOA 3AXKA 1SC1B 4H4MA 4ZVOB 2MHEA 3AFGA 3PRBA 2CZ9A 1R8CA 2CRLA 2M5YA 2OTJS 2N3LA 4ZVTB 2R2SA 2O3DA 1E6YB 4PQUA 3K0JA 1WSVA 2O5DA 2DGQA 2J7KA 3CT9A 1PARA 5HI7A 3R7SB 3TJ9A 1U45A 3MM8A 1KN6A 2FD2A 2E7XA 3L09A 1JJ2R 2XHWA 4B9SA 3KHRA 2PMHA 3MPDA 1RDRA 4OZLA 1PO6A 3CJ0A 1Q5VA 2YNHB 4CI0B 3KK2A 3KG4A 5M2PA 3OVAA 3C6UA 4WJBA 1VIOA 3K5MA 1IJFB 3CCQS 1OY8A 2XWXA 3AQPA 2ASYA 2OEMA 5AE3A 4AD6A 1X9WA 2CG4A 3MCOA 3EZ5A 4J9NA 4ER8A 1XC9A 2MQLA 4DZDA 2KELA 4EBDA 1B0TA 1RTIB 4F7VA 5I3PA 1N0UA 2FZGB 3FJ2A 5ETOA 3R6GB 4DEZA 4Q5VA 1H6KX 2F40A 2BJ1A 3M2UA 1IR0A 3OVSA 1VFJA 2HHXA 2A2DA 5KFIA 3W7BA 4DFPA 3CCVS 3EYZA 3KK3A 4QWCA 1MU2A 1S59A 3CJSA 1J5EJ 2CQGA 3SYZA 3UN5A 2B9WA 3D1OA 3DXSX 1DLOA 1RT4B 2RH3A 3G9CA 3DRYA 1NZAA 2F9JA 2Z8QA 1UVMA 1N6QB 1QUPA 1RAJA 2HAFA 2NXUA 3TWZA 1W25A 1YWXA 3BKFA 3HLUA 2IRXA 4CO5A 1IKWB 1RU1A 2Y1IA 5D3GB 2DT9A 2W7AA 1T11A 3KLHB 5C24A 2RT3A 4ELVA 1OHNA 2VQEF 1LV5A 4KFBB 2FLOA 5BYRA 5F8IA 1HHTP 2K1OA 3LPYA 3SCJE 1CQNA 3BBCA 4OMFG 5FD1A 4WXOA 5DLGA 3SDEB 3A12A 4X84A 3T1HF 1H7WA 3MR2A 4K4VA 1NJXA 4C9DA 4PCQA 3HDSA 2HK3A 4OYIA 2OPPA 3BQ2A 1AT1B 2D1CA 3M8YA 4C2MA 1X0FA 1N48A 1N32F 4C8MA 5DDOC 1T0TV 2IDEA 5LM7E 4UTGA 1NB2A 4J37A 4X64J 1N5QA 4WXWA 1GQEA 2HHTA 1JWWA 3RB3A 3H4DA 2VB6A 2I0XA 3OR2B 1JLEB 2XMJA 4DDFA 1EHWA 3ENQA 2B5JB 1Y9OA 3PO4A 1F0XA 4HH1A 3OHAA
chains in the Genus database with same CATH topology
2BJ8A 2K1OA 1ARQA 2BA3A 2CAJA 2HZVA 2JXGA 2CAXA 3OD2A 2BJ1A 2BJ3A 2K5JA 3BKTA 2BNZA 1MYLA 3PHTA 3LGHA 3FT7A 1Q5YA 3FMTA 2K6LA 4HV0A 1IRQA 2K29A 2Y3YA 2BNWA 1PARA 3BKUA 1MYKA 2GPEA 3QSIA 2NZCA 4D8JA 2BJ7A 1EA4A 1Q5VA 2CPGA 2WVCA 3QOQA 2JXIA 1P94A 2BSQE 2F1FA 2KELA 3VW4A 1B01A 4ME7E 3VEBA 2FGCA 2PC6A 1QTGA 2WVEA 1U9PA 2K9IA 3BKFA 3GXQA 1BAZA 2HZAA 2H1OE 2RBFA 1X93A 2WVFA 1B28A 2JXHA 1BDTA 1BDVA 2BJ9A 2WVBA 3H87C 1MNTA 4FXEA 3VEAA 2AY0A 1NLAA 2CA9A 2WVDA 2CADA 1ARRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ8 A;  2K1O A;  1ARQ A;  2BA3 A;  2CAJ A;  2HZV A;  2JXG A;  2CAX A;  3OD2 A;  2BJ1 A;  2BJ3 A;  2K5J A;  3BKT A;  2BNZ A;  1MYL A;  3PHT A;  3LGH A;  3FT7 A;  1Q5Y A;  3FMT A;  2K6L A;  4HV0 A;  1IRQ A;  2K29 A;  2Y3Y A;  2BNW A;  1PAR A;  3BKU A;  1MYK A;  2GPE A;  3QSI A;  2NZC A;  4D8J A;  2BJ7 A;  1EA4 A;  1Q5V A;  2CPG A;  2WVC A;  3QOQ A;  2JXI A;  1P94 A;  2BSQ E;  2F1F A;  2KEL A;  3VW4 A;  1B01 A;  4ME7 E;  3VEB A;  2FGC A;  2PC6 A;  1QTG A;  2WVE A;  1U9P A;  2K9I A;  3BKF A;  3GXQ A;  1BAZ A;  2HZA A;  2H1O E;  2RBF A;  1X93 A;  2WVF A;  1B28 A;  2JXH A;  1BDT A;  1BDV A;  2BJ9 A;  2WVB A;  3H87 C;  1MNT A;  4FXE A;  3VEA A;  2AY0 A;  1NLA A;  2CA9 A;  2WVD A;  2CAD A;  1ARR A; 
#chains in the Genus database with same CATH topology
 2GO8 A;  1A0O B;  3RW7 A;  3ZTR A;  1X31 C;  2MQ8 A;  5DS7 A;  3U02 A;  3ZC4 A;  3ZZR A;  4ZHR B;  4CRJ A;  2VON A;  3JYT A;  1K73 T;  1FVQ A;  2KU7 A;  4LSN B;  4NLS A;  2HG4 A;  2WB4 A;  4P7V A;  4P72 A;  5A2Q U;  3EPI A;  2DO4 A;  2XMV A;  5LJ5 Y;  4QBU A;  2BQU A;  2W7P A;  4EO8 A;  4LBH A;  4Q7A A;  3OSP A;  3D0G E;  1KLM B;  5CA5 A;  4WPA A;  4N8N A;  2JXI A;  1X4D A;  5CYM B;  4X4V A;  4CH1 A;  3I4H X;  4OYO A;  4B3S J;  1IKY B;  1TKX A;  4WYW A;  1PKU A;  2FY1 A;  5HMW A;  3D2W A;  2HWT A;  3J81 Y;  4WKR A;  1S57 A;  2X51 A;  5FLX Y;  2AYG A;  1WAC A;  1GMW A;  2EK6 A;  1PCA A;  1RQ0 A;  2XI2 A;  1XIQ A;  5KG6 A;  4CNZ A;  2RQM A;  3BPS P;  3CB4 A;  3B78 A;  4TY9 A;  5M2U A;  5IS2 A;  2KM8 B;  1KC8 T;  3EMT A;  1MNE A;  4NXN J;  2J9D E;  3QLH B;  3RRK A;  5IM0 B;  4BLG A;  3NXZ A;  1X5P A;  4F3Q A;  2JH3 A;  3VAJ A;  3SSS A;  3NP5 A;  3PW0 A;  4XPC A;  3OTC A;  2D3Z A;  2XSJ B;  4ZLJ A;  2EC0 A;  3SMZ A;  3C19 A;  4NL5 A;  3JB9 k;  4F36 A;  4NXM J;  1IKX A;  3K2Y A;  1I94 F;  1A9N B;  5J2N A;  4I4B A;  3I32 A;  1G6B A;  1A7G E;  1ROF A;  4KHM A;  2ATC B;  3T5L A;  4FPI A;  4E0D A;  4F2S A;  1SJ4 P;  2B7C B;  1SI9 A;  3GJR B;  2KVI A;  4NLD A;  4Q0B B;  2C42 A;  1Q81 T;  3V2U C;  2YH1 A;  3D5M A;  1T9X A;  4N76 A;  3ZNU A;  3TI0 A;  4AFF A;  3KMQ A;  5F8M A;  2CAJ A;  1JMT A;  1N54 B;  3BJY A;  4ZVQ B;  3MUV P;  2L9W A;  3N5B A;  2HGM A;  1WC3 A;  2K2P A;  2VKZ G;  4DS5 A;  3TRG A;  4DR6 F;  2EBG A;  2QC3 A;  4G65 A;  2R8I A;  2OGU A;  2GPE A;  4O3S A;  3RB6 A;  3MCM A;  3ONQ A;  2NXE A;  3A3N B;  3K8V A;  3VWS A;  4FBT A;  3TAN A;  2DNQ A;  2HEK A;  2AJ0 A;  2B43 A;  2QJ3 A;  5H9F K;  3OXF A;  4DR7 F;  4K50 A;  1RLC L;  5D6G A;  4C11 B;  1HW9 A;  2M88 A;  3F44 A;  1K9M T;  3WC2 A;  2RRA A;  1QY7 A;  2ZD1 B;  1JXE A;  3H59 A;  2KDO A;  1N5T A;  4YME A;  3OL9 A;  2HHW A;  1DBD A;  1YJ9 S;  4K0K J;  1RAG B;  4PUO A;  3HJF A;  4KFB A;  3H5Y A;  1TUW A;  3HKZ D;  1YKW A;  2V2Z A;  4O4R A;  3HHL B;  1RWW B;  2CNN B;  1JLF B;  3OD2 A;  4ZPT R;  2CQI A;  3Q8P B;  2X7I A;  2P9C A;  2OJ3 A;  5CHC B;  5I42 A;  4EWT A;  1FX4 A;  2ZIT A;  1TP7 A;  2F9D A;  3RBX A;  4F67 A;  1H38 A;  4UY8 T;  2MKY A;  3Q0A A;  1CBK A;  3PW4 A;  1QVG R;  4NWB A;  1N6Q A;  1U0H B;  3DRP A;  3V6K A;  3ILI A;  4K2X A;  2K7K A;  4YS2 A;  1DRZ A;  4PG4 A;  2E9Z A;  3DN9 A;  4DX7 A;  5E3R A;  4CDI A;  1UFW A;  2CQ1 A;  3VW4 A;  2JHE A;  3HP6 A;  1Q7L B;  2BV3 A;  1QTM A;  2HVI A;  3DYA A;  2AEM A;  2XC9 A;  3GII A;  4KPY A;  4DQR A;  5KTQ A;  3M30 B;  2YPZ A;  3J7Z 5;  2XO7 A;  2BM0 A;  1TU0 B;  2EEY A;  4IRK A;  2V34 A;  2KJV A;  3K89 A;  3MMB A;  1RT7 A;  3MMB B;  2R7X A;  1RHJ B;  5DQI A;  2A10 A;  1MML A;  5HQ8 A;  4OI4 A;  1TVR B;  2M7S A;  5KT7 A;  1SL2 A;  4B9N A;  4EMD A;  4DLG A;  3BSO A;  4KKO B;  1YIT S;  2RQ4 A;  1XMB A;  1F2H A;  3MEG B;  2NS1 B;  2IRU A;  3PFE A;  3TVK A;  1F9E B;  1PAU B;  3GIK A;  1A6L A;  3GV5 B;  4MYU A;  4BC9 A;  1H74 A;  3MM9 A;  1BHN A;  3M8Z A;  3POT B;  4RUB A;  2AV5 A;  1BQM B;  4JV1 A;  1RXO B;  4K5S A;  3C66 A;  1T3N A;  3VAL A;  3GZ7 A;  4DZ6 A;  3C6T A;  2IMW P;  3QAT A;  1J27 A;  3QYY A;  2KG0 A;  1CEZ A;  2Y0S D;  4DSI A;  2V8G A;  1RHU B;  3ZZP A;  4WBF A;  4X4U A;  3TQE A;  2BE2 A;  2V4R A;  2WVF A;  1N34 J;  1AZS A;  1SJ1 A;  4M5D B;  1R0C B;  4LRV A;  4G6V B;  2M9K A;  1B28 A;  5DDQ C;  2DVI A;  3CME S;  4FKX A;  5C2G A;  4Q0B A;  3UR0 A;  4CLW A;  3RB4 A;  2BZ2 A;  3POT A;  4R0J A;  2HIY A;  4EFA C;  1HYS B;  4FP9 A;  2B0G A;  4NA3 A;  2GJF A;  4RU9 A;  5KFW A;  3G87 A;  2K29 A;  3SCI E;  2F3J A;  3IGV A;  3TJA A;  2RIL A;  1D3W A;  1YJW S;  1OY6 A;  2ZE2 A;  1QTN B;  5KFT A;  3W9I A;  2OD4 A;  2UV8 A;  1SUQ A;  2W8L A;  4ED6 A;  3UD5 A;  2EK1 A;  2CQ4 A;  3ZTS A;  1ZM2 A;  4B3T F;  2V2V A;  8ATC B;  4L75 A;  4ZJL A;  4OHW A;  4KTQ A;  2EFV A;  2YQ3 A;  3W9H A;  4QR2 A;  4M63 A;  2A2B A;  4CTA B;  1ZZN A;  4J9K A;  1VK8 A;  3QAU A;  4ED3 A;  1HBN B;  3BN7 A;  3MAA A;  4LIW A;  4Y00 A;  4FXE A;  4EU0 A;  5E3A A;  1JK9 B;  5HVH A;  4OHV A;  4B9U A;  2B5J A;  5BR8 J;  2V2Q A;  3GIM A;  2DRA A;  1X8D A;  1VLY A;  5EWE A;  3NNC A;  4OJ3 A;  5H9E K;  4YEA A;  4NYO A;  1FX2 A;  2DHG A;  3LGH A;  2J76 E;  3BRE A;  3PRV A;  4KT0 C;  3LAL A;  2HRU A;  3U1M A;  2MZT A;  4LR8 A;  4ES3 A;  2E44 A;  2L48 A;  5C2C A;  1RCO B;  1VQ5 S;  3IAM 9;  2K06 A;  3G6X A;  2QRR A;  3GJQ B;  4QIE A;  3J81 U;  2MGZ A;  1JXV A;  3DHW C;  1TAU A;  2W1B A;  1C1C A;  1NK5 A;  2H65 B;  2W4C A;  3VEB A;  5D0E A;  4DG1 B;  2GIQ A;  4JI4 J;  4DV4 J;  3LGN A;  3RTV A;  4LRC A;  4Z2X A;  1NRK A;  2PD1 A;  4K2J A;  1DQA A;  3ZZ0 A;  4M5G A;  1J5O B;  4OYW A;  3CCU S;  1SL1 A;  2RIJ A;  3LP1 B;  4UOC A;  2VJU A;  4IOC Q;  3W64 A;  4DR3 J;  1ITP A;  2O66 A;  3PCO B;  4TY8 B;  2W2P P;  1WKK A;  2VBZ A;  3M8P B;  1M1K T;  1Z4U A;  4DBQ A;  2E1P A;  4GVB B;  5RUB A;  1FEH A;  3W2W A;  3BKU A;  1JJH A;  4U9R A;  5J1N A;  1R8H A;  2R8J A;  1FEE A;  4J9S A;  2F4V J;  1XWL A;  2MLY A;  4FYY B;  2BR0 A;  1HNW F;  1NME B;  2NZ4 A;  3VAG A;  2B4P A;  2DY1 A;  2WOM B;  3SCK E;  4O3N A;  1HBN A;  1IM4 A;  2L08 A;  3C15 B;  1R3N A;  1YI2 S;  1VRU A;  2R7S A;  1NHK L;  1YJ7 A;  2QSF A;  2DXD A;  1M5S A;  4F4A A;  1YJT A;  1UP1 A;  4P2M A;  1JLG A;  3DLK B;  4WCE Q;  3KK1 A;  3ZZT A;  1NUE A;  2J6T A;  3LO3 A;  4ETZ A;  1VQL S;  4B3T J;  2VOO A;  3D1Q A;  2OFH X;  1BWE A;  1CS4 B;  3CD0 A;  3GIL A;  1YX2 A;  3VVT A;  2POK A;  3NCQ A;  2JVR A;  1V3S A;  2E66 A;  4KO0 B;  2J9E A;  4M8L A;  3J81 j;  1FF2 A;  2A3J A;  4UUX A;  4A4J A;  5HAN A;  4DV0 F;  4DI6 A;  2UU9 J;  4A8S A;  2DEI A;  4OJG A;  1XNQ J;  4G1P A;  2IM0 A;  3GYN A;  5LMN F;  4ZVS B;  5F9L A;  1Y0H A;  2YNF B;  1R8P A;  1RBL A;  3KK3 B;  3DMJ B;  3SV3 A;  1VQ4 S;  3THT A;  2RKI B;  2M52 A;  1L5U A;  1NDC A;  1VIS A;  1RT5 A;  1WOP A;  2VAS A;  2LEA A;  3FC9 A;  4R25 A;  1WEX A;  4AXJ A;  4C98 A;  4J9O A;  3BH7 B;  2OHD A;  1VQN S;  4Y0F A;  2BAN B;  1WC1 A;  1I1G A;  5J2M B;  1VHF A;  3HHL A;  1RWO B;  4LF8 F;  1F2G A;  4CTA A;  3HVA A;  3OQ2 A;  2YKQ A;  5E3Q A;  5SUH A;  4RNO A;  3MR5 A;  2Y8Y A;  4WZM A;  1R7I A;  5B0E A;  5AXN A;  3L3C A;  2HND A;  1RHM B;  5CYQ B;  3CPW R;  2UXC J;  1JIH A;  3Q8R B;  5GAE U;  3M9N B;  1Q8L A;  1WJ9 A;  2KI2 A;  3GMG A;  1ZBT A;  4YY3 F;  2VU5 A;  1IQT A;  1DAR A;  1TL3 B;  2MKH A;  4NLQ A;  4OX7 A;  3QT8 A;  3IP0 A;  1HBO B;  5IC4 B;  3M30 A;  4L73 A;  2QT7 A;  1YRX A;  4I68 A;  4NE9 C;  3TVY A;  1TV6 B;  4DR1 J;  3HVR A;  2AP6 A;  2DNR A;  3K58 A;  1C2P A;  2WSC C;  4ID5 B;  5KFG A;  4OYM A;  1N36 F;  4NA2 A;  2A1B A;  1N4L A;  1URN A;  4RWX A;  1MSW D;  4Y3C A;  1UTA A;  1NK4 A;  4K4U A;  1NH7 A;  1PC4 A;  1RTI A;  2QL9 B;  2B4O A;  3A8I A;  4F0M A;  4NLG A;  3IWL A;  1BQN B;  4ED5 A;  3QIP A;  4DXL A;  3NNE A;  3BB5 A;  4PWW A;  4PXE A;  2VFS A;  2BW7 A;  2CPJ A;  4DPU A;  4TU8 A;  1RKI A;  3CD6 S;  2VUG A;  4BWJ A;  1L3T A;  1RAE B;  4KAI A;  4PWD A;  3QJJ A;  4I0W A;  4DCP B;  2R2T A;  1JLC A;  3C6U B;  5CXT A;  4DL2 A;  2AJQ A;  2Z30 B;  1N34 F;  4C8O A;  3L9Z A;  2M8H A;  2FHJ A;  4GC6 A;  4TYB A;  4KC5 A;  5KG7 A;  2AU0 A;  2UUC J;  1KTQ A;  3HHK A;  4CO4 A;  1RWM B;  3PAC A;  5IT0 A;  4C11 A;  2QFJ A;  2BE7 D;  2J6U A;  3CUL A;  2IFX A;  3PYD A;  4ZN1 A;  2J0S D;  5KAK A;  3MFI A;  2JC1 A;  3DGP A;  3O44 A;  5DDP C;  2RRB A;  2B8P A;  4R8U A;  2VQF J;  4DV7 F;  4H4K A;  3GYG A;  1ARQ A;  2WRM A;  3M8Q A;  3NNA A;  2XMT A;  1UET A;  1UZD A;  4MJW A;  2D9P A;  3AXM A;  2MDA A;  2AYE A;  1KVK A;  3MGJ A;  4MFB B;  3UWT A;  4CLF A;  5LSL A;  5C25 B;  1HI8 A;  3KDN A;  5HRO B;  3NCR A;  3PR5 B;  4B9T A;  4RBT A;  1JLA B;  3R5J B;  3M32 B;  1UW4 A;  2CJQ A;  2GVZ B;  2OKQ A;  1P1T A;  2A18 A;  5J1P A;  1QUV A;  3IS9 B;  1Q53 A;  2Z56 B;  4XTT A;  1OQ3 A;  1M90 T;  2DR8 A;  3W3S A;  1KLN A;  3IRX A;  1D9F A;  3TYT A;  1PJ6 A;  5C42 B;  1YJV A;  4H4O B;  4NLU A;  4LRA A;  2NCK L;  5D4N A;  5DQH A;  5CZX A;  3H20 A;  4DCJ B;  1FTR A;  2MY7 A;  7FDR A;  2IA6 A;  1LNQ A;  3DYA B;  1VC5 A;  5J2M A;  2ZD1 A;  2GQC A;  3S1T A;  4NLR A;  2C3O A;  1BDV A;  2DHA A;  2BJ9 A;  5HO4 A;  4A8M P;  3BGR B;  2XS7 A;  2VOD A;  2KRR A;  2ZUA A;  4NZ6 A;  3MM7 A;  1W2I A;  1YQH A;  2IYG A;  2Q3P A;  4M1K A;  3CED A;  4NXM F;  2WK4 A;  5D4P A;  3E3X A;  1RTZ A;  4X4S A;  1F60 B;  4AL6 A;  3I5C A;  2OSQ A;  2QMW A;  1FXL A;  3W8P A;  1E6Y A;  4MT1 A;  3ISZ A;  3DCA A;  1FES A;  3G2X A;  1TL4 A;  1S1X B;  3KXD A;  3U1N A;  2DJW A;  3GCX P;  2Z2M A;  3CDB A;  2V5H G;  2A2C A;  3CCM S;  2Q43 A;  2D3O 1;  2PI4 A;  4E2F B;  4HI1 A;  2GQ2 A;  2XGQ A;  2DIU A;  2HPU A;  3CO9 A;  4DR2 J;  1VS3 A;  4K59 A;  4ME7 E;  1F5B A;  4CLK A;  5AJ3 J;  1VC0 A;  4DV1 J;  4ZCK A;  1VBZ A;  3FMW A;  3H4B A;  4CWB A;  1W26 A;  1IVZ A;  4G1I A;  1C1C B;  1LQ9 A;  2HGN A;  3PDN A;  3MAH A;  3OSN A;  2FTR A;  3K5P A;  4ZVU B;  3JS9 A;  3CJ5 A;  1PBA A;  1D8Y A;  3OJS A;  2HQG A;  2PO4 A;  3BEG B;  4OZ3 A;  3L7O A;  1OYD A;  5C24 B;  4JB8 B;  3KLV A;  2R3V A;  2UXB F;  2AMC B;  3ETM A;  5E7O B;  4AAI A;  2J8A A;  2ABY A;  1VQS A;  1TR0 A;  2OEJ A;  2J0W A;  2WB1 D;  2H5E A;  3LAK A;  4N5S A;  3JYT B;  1YSJ A;  2Y3Y A;  3M8P A;  3AOC A;  4KGM A;  4X65 F;  1TL1 B;  3K5O A;  1RWN B;  1LWE A;  2K1R A;  3FEY B;  4RKU C;  4LF8 J;  3CJ4 A;  3KLE A;  1X4C A;  4DV7 J;  4MKY A;  2UU9 F;  4QIV A;  2LA4 A;  1S97 A;  1ZAV A;  5L1K A;  2QN6 B;  2ZUG A;  3QWU A;  3PKY A;  3DLG B;  1WHW A;  3MD3 A;  5A8K B;  4ED2 A;  2CQ0 A;  1EZZ B;  1RB0 A;  3UCU P;  2B6A A;  3BYP A;  3UFC X;  4WU2 A;  4TNO A;  3CMQ A;  2Y1L B;  5FII A;  4CLL A;  3R1H A;  4ILL A;  1HQE A;  5ETT A;  4RNM A;  1F3V A;  3R27 A;  2ZM6 F;  5J2P B;  1RK8 A;  2MB0 B;  1NLA A;  1R31 A;  1TKZ B;  4NLP A;  1UWA A;  3T3F A;  4LQ3 A;  1QAY A;  1FJ7 A;  1IQZ A;  1MG7 A;  4RX6 A;  1S6P A;  3DU5 A;  4O3P A;  1ZZF A;  3HXM A;  4OYX A;  4Z7C A;  5KFE A;  2H1Y A;  3SDE A;  5AXK A;  1SJ3 P;  5L39 A;  4P71 A;  4FF3 A;  1G1X A;  1UVK A;  3VR1 A;  2AT1 B;  2DNN A;  2GGP A;  1KBR A;  1IM6 A;  5J2Q A;  2NZC A;  4O3R A;  2Q66 A;  3M6W A;  2DGT A;  2YWH A;  2RHS B;  2XYH B;  3MPW A;  1RAC B;  2J7W A;  3BR8 A;  3VGT A;  1S6U A;  1WHY A;  2GZO A;  1MWZ A;  2YKO A;  2H1O E;  5IV4 A;  3QZ8 A;  3T5J A;  4OX9 J;  5BR8 F;  4K4W A;  1QAX A;  1WG5 A;  2HHP A;  2OPR A;  5A0Y B;  4LJM A;  4WK1 A;  4HDH A;  4DPX A;  3RR7 A;  3FQK A;  4OZN A;  1QD1 A;  2VFR A;  2WBM A;  3D1H A;  4RPF A;  2AQ4 A;  1RHQ B;  1NK0 A;  2UVW A;  4F3O A;  1KVJ A;  1IKV B;  1LWF B;  3B82 A;  1MU2 B;  3DC2 A;  5K8M A;  1B70 B;  1X5S A;  2V8V A;  5KFN A;  4F2R A;  1SQF A;  1M0S A;  3MEG A;  3WC0 A;  4LSN A;  3HCX A;  5C25 A;  5I42 B;  2MKI A;  3KLF A;  5I3U A;  2VC0 A;  2E5J A;  1UWB B;  2KZM A;  1TVR A;  1EP4 B;  3PO5 A;  1RZM A;  4HH0 A;  3JSM B;  2FC9 A;  1P9Q C;  3LTO A;  2EKY A;  5A8K A;  2EG2 A;  3SBM A;  1KWM A;  1S77 D;  4EGL A;  4O44 B;  1ICE B;  4CM2 A;  2OO4 A;  3QNW B;  1KSP A;  1T9W A;  4KQZ A;  4DV4 F;  2ZC3 A;  2GO9 A;  3IBC B;  1NO8 A;  2YKM B;  2W2O P;  2OUG A;  2WVE A;  1JLE A;  2VDH A;  3J7A 1;  3HUL A;  1IKW A;  5D3G A;  2JNJ A;  4B9V A;  4U7U D;  1BDT A;  2AYB A;  4X66 J;  1HBU B;  3DLH A;  6FD1 A;  3ADA C;  4ED4 A;  2C2K B;  2CVI A;  5F0U A;  1E6V B;  2BA3 A;  1V5V A;  2HUR A;  4M5J A;  1XQI A;  2UV8 G;  3GE9 A;  4OQJ A;  3BGL A;  5B0F A;  3AJ2 A;  3W63 A;  8RUC A;  5IZH A;  1UEU A;  5HK4 A;  4AUK A;  3A8J A;  3A8K A;  4ZVF A;  2E7V A;  4V19 X;  3FCV A;  1BQN A;  3DFE A;  3CJ8 A;  1X0P A;  1GEH A;  1IUJ A;  1LWC A;  2ROG A;  4U8Y A;  2R7W A;  3FDS A;  1HKA A;  1CC7 A;  1U7L A;  3KNG A;  1R6Y A;  3MTJ A;  3H42 A;  1SL0 A;  4X4Q A;  1D8Z A;  1GTE A;  2KL8 A;  1OS5 A;  3CD7 A;  3EGV A;  3E2E A;  5FJ4 A;  2GA7 A;  2OSR A;  1I3O B;  3P3D A;  3MPY A;  4RUA A;  2R2U A;  5D77 A;  1HHS A;  2VBY A;  1U47 A;  3LWL A;  5L9X A;  3FEX B;  3F0N A;  3AD8 C;  3ILL A;  3EUN A;  4YR2 A;  2QEX S;  1IBM J;  2HVH A;  4C6A A;  2CJK A;  4O4G A;  4LMZ A;  3OLA A;  2E1R A;  2ROE A;  1K8A T;  3BSN A;  1RTD B;  2CJA A;  4ZDN A;  1DZ5 A;  2IYI A;  1S9F A;  1KHV A;  3AB2 B;  5F8H A;  5KFQ A;  1U1K A;  2QYG A;  1UW9 A;  2C3Y A;  4NRT A;  4OX9 F;  2KXH A;  2JLE A;  3R9L A;  2A6O A;  2CNO B;  4F04 B;  3R5B A;  1S0M A;  4HV0 A;  4F25 A;  1JLF A;  1SB6 A;  2HHH F;  4M94 A;  3VHQ A;  2VPZ B;  4IQX A;  2DCL A;  2CYY A;  2W24 A;  4EK2 A;  4EYH B;  4ELU A;  4ED8 A;  3CD5 A;  4DV2 F;  4IG0 B;  3EDR B;  3R7N B;  1RAO A;  1T03 B;  2LYV A;  4PRF A;  2XLI A;  2MMY A;  3IS9 A;  4DUY J;  4J91 A;  2EW9 A;  1ZAX A;  1S6O A;  3PJ9 A;  4N7T A;  2ZHB A;  1HPZ A;  2BQR A;  2MZQ A;  4UOF A;  1FNO A;  2IVY A;  1U1R A;  2MLZ A;  3LWM A;  1SKW A;  1Q7Y T;  5L8R C;  4DQS A;  1YRT A;  2OFG X;  3OXG A;  3MMC B;  2RJZ A;  3FSX A;  4JOU A;  3T1A A;  3OJU A;  4IH7 A;  5DRK A;  1HR0 F;  2CAD A;  2BJ8 A;  2RAQ A;  2RUG A;  1SJR A;  3RG6 A;  4C0O C;  1RTD A;  4LF7 J;  1WHX A;  1OSC A;  4K4Z A;  2KZZ A;  4OI3 A;  2C2M B;  3RU0 A;  1SBR A;  1B0P A;  2BNZ A;  1RCX B;  5HMY A;  4QWD A;  4ECR A;  3SSR A;  2K3K A;  2YBV A;  3OLB A;  1VQ6 S;  2DGO A;  3TP2 A;  3D7S B;  3LA0 A;  2DNK A;  2BNW A;  1CSJ A;  4NLV A;  4QIF A;  4NA1 A;  4PEO A;  1DQ8 A;  4EI2 A;  6FDR A;  5B08 A;  5F8L A;  4X66 F;  4ITS A;  3CCR S;  4LVN P;  2AD9 A;  2FLP A;  4DSL A;  2MST A;  2JC0 A;  1W7W A;  4HYK A;  2HS0 A;  3MDF A;  3KJN B;  2UUA J;  3FQL A;  2DGW A;  4QU7 A;  2IA0 A;  3SQG A;  4A8W A;  2IM3 A;  3EVW A;  3QGP A;  4OV1 A;  1RYS A;  2WVB A;  1TKT A;  1U25 A;  2E29 A;  4Y2M A;  2RML A;  4RJV A;  3DOL A;  1H2U X;  3OR1 A;  4DV5 J;  4W92 B;  4ZOS A;  5IWA J;  3V4I A;  2HKE A;  2KHD A;  2DH7 A;  3D4J A;  3UDE A;  5ETK A;  3UI3 A;  1WD6 A;  3VVU A;  3CCW A;  3R5D A;  3ZZU A;  4IUF A;  3P8B B;  1JB0 C;  2LQB A;  3UQS A;  2MEW A;  3DI6 B;  3NL0 A;  3HZG A;  3UR3 C;  1D09 B;  1UJ5 A;  2YVS A;  2YY3 A;  4HT5 A;  4LR7 A;  1HWI A;  3RBE A;  3DLG A;  3PZP A;  5IWA F;  3IO1 A;  5J2Q B;  2P6S A;  2CPX A;  3E01 A;  4ES2 A;  4QWA A;  2KN4 A;  3KYL A;  3R3T A;  3G8S A;  4EBC A;  5KFF A;  1I51 B;  4LF5 J;  2IM1 A;  1CC8 A;  2QX0 A;  1PYT A;  3PX4 A;  1QAJ A;  2HW3 A;  4UUW A;  4U6P A;  1FJE B;  5GMK a;  3OR2 A;  4HHU A;  5HAO A;  1N5Y A;  2H5I B;  3PNI A;  2AGQ A;  1GX5 A;  5A8R A;  1FKO B;  4MKV A;  1ZA2 B;  5CYM A;  3KJQ B;  3V4I B;  1XR5 A;  1MYK A;  2GJI A;  2IAJ B;  2ZVI A;  1VQ8 S;  5FDL B;  1O8B A;  3SEO A;  9RUB A;  3OR1 B;  1Z1Z A;  3NLC A;  4AQY J;  2XS2 A;  5ETV A;  3BH6 B;  2ZH6 A;  3RAM A;  4KV8 A;  3GJT B;  5HP1 A;  2JEG A;  1WC6 A;  1YDL A;  1UVJ A;  1ZM9 A;  4BC7 A;  3TZY A;  2MKJ A;  1Y5N B;  4EZ9 A;  4FF1 A;  1IBC B;  3VV2 B;  4NEZ A;  1HR0 J;  1WDT A;  2LEC A;  3O1L A;  1RAF B;  2FVQ A;  2VPY B;  3TX8 A;  1YJR A;  1U24 A;  4LF7 F;  4QWE A;  2W25 A;  5I3Q A;  2YKA A;  3CJQ A;  4TQS A;  1UMJ A;  1TFY A;  1WG1 A;  4DQI A;  3DMJ A;  5C7P A;  4TU7 A;  3OTD A;  1FI4 A;  2RQC A;  5KFZ A;  3EGZ A;  2DHS A;  1BGX T;  3GLJ A;  2FJW A;  1MRO A;  1RT1 A;  1U1P A;  2XCA A;  2ZNY A;  4E98 A;  2QA1 A;  4ZN3 A;  1C4C A;  2QGF B;  3QGI A;  5DZ7 A;  3KUG A;  3QBC A;  4O4G B;  4Y28 C;  1HL6 A;  2CJ9 A;  4DF8 A;  1JLQ A;  1B7Y B;  1U09 A;  1ZYQ A;  2XSF A;  3PXG a;  3PX6 A;  3MM7 B;  3AD7 C;  4ATN A;  2XB2 D;  2V69 A;  7FD1 A;  2JXG A;  1IWG A;  5FLX U;  2EBE A;  1N33 J;  1BC6 A;  2AEJ A;  3BGU A;  2EG1 A;  2FIU A;  2GVD A;  2MZS A;  2HNY B;  3MMC A;  2ZH5 A;  4N56 A;  1QVF R;  3QT7 A;  4ZLP A;  2RNE A;  4YB7 A;  3OXL A;  3PIP Q;  3VAI A;  2DNP A;  3PRD A;  4O3O A;  3T41 A;  4U7C A;  2VG5 B;  1NKC A;  2ZH9 A;  4DOZ A;  2CJX B;  3M05 A;  4H4O A;  2U2F A;  1SJF A;  4O23 A;  1GTH A;  4FS2 A;  2BJ7 A;  2J0X A;  3PFO A;  4PWD B;  3BS9 A;  3EGN A;  4ENO A;  1N52 B;  3HX9 A;  5CD4 H;  3BGF A;  4KB7 A;  4O0N A;  2DGU A;  1H3D A;  2BQ3 A;  1RAD B;  4LF9 F;  4JI4 F;  2XI3 A;  1E6V A;  2XNQ A;  4J7C A;  1YRU A;  5GAH I;  4L3N A;  4CLU A;  3FFI B;  4ZIV A;  2V0N A;  3KLG B;  3HT3 A;  5D8H B;  4LFC J;  5CCM A;  1EA4 A;  1FTC A;  3TUZ C;  3OFH A;  3M8Q B;  1XMQ J;  1WNE A;  4HKQ A;  4LVO P;  5ETM A;  3I31 A;  1VQ9 S;  4WE1 B;  1C0T B;  3NNH A;  2QLF B;  3ZTO A;  2F8E X;  5KT6 A;  2HNZ A;  2KXF A;  2CZ4 A;  5D0R A;  2NSC A;  2CUY A;  3DRR B;  1RAH B;  5F8N A;  4K4Y A;  4IYQ A;  3W5Z A;  1FXD A;  3UDL A;  1WKJ A;  2WHO A;  5A76 A;  2L3M A;  1SUQ B;  2FVC A;  3QT6 A;  3UCZ P;  1IBL J;  2YKN A;  2NUU G;  4EUV A;  2ZZN A;  1EP4 A;  1P94 A;  1NBE B;  2V68 A;  1PYO B;  1Q95 G;  1SJQ A;  2EC2 A;  1HNX J;  4IR9 A;  2JOQ A;  4NCA A;  4OZ0 A;  5HBM B;  1KQF B;  3M7V A;  2M2B A;  5ETS A;  1XR7 A;  2E1A A;  3D9B A;  5L1J A;  4F50 A;  4JI7 F;  1NXI A;  2HBZ B;  2ROP A;  3I0S A;  4CLS A;  5EWG A;  2MKC A;  5ITH A;  2GS8 A;  4PAA A;  4EBE A;  2MTL A;  2YWW A;  5DJB A;  2DHH A;  4DU7 A;  2GJ2 A;  1AZS B;  3MCS A;  4PZV A;  4F3M A;  3KHL A;  2IC3 B;  3NWG A;  3CJ2 A;  2X1B A;  1RJJ A;  4F4K A;  1RTH A;  1ZM3 A;  5U47 A;  2MQQ A;  5LL6 d;  3AOB A;  1S7I A;  2K3I A;  2XTJ P;  2HLT A;  4CQ1 A;  4G1Q B;  1U26 A;  4AL5 A;  4TU9 A;  3PKM A;  2GFF A;  2HFZ A;  5KFV A;  2F8M A;  2FVS A;  2GGP B;  2B9X A;  3PM9 A;  1KOH A;  3ZNJ 1;  2HHS A;  2H51 B;  3NWR A;  4IQM A;  1RWU A;  3MM9 B;  2UVR A;  1IXK A;  1U1N A;  2C1E B;  2NUH A;  2IJR A;  2JEF A;  3LP2 B;  4DPT A;  2WSE C;  2ZH8 A;  4JV5 J;  3CIZ A;  5D4O A;  4WZQ A;  1R27 B;  4YDX A;  4GKK J;  4WK3 A;  1HBM A;  3C14 B;  3M8W A;  2EFG A;  3EZO A;  4NLW A;  5J1E A;  4I6Y A;  2CG8 A;  3B8H A;  3UDV A;  3KNA A;  1R6V A;  4Q2M A;  1BQX A;  5ETQ A;  3HM9 A;  4U7U K;  1HQE B;  4PWU A;  3DRR A;  2VF3 A;  3W5Y A;  2XYG B;  3C16 A;  1G2E A;  4MKA A;  3MED B;  3SXL A;  4B3R F;  1RBA A;  2J7U A;  1RT2 A;  1RAA B;  3SFG A;  2IJF A;  3A8E A;  2V50 A;  3AAW B;  4EYI B;  3Q8Y A;  3PW5 A;  1VGY A;  1Y10 A;  2RDJ A;  3PW2 A;  3QFW A;  3R1L A;  1NDP A;  1SKS A;  3SFU A;  4W90 B;  2CIM A;  2JSX A;  3KLE B;  2DXF A;  3R8Y A;  4ZVR B;  4ILR A;  4P74 A;  3CDA A;  1GNK A;  4DX5 A;  4C8L A;  4EZ6 A;  4CO0 A;  2HFS A;  1ZTW A;  2HS3 A;  1Y3J A;  5ETL A;  3DRX A;  2PN6 A;  3KHG A;  3IC1 A;  4HTJ A;  4NLX A;  2KXN B;  2VJV A;  1R0A A;  1O6X A;  3OBI A;  4I7F A;  3TZW A;  3WQP A;  2VG6 B;  4QPT A;  4V19 J;  3DLB A;  1NDK A;  2OAU A;  4OLO A;  3G82 A;  5HBM A;  1QE1 A;  1UKU A;  3HO1 A;  2CVE A;  2YXL A;  3QT5 A;  5L46 A;  4PKD B;  4DR3 F;  4IFV B;  1G4C A;  4OI1 A;  4UY8 5;  2LXI A;  1D9A A;  1Q8B A;  4RLE A;  2CAX A;  1K44 A;  2DNO A;  4QIW D;  4OYB A;  5J2P A;  2UXB J;  4BWM A;  1FWP A;  1S1V B;  4JI0 F;  2FUG 9;  4LF5 F;  5AT1 B;  5DM7 Q;  3Q22 A;  2U1A A;  3A13 A;  3DOM B;  2KT3 A;  2FJX A;  3V6D A;  2VIC A;  1Q82 T;  7AT1 B;  2XMW A;  4DV0 J;  2FHK A;  1RT3 B;  2RDD A;  3Q8U A;  3CUN A;  2R7T A;  4C8Y A;  4QJV A;  4A8O A;  3UCG A;  1Q4R A;  3N6N A;  1OPZ A;  1S9E A;  4DR4 F;  3RRH A;  3QID A;  2MPU A;  4I64 A;  1AFJ A;  1EB0 A;  3UE2 A;  5HQM A;  4U95 A;  2QL5 B;  5LXR A;  4ZCL A;  3W61 A;  1NSP A;  2G2Z A;  3G71 S;  1TQL A;  2E5I A;  1FRH A;  4YB6 A;  2NRE A;  2C2E A;  2PMW A;  1N8R T;  3TAP A;  2N82 B;  1JLG B;  3DLK A;  4CO3 A;  1U1O A;  4JI3 F;  4A8Q A;  2I5J B;  2BJ3 A;  3W62 A;  3WDO A;  2C22 A;  3HFV A;  2PFD A;  3I87 A;  3MEE A;  3MUM P;  5JUM A;  3AOD A;  2E9T A;  3N6L A;  3PEH A;  3FGV A;  1LFW A;  2RQK A;  3M4X A;  2YWF A;  1P9Y A;  1HI1 A;  1HAR A;  4DL7 A;  1VRT A;  2YWG A;  4ZKA A;  2FVP A;  4OJH A;  3M32 A;  4UT4 A;  2ERR A;  1NK7 A;  1REV A;  2LEP A;  1S1W A;  2VC1 A;  3I9V 9;  2XQC A;  3CDW A;  1U49 A;  4QR1 A;  5F8J A;  4PPD A;  4AE5 A;  5KG0 A;  3RAX A;  3UN2 A;  3TAM A;  3PJW A;  3GPA A;  3ZZO A;  2IY5 B;  4QW8 A;  2BA9 A;  2CFX A;  5KG2 A;  3FZB A;  4LBP A;  4P9S A;  3NGR A;  3FMB A;  4JI6 F;  2XMU A;  1CUL B;  4USK A;  2ZJP Q;  3V6D B;  3D28 A;  4FYV B;  3EWG A;  4X4O A;  2BMB A;  1WC4 A;  4Y2I A;  4ZP7 A;  3B6B A;  3O3L A;  3KMS A;  2E9R X;  4GKJ F;  2FDN A;  2AN7 A;  1GK8 A;  1G3O A;  3D6H B;  1CJT A;  2FJD B;  2BKO A;  3C16 B;  1GXT A;  2V8H A;  4FXV A;  5CAA A;  3LP0 A;  3KJV A;  1HQ2 A;  5CCL A;  2ZVS A;  1HMV A;  4QW9 A;  4I69 A;  3AQO A;  4V1A k;  5K5M A;  3IRX B;  4C8N A;  1AW0 A;  3CWJ A;  3QOQ A;  4TXS A;  1TL5 A;  1LXJ A;  1VJW A;  4OX6 A;  1FK9 B;  1T9U A;  2QLW A;  2XSJ A;  1VQO S;  3TJ8 A;  1JKH A;  3P5T L;  1VBX A;  2ZH2 A;  4DV1 F;  2V6A A;  2B56 A;  3I5B A;  4P75 A;  3NGT A;  1WKL A;  4IO9 Q;  4ZA1 A;  1P1L A;  2VPW B;  3IAS 9;  5JXS A;  3W9J A;  2F4F A;  3M9O B;  3Q24 A;  3CC4 S;  2ZJR Q;  1U6B A;  1CLF A;  4C0H A;  4QU6 A;  1H73 A;  3CCZ A;  3DRS B;  3VF0 B;  2OH2 A;  4TY8 A;  2DYA A;  1D0E A;  3M1V B;  3KOA A;  4G1Q A;  1T02 A;  5F0W A;  3IRW P;  1MYL A;  2BAC A;  3FUY A;  2DHX A;  5F9N A;  3IWN C;  1Q16 A;  2F65 A;  1RTH B;  2P9E A;  3Q89 A;  4PG8 A;  2QFI A;  4DL6 A;  3IR7 A;  1S1V A;  5KFY A;  3T6B A;  4LRE A;  3DLE A;  3TEG A;  2BBE A;  1V6H A;  3GIJ A;  2Y0B B;  1F9H A;  4F8R A;  2P2C B;  5T14 A;  4OL8 A;  1BWV A;  1SCJ B;  3H0P A;  2CPE A;  1X9S A;  1VJQ A;  2YPY A;  1QSL A;  3CJK B;  2JL9 A;  1IBK J;  2MJU A;  3MXH P;  2PE8 A;  1SVD A;  2C3M A;  3IMQ J;  3K8W A;  1QJH A;  2FGO A;  3BM7 A;  3FBB A;  3VQS A;  1HWK A;  1CG2 A;  1WF2 A;  5BXI A;  1IR1 A;  1M5H A;  2GIF A;  1CJV B;  2ATL A;  2Y8W A;  2EI5 A;  3X1L B;  2C3U A;  2X3G A;  2HNY A;  3M6X A;  2FJB B;  3KG1 A;  2GVD B;  4YN3 B;  5K14 A;  5ADZ A;  2RRN A;  3V6J A;  2KOE A;  2FQQ B;  5KT4 A;  2Z2Y B;  1CUL A;  4BDP A;  4Q8F A;  1ZAW A;  5HJY A;  2OP5 A;  3OUY B;  4ECW A;  2H48 B;  3HHE A;  1TK5 A;  4NML A;  3DOK A;  2ZBI A;  1BD6 A;  4LT6 A;  5LMU J;  3QQC D;  4Y65 A;  4ED1 A;  1JX4 A;  3BO2 A;  4DJB A;  4C8K A;  3T1Y F;  2H4Y B;  4NLO A;  4PR6 A;  2JEJ A;  1U0H A;  3NAH A;  3DRP B;  4USM A;  1QTG A;  5E3C A;  3D54 A;  1HNI B;  5J1E B;  1YK9 A;  2HFV A;  4QYR A;  2CPZ A;  2MZJ A;  3FBE A;  4RW9 A;  4RW4 A;  3JSB A;  1HHQ A;  4A8Y A;  2PGC A;  3TVZ A;  1OJ4 A;  1CJV A;  2BUN A;  3NRB A;  5GAD I;  3CDU A;  4RU2 A;  3G6V A;  2KT2 A;  2LQ5 A;  4FF2 A;  1VBK A;  3B4D A;  3HI9 A;  3CCL S;  2PEH A;  4YQW A;  1GFW B;  2J5A A;  4RW7 B;  3CSK A;  3VAF A;  4Q44 A;  2HBR B;  1HLW A;  3DKD A;  3JQM A;  4I2P B;  2XMA A;  1MMN A;  1AB8 A;  2DNH A;  4KIA A;  3UN3 A;  4DSF A;  2OPQ B;  3GWC A;  1K47 A;  4HTI A;  5LMU F;  2F4V F;  3D6T B;  5IFM A;  1IJE B;  2Y1R I;  2LLZ A;  2QA4 G;  3KUE A;  1GAO A;  5K8P A;  1M5V C;  1UVN A;  4PG5 A;  5HL7 Q;  3EVO A;  3IR7 B;  1DUR A;  3S7R A;  1HD0 A;  5LJ3 Y;  2XY5 A;  3RBD A;  4Q43 A;  1HNZ J;  2WSF C;  4HL9 A;  3J7Z T;  4LF4 J;  2PA3 A;  3CCS S;  4NXN F;  3TA1 A;  5KOX A;  1ZPW X;  2HBQ B;  4RUH A;  2ZM6 J;  3D6M B;  5JJB A;  4NPO A;  3M2R B;  4TYA A;  3T6J A;  4J9U E;  4X62 F;  1HNV A;  3W8G A;  5IXU A;  4ED0 A;  1UPP A;  2CA9 A;  2H3E B;  1U6F A;  4ZVP B;  2RS2 A;  3GTY X;  3QGG A;  4ZJO A;  1NU4 A;  3DOM A;  3P5B P;  2KTQ A;  5KFX A;  2DGX A;  4F0H A;  2JBV A;  1KR4 A;  3EXC X;  3PIO Q;  2HFN A;  3AJD A;  5GAH U;  2CPY A;  2BDP A;  2XMK A;  2DKO B;  4FZV A;  3DM2 B;  4WTY A;  4Y6I A;  5D0G A;  3W65 A;  2WAQ D;  4IG3 B;  4KV8 B;  4X65 J;  1GMV A;  1KLM A;  2ASL A;  3ZTQ A;  4TQR A;  4M5M A;  5B0B A;  3KKF A;  4ECS A;  4KYZ A;  2WOM A;  4P52 A;  5BJR A;  2V4J B;  4MTP A;  1VLO A;  1CPZ A;  2CNL B;  1URR A;  4CLP A;  5LXY A;  1X7V A;  5KFP A;  3WX4 A;  4RW8 B;  4LF9 J;  1Z2Z A;  3HSD A;  1N5Y B;  2Z57 B;  4JI7 J;  1FFG B;  1NND A;  2AGO A;  2DH9 A;  3UVJ B;  3G8T A;  2LDY A;  2WON B;  2WW8 A;  2VD3 A;  2ZKT A;  3O5T B;  3K57 A;  4W4M A;  3EVM A;  1RP5 A;  3MM6 A;  5CYJ A;  5HVG A;  1OSD A;  3MED A;  3P6Y C;  4K5R A;  4J90 A;  3FBC A;  4BS2 A;  4B17 A;  2G13 A;  4LFA J;  2PI5 A;  4A8F A;  4QCL A;  2UXC F;  5I3U B;  1S1T A;  3HMJ G;  3T9Z A;  4I56 A;  3IR6 B;  3M6U A;  4WFY A;  4I6A A;  2PEB A;  1U4B A;  1FJG J;  5LSO A;  2YQ0 A;  4D8J A;  2VG7 B;  3CIM A;  3N4W A;  2VG7 A;  4DN0 A;  5KT2 A;  3G96 A;  5DG7 A;  3KTQ A;  4MMO A;  1CJU B;  3RUB L;  3HD2 A;  4C0B A;  2C2N A;  1NPR A;  5KFB A;  2B6A B;  3CC7 S;  4DV2 J;  1NH8 A;  2LXF A;  4I7F B;  1VQK S;  4GKJ J;  3IM8 A;  1FKP A;  1RT1 B;  2PA8 D;  3CJR A;  3GFH A;  3VZI A;  1FRK A;  3TZX A;  4DR1 F;  4OI2 A;  3FZ2 A;  3HD1 A;  5LSR A;  2VFU A;  4LUB A;  3FCW A;  1QDU B;  1PAE X;  2RS8 A;  2AY0 A;  1H72 C;  2QA4 S;  2W2Q P;  2HYI B;  4YHH J;  1X5O A;  2VQF F;  3I5A A;  3L95 X;  1OWX A;  1HNZ F;  4WFX A;  2DPJ A;  1XR6 A;  2V4Q A;  1VC6 A;  2YNG B;  2R9L A;  4DV6 F;  3CJT A;  1BXN A;  2OML A;  2AJF E;  3VGV A;  2JLF A;  1HWU A;  4H54 A;  4D3H A;  5DET A;  1SXL A;  1UJ4 A;  2FC8 A;  2QMU B;  3C6T B;  4MIW A;  1FRJ A;  4DPW A;  5AE2 A;  1Q1K A;  3OL6 A;  1VYA A;  2G9O A;  4J9Q A;  4OHX A;  2DIS A;  4NRU A;  2CPH A;  4OJ1 A;  5H1S V;  1KNZ A;  2QZ8 A;  1S76 D;  1IKX B;  1DQ9 A;  1SIZ A;  4USU A;  4YR3 A;  4FYW B;  3ZXW A;  1AYE A;  1XBW A;  2J9D A;  4QIG A;  3UNY A;  1UZH A;  3IGN A;  4LF6 J;  4JV5 F;  2QIF A;  4I1T A;  2V94 A;  2R7V A;  3P45 B;  1HPZ B;  2VKR A;  4ZCI A;  2I38 A;  4FYD A;  3KHH A;  3ENW A;  1HQU A;  3I0R A;  1WI6 A;  1T3O A;  2CQB A;  2D3U A;  2W2M P;  3H87 C;  1TMJ A;  2O1P A;  4IFY B;  4MYT A;  2LQJ A;  2CWK A;  3MHY A;  2BXJ A;  3R7B B;  4NAS A;  1TAQ A;  2KYX A;  1SPB P;  2KT5 A;  1OY9 A;  1WHV A;  1WF1 A;  2G2Y A;  4P2S A;  4FS1 A;  3PX0 A;  3AB4 B;  2E1M C;  3HVW A;  2Q6C A;  3RB0 A;  3G86 A;  1TK8 A;  4DUZ J;  5DLF A;  2CKW A;  2RE1 A;  2NR0 A;  2JRS A;  3KK2 B;  2CXE A;  1EET B;  2MSS A;  2P5V A;  4B3O A;  3H8Y A;  3H40 A;  3JAM U;  1PIE A;  1OG7 A;  1FDA A;  1M1G A;  2CQ2 A;  2I9S A;  3MMA A;  4HHH A;  1DLO B;  1RT4 A;  2OPS B;  1AUD A;  2HWH A;  1VQ7 S;  2XNR A;  2K9I A;  2QYC A;  4ZP8 A;  2IHR 1;  2VZ9 A;  3I6P A;  2BE9 B;  3AT1 B;  2JZ5 A;  4ZPB A;  3SQG B;  5C42 A;  4RZR A;  1N32 J;  3K17 A;  2MY8 A;  3MM5 A;  4RW6 B;  3BV8 A;  2R2R A;  2D41 A;  2H4W B;  1XNR J;  4PUO B;  1L3K A;  1RT6 B;  1LK5 A;  2AJ4 A;  3MUR P;  4ECT A;  3KJF B;  3C3L A;  4J9L A;  1WEZ A;  5HN0 A;  4DL5 A;  2Z2Z A;  4ZS6 A;  3OPK A;  3EJM A;  4WIQ A;  4MFB A;  2AWZ A;  3LH2 S;  5KFO A;  1FKA F;  1SKU B;  3DLL Q;  1RTJ A;  2ADL A;  2AKW B;  3W66 A;  4DLE A;  3JTO A;  4ERD A;  3EIC A;  4ZP6 A;  2HMI B;  3AOA A;  1B3T A;  2ZH3 A;  4KR0 B;  2F7V A;  3CF5 Q;  1UPM B;  3IG1 A;  1Q78 A;  4PXD A;  5IQQ A;  3QMQ A;  3W1Y C;  1K0T A;  1XK8 A;  4LRF A;  4WP8 A;  1S6Q B;  1WG4 A;  2IJN A;  4GO5 X;  1S1U A;  2HZA A;  4H4K C;  5E2Q A;  2W9C A;  3FRY A;  3G6E S;  1TFW A;  1FJC A;  2RF2 B;  2HIQ A;  3TQ1 A;  3J7A N;  2BX6 A;  1Z2L A;  3PTW A;  1GH8 A;  2EVZ A;  1RHK B;  3RJM B;  1ZH5 A;  2B9E A;  3CJK A;  2PT0 A;  2R7O A;  4JI6 J;  5EN1 A;  5IT9 Y;  2ASD A;  5HP1 B;  4ZPW R;  3LJP A;  1ZM4 A;  2A0F B;  2F63 A;  2WZ1 A;  4TKT A;  3KLF B;  2EFP A;  3WIV A;  2K6L A;  3H5S A;  4MK7 A;  4RO0 A;  2AF6 A;  4DS4 A;  2IVM A;  2XS5 A;  4QYZ K;  3OTB A;  3FSI A;  4PYA A;  1KOO A;  1UEV A;  3NG8 A;  3UNG C;  1ZA1 B;  3OVB A;  2Y9H A;  2FB0 A;  1Y3K A;  3HSZ A;  1JJC B;  2C2R A;  1ZET A;  2QO3 A;  3ULH A;  2OLW A;  3NBP A;  3KDO A;  3MCN A;  5HSP A;  2OEL A;  4ZPV R;  2NQP A;  1VCT A;  2JDJ A;  3NGU A;  1OO0 B;  1DJ0 A;  4DV3 F;  1WOO A;  2H54 B;  3N28 A;  4K4X A;  2HHU A;  2XZT B;  3KUH A;  2XLK A;  2F8H A;  4IFY A;  4RNF A;  2ZH1 A;  2MYF A;  3IBF B;  3ILO A;  3MAQ A;  4B9L A;  2XEX A;  4TN2 A;  2UXD F;  2NPI A;  3JSY A;  4NOH A;  4USW A;  1XMO F;  4NZ7 A;  4DPO A;  1UWB A;  4URS A;  1KON A;  4ED7 A;  3Q2T C;  4RWW A;  2HND B;  2AW0 A;  1LW2 B;  3BF4 A;  5CYQ A;  4RUC A;  1IKV A;  1LWF A;  2VV5 A;  4K7Q A;  2FYX A;  1O51 A;  1SV5 A;  5H9F J;  5F8G A;  3K5N A;  1YBA A;  1IBL F;  2FVR A;  2AZ1 A;  4YY3 J;  1HIY A;  2H3A A;  3MMA B;  1TTH B;  4UST A;  2XM3 A;  1YHQ S;  2PDA A;  2YNH A;  4C3K A;  1C1B A;  3HPO A;  4C4W A;  4NCB A;  1U8S A;  3D67 A;  4KBI A;  4DR4 J;  1HBU A;  5ETN A;  3H2U B;  1Y11 A;  3AJ1 A;  2NPF A;  4YFU A;  5EHH A;  1O5J A;  1FE0 A;  2MZ1 A;  4PG6 A;  3NCP A;  2QE5 A;  1ELO A;  3I96 A;  3M1V A;  1JJ4 A;  4OZ2 A;  4DSJ A;  5A2Q Y;  1DFD A;  1BUX A;  2DNY A;  4XAK A;  1F9F A;  1UVL A;  2L9D A;  4U96 A;  4ECQ A;  1PGZ A;  1EJ7 L;  5HAT A;  4H4M B;  2E1C A;  2XZD B;  5JVH Q;  3G5O A;  3CTR A;  3J7Y I;  4Z37 A;  1S6P B;  4Z7Y A;  3D68 A;  3K59 A;  1B4S A;  3DI6 A;  5AE1 A;  5DG8 A;  3ILJ A;  4KGK A;  4B9M A;  4L74 A;  1C1B B;  1RUS A;  1SKR A;  4P2F A;  2UVV A;  1NK6 A;  1UCN A;  4OIX A;  2F5G A;  1FFS B;  1RWP B;  5KT3 A;  3HVT A;  4QYZ J;  5CD4 A;  4IG3 A;  1WEL A;  1I6J A;  4JI1 J;  1QSS A;  1VI7 A;  1Q0N A;  2J9C A;  2GAG C;  2NXN A;  2VA3 A;  3O2I A;  4C8Z A;  3GR1 A;  3BQ1 A;  3HF5 A;  2AJ1 A;  5B7W A;  1ZTT A;  4E8U A;  2WVD A;  3QGH A;  1AXQ A;  5L1L A;  4K4T A;  3PVX A;  1QM9 A;  1T7P A;  1N5V A;  2HQF A;  2HHV A;  3V6H A;  1Y5I B;  4DF4 A;  1FKO A;  3OT9 A;  4KRW A;  1EET A;  4HHJ A;  5BYS A;  4MH8 A;  4DV3 J;  3TZZ A;  5E33 A;  4URQ U;  4NCG A;  4AT1 B;  1M5P C;  2MKS A;  1FE4 A;  4QWB A;  2APO A;  5IOL A;  3U7J A;  4LF6 F;  4CH0 S;  3PYE A;  4ZLN A;  4N8O A;  4JI2 J;  3QWP A;  3MZI A;  4Q2L A;  1XMO J;  2J8S A;  2V63 A;  2B8Q A;  4HVZ A;  4KSE B;  4M5K A;  5CH7 B;  2UXD J;  3W2V A;  1XN9 A;  2GIR A;  4Q45 A;  2FHM A;  1AUS L;  4L6V 3;  1IR2 A;  3QO9 B;  2D3O R;  1FXR A;  1LOU A;  3MR3 A;  2BAB A;  2KO1 A;  1B64 A;  2MZR A;  3FVY A;  1DTQ A;  1S9G A;  5H9E J;  1G7C B;  3HHL C;  3ZTP A;  4LF1 A;  1T94 A;  1U1M A;  1HNV B;  3EGW B;  1NJY A;  4AL7 A;  1S48 A;  4IFV A;  4X2B A;  2YWK A;  4GVL A;  4NI2 A;  5HVF A;  4LBI A;  2C2D A;  3KLI A;  5IC6 B;  4ZIW A;  4EEY A;  4KHR A;  2ZOM A;  3ICL A;  1SQE A;  4OLP A;  2B9Y A;  1EIY B;  1XTZ A;  1Y7P A;  5HRO A;  4IRD A;  3ZZZ A;  1IRQ A;  2GML A;  4OI6 A;  5EWF A;  2P8I A;  1NJW A;  3ET6 A;  3IG1 B;  3DDK A;  3Q8V A;  4OZ1 A;  2YTC A;  3SQO P;  4DQP A;  2AX1 A;  2OPQ A;  1VK3 A;  1IBM F;  3MD1 A;  4CIO A;  4LQ9 A;  3QZ7 A;  2QV6 A;  2ZH4 A;  2VDI A;  2EFN A;  2FGC A;  1WSR A;  2HVE A;  2ZDO A;  3IWX A;  4KGV B;  5F41 A;  5L38 A;  3SZ2 A;  2XG8 A;  5LT5 A;  1GXL A;  1OPI A;  2HSE B;  1HBO A;  1DAX A;  2W4P A;  3TR5 A;  3Q8S B;  2X3D A;  4FXD A;  3SSQ A;  5KFM A;  4GRS A;  2W01 A;  1RU2 A;  2R8K A;  3GR0 A;  4IH6 A;  4B3M J;  2IM2 A;  2RHQ B;  3G8Q A;  4UOG A;  4BBY A;  2OIH A;  2D7S A;  5D4L A;  4R5P A;  2E5H A;  1RLD A;  3E8O A;  4AYB D;  1NHU A;  2WBR A;  2J6S A;  1K0V A;  1Q86 T;  3ITH A;  4FPR A;  4IKA A;  3TEH B;  4LF4 F;  1WUU A;  5HJX A;  2QG9 B;  2N3O A;  2HAI A;  1MWY A;  1F3F A;  3ETO A;  3IM9 A;  3ZO7 A;  4J9R A;  1NCL A;  3QIP B;  2LDI A;  1MLA A;  3N6M A;  4LSL B;  2BRK A;  5E41 A;  2XY6 A;  2X1F A;  2A6M A;  2LU1 A;  4FVC A;  3HHL D;  3DLE B;  4P7T A;  3ZFV A;  4HLB A;  1EAR A;  2CPG A;  2VQE J;  1SIW B;  2XBP A;  3SIP B;  3M6V A;  4B3O B;  3AD9 C;  4HDG A;  4I2Q B;  4YB5 A;  1NB7 A;  1RT5 B;  4LFB F;  3GXQ A;  3SCL E;  4CNY A;  3TA2 A;  3PR4 A;  3ENV A;  2DCU B;  3UD3 P;  1P6T A;  3M2V B;  2GNK A;  4YUD A;  2JXH A;  1TUG B;  1DHM A;  1RGV A;  1FD2 A;  2V9K A;  2W9B A;  4X64 F;  1KD1 T;  1S0V A;  3I0S B;  4KPC A;  4USJ C;  2M4M A;  4KO0 A;  4DU8 A;  5GAG U;  2DIV A;  1N56 A;  1KTV A;  1SV5 B;  4P2X A;  2KRB A;  2GV1 A;  1JNR B;  1EKR A;  2CDR B;  5T7L A;  2R42 A;  3T19 A;  4F0K A;  1X4F A;  3ITH B;  1LW2 A;  2LP4 A;  3TUI C;  2P6T A;  3QPI A;  4OYA A;  4L72 B;  4OYP A;  2QSW A;  3DNC A;  3LUY A;  4ZK7 M;  5HQL A;  1VDH A;  2W8K A;  2ILZ A;  1UA1 A;  2EPI A;  1C0U B;  4ID5 A;  3ISN C;  2W9B B;  1BE4 A;  2AJ2 A;  1VRU B;  4DR6 J;  1TV6 A;  3M8S A;  2GAH C;  1NKB A;  3IR5 B;  5HMZ A;  2K7J A;  2EFQ A;  1XNQ F;  4B02 A;  4JI2 F;  5LMN J;  1TL7 B;  1RWV B;  4CT8 A;  1C0T A;  3D6F B;  3FFI A;  3OFE A;  3THV A;  1KS2 A;  1RKJ A;  2GX8 A;  2LA6 A;  4PXC A;  2ASJ A;  3GSI A;  4QOT A;  1TKD A;  2D74 B;  2CZV C;  4IDK A;  1JLC B;  2MJN A;  4AQY F;  3LPE A;  3PY8 A;  1RI7 A;  3TAR A;  4Y2A A;  2BJD A;  1HWJ A;  5IV3 A;  2ACM A;  4F4Z A;  4F4Y A;  3M9M B;  1FT8 A;  4R5P B;  2MHN A;  1NKE A;  1CS4 A;  1H0H B;  1REV B;  2IIH A;  2C2Z B;  3GJS B;  4KKO A;  1S4F A;  2XLJ A;  2MQN A;  3KJV B;  4BCA A;  1ULR A;  3N01 A;  2N7Y A;  4O44 A;  5KG4 A;  3TNV A;  4AND A;  4YR0 A;  4ANE A;  3CCJ S;  3MEC B;  3LAN A;  4LF2 A;  3VQT A;  4DQQ A;  4QQB A;  4DN9 A;  5DG9 A;  4HAC A;  1VQY A;  2BOA A;  1DTQ B;  1S9G B;  2FY8 A;  1S1U B;  3C8Y A;  2XO6 A;  1S6Q A;  1WC0 A;  5L1I A;  2UP1 A;  4YB1 P;  2RKI A;  4TLQ A;  2UUW A;  2V67 A;  2E5L F;  3NOG A;  1YIJ S;  3FRZ A;  4CYU B;  1VRQ C;  5DZ6 A;  4RR5 A;  5K8N A;  1YG0 A;  2BRL A;  3DRS A;  2W9A A;  1JLB B;  2LXU A;  4MIB A;  3BO3 A;  1U1L A;  4CCH A;  4DL0 C;  4JI3 J;  2XY7 A;  1T8E A;  3JQK A;  1YLX A;  1WEY A;  2M70 A;  4LFA F;  3HZE A;  4NCG B;  1UFL A;  4TLR A;  1U6Z A;  2DXE A;  2HQC A;  3HFZ B;  2I6W A;  2R8H A;  1FK9 A;  3NKY A;  4PQA A;  5A8W A;  1P8G A;  3GFX A;  4A46 A;  5THW A;  1CVJ A;  1Q8K A;  3I4P A;  1PJ5 A;  2NSB A;  5DGA A;  3RR8 A;  3GV8 B;  1V3R A;  4JI8 F;  1DY3 A;  1DTT B;  1SC4 B;  1FRL A;  4NLY A;  1IWA A;  2EFO A;  4KGZ B;  2BAN A;  4J5O A;  5E5N A;  1S10 A;  2LKZ A;  1LEO A;  5J2N B;  1L3S A;  4F4X A;  2AYM A;  4ICL A;  4RBV A;  4DG1 A;  3QSY B;  2FHJ D;  1V9O A;  3PV8 A;  1BLU A;  3NO7 A;  4UQT A;  1JLQ B;  4WWS A;  1N88 A;  4WFN Q;  5G0R A;  1TEL A;  3BQ0 A;  2O67 A;  4JYA F;  1S1X A;  3R5A A;  3L7P A;  4JI5 J;  1VMB A;  3CGI A;  5GAD U;  5D78 A;  1SC3 B;  4ES1 A;  4UZB A;  2GQQ A;  3GB0 A;  1NM2 A;  1RT3 A;  3DDI A;  2CPD A;  4CZC A;  4ECY A;  2DR9 A;  3HJV A;  3H5U A;  2BE2 B;  1RBO B;  2IVF B;  3UO0 A;  1VOM A;  3LF0 A;  1KQK A;  4ELT A;  4O0I A;  2DGS A;  4C3M A;  1IN0 A;  3VAK A;  2NLW A;  1FKP B;  1FFW B;  2X1G A;  5C5J A;  2AHO B;  5BYQ A;  5AXM A;  2LU2 A;  5KFL A;  2GCF A;  3TOQ A;  4U8V A;  3WBZ A;  2ZZT A;  1ARR A;  3VAH A;  4MK9 A;  2KFZ A;  5KG5 A;  5CZV A;  2L9N A;  4YOE A;  2FHO B;  2DIT A;  2K5J A;  1P27 B;  2HQD A;  5KOW A;  3OV7 A;  3T5K A;  1FWK A;  3T5H A;  1VQP S;  3MEK A;  1EQ0 A;  3JAM Y;  3QLH A;  4ZHR A;  2G1D A;  1HI0 P;  2ILY A;  5K20 B;  5KFU A;  4ALZ A;  4UQG A;  5DGB A;  3E51 A;  4DFK A;  2G0C A;  1ZOT A;  4ZP9 A;  3MPU B;  3NGD A;  3G6Y A;  1QSY A;  2DTJ A;  2DR6 A;  2XMM A;  4ZLL A;  4OYZ A;  2YQ1 A;  1H2V Z;  2DBB A;  2G0J A;  2NXJ A;  2VBX A;  3PG9 A;  4O3Q A;  4ZJQ A;  1LXN A;  1EKS A;  3DDN A;  5CQG A;  1EAY C;  2ZC4 A;  3WZ0 A;  2ZBR A;  5EDW A;  3T1Y J;  2WW4 A;  4F02 A;  3FK4 A;  3NBP B;  2I8E A;  1HWL A;  4ECZ A;  2DH8 A;  1RWX B;  3GG0 A;  3Q83 A;  3K7R A;  4YHH F;  2AIR B;  3O6Q A;  8AT1 B;  2QTW A;  3HSJ A;  4K4S A;  4ICL B;  3VGS A;  3MMJ A;  4CLZ A;  1FNX H;  3G82 B;  4ZPA A;  1S72 S;  3LW5 C;  4F4W A;  2CWX A;  3V81 A;  4FXW A;  4ZVE A;  1O0P A;  4I2P A;  3NEK A;  2DRB A;  3MM6 B;  2NXC A;  4X4R A;  1PSD A;  4GO7 X;  1NDL A;  1S12 A;  1X4A A;  2DD8 S;  1SH2 A;  2NYI A;  3SV4 A;  2DNM A;  2VHG A;  2HVD A;  4JI1 F;  1WWH A;  2ACY A;  3HHN B;  4C3L A;  3K5L A;  3CC2 S;  3CE8 A;  1TL7 A;  3GQC A;  3GFZ A;  3B54 A;  2B3T B;  3MAA B;  3HSG A;  2W9C B;  1S7H A;  1JQG A;  2RB7 A;  1FVS A;  1LKZ A;  1S0N A;  4IO1 A;  1S9E B;  4WE1 A;  4DPY A;  4XDC A;  2R8G A;  2RVJ A;  3NY0 A;  1MNT A;  1NZ8 A;  2NYH A;  1MN7 A;  3RRG A;  1YJU A;  4JV2 A;  3ENA A;  2IRY A;  3NOC A;  4ANC A;  4R8U B;  1GMU A;  3QRQ A;  4DX8 H;  5IT9 U;  4MKB A;  1U2R A;  3OW2 R;  1C4A A;  1PIL A;  1RSC A;  4P6Q A;  2KKH A;  2R4F A;  4ILM A;  3PHT A;  4JV0 A;  3NAI A;  3MUT P;  2JEI A;  3A3P B;  3WIU A;  4AXI A;  1RHR B;  3RYL A;  2CNK B;  2EKN A;  4K8R A;  5AXL A;  3R6L B;  4PG7 A;  4A8K A;  2CQH A;  4X4T A;  1HYS A;  3EZU A;  2FZC B;  4ZPD A;  4FF4 A;  1BY9 A;  3HKW A;  1HMV B;  1KQS R;  2KB2 A;  2DNL A;  2DGV A;  3O8W A;  2B7B B;  3EM1 A;  4C48 A;  3VAM A;  3B4M A;  1U48 A;  2UUB J;  4NX9 A;  1NSK L;  2RF2 A;  3M2R A;  1H2T Z;  4DMZ A;  4DR7 J;  4CO1 A;  1FER A;  1LWX A;  3LGM A;  4CO2 A;  3KG0 A;  1TK0 A;  4IOB A;  1B0V A;  3PYF A;  1JNZ B;  1RAI B;  4DSK A;  3KLG A;  1HNI A;  2G1H A;  2XHC A;  2JLG A;  4IRC A;  4P10 A;  2E5G A;  2HHQ A;  4CP5 A;  2ZJQ Q;  1M1H A;  2V2K A;  1T95 A;  1S4E A;  1ZS6 A;  4GVB A;  4C7Q A;  4U67 Q;  2JWN A;  4GMK A;  1RTJ B;  1APS A;  2CQ3 A;  3N79 A;  2QA2 A;  1YJN S;  2VA2 A;  4YP3 A;  1REG X;  3OL8 A;  4ZIT A;  4S0M A;  1NHV A;  1OQ6 A;  4JUZ A;  2UVU A;  3Q23 A;  2Z58 B;  3CXC R;  4HAC B;  1N5S A;  1VRT B;  1TL3 A;  1HNW J;  2YKN B;  2JFK A;  2ZBC A;  2Q1L A;  1LWC B;  3D3B J;  3M8R A;  1IKY A;  1TKX B;  2BKN A;  2BSQ E;  2XGP A;  3JSM A;  1WTF A;  2ZBQ A;  3C14 A;  5KFR A;  3F41 A;  4HT7 A;  4C97 A;  3IN5 A;  2H5J B;  1FD8 A;  4LIR A;  2MQP A;  1MW7 A;  1T9Y A;  1U0S A;  1FWL A;  3BSC A;  3TW0 A;  2WTF A;  1KVI A;  1WDD A;  2DO0 A;  4FVM A;  3C15 A;  3GFY A;  4ECU A;  2HWI A;  2KJW A;  4IOA Q;  1D1U A;  3AY0 A;  2XCP A;  2ZHO A;  3BBB A;  1TZ0 A;  4IH5 A;  3PJX A;  4FDF A;  4DUY F;  2HZV A;  1SQG A;  3OFG A;  1YVF A;  2FLL A;  4IR1 A;  4OI0 A;  3MM8 B;  4RNH A;  3DHX A;  2B4U A;  4XO0 A;  5DDR C;  3FCH A;  2MLX A;  4FBU A;  4PQU B;  1YBT A;  3KWM A;  2IC3 A;  1SIW A;  4D3G A;  3GON A;  2RDI A;  4A47 A;  1YZ6 A;  2GMJ A;  2R7Q A;  4Y2K A;  1C0U A;  2WVC A;  2ALZ A;  3VTI A;  1WTB A;  2RSQ A;  1HQU B;  3I0R B;  4TVA B;  2FJE B;  3S6E A;  1MN9 A;  3I55 S;  1U9P A;  5KFC A;  3HK2 A;  2W7O A;  2ZOG A;  1NPK A;  1QLN A;  4JI5 F;  4HEA 9;  1NSQ A;  1CJU A;  3MF5 A;  3NS6 A;  5G0R B;  3RAQ A;  1AA1 B;  4X62 J;  3QRP A;  5EX3 A;  2N7C A;  2MQO A;  1JKH B;  1L3V A;  9ATC B;  4B08 A;  5T7L B;  3OFF A;  2IBK A;  3DOL B;  2CQD A;  1R8B A;  2GC8 A;  3IXQ A;  5A8R B;  3NMR A;  2DK2 A;  2ZEJ A;  2N4C A;  2HFO A;  3H5X A;  3MFH A;  2HK2 A;  2G0I A;  2X1A A;  1Q16 B;  1GT8 A;  3OTE A;  1GXU A;  1X4G A;  2VPX B;  3R2D J;  1FRI A;  2HRY A;  1BMQ B;  1FDD A;  2Q79 A;  2YNG A;  4QZV B;  2ADB A;  3FSY A;  3MWB A;  2UUT A;  4MAK A;  2PFF B;  4B3M F;  4NLT A;  1XMQ F;  3TUP A;  4OFZ A;  1NAQ A;  4KJI A;  1FA0 A;  4LFC F;  3ET6 B;  5ETR A;  4A48 A;  5KFJ A;  4OHY A;  4M5H A;  2PC6 A;  3WHI A;  3G4S S;  1RA7 A;  2BVZ A;  4RW8 A;  3BYR A;  4CT9 A;  4X4N A;  1Y5L B;  4USV A;  1I5O B;  3R5G A;  1TUV A;  2I1R A;  4LRD A;  1FNM A;  1WOS A;  4OHZ A;  4ECV A;  4M95 A;  1TKT B;  3V81 B;  4CYU A;  3J80 Y;  1WC5 A;  2BKP A;  4L3K A;  5LOQ A;  2GMH A;  4RNN A;  3FBF A;  2KG1 A;  2PSZ A;  3DM2 A;  4MIA A;  1NEE A;  1CQM A;  1YGY A;  1HFE L;  4LRB A;  5JVG Q;  2R7U A;  2ZOF A;  4QR0 A;  1S1T B;  5T41 A;  4F26 A;  1XJW B;  4LSZ B;  1KFS A;  2EXU A;  3X3U A;  2FLN A;  3KFW X;  3E01 B;  2LVW A;  3QAE A;  4USI A;  3CVK A;  4ZVH A;  4WII A;  3GV7 B;  1NSA A;  2DNZ A;  2K1R B;  1RIS A;  2E7W A;  2FZK B;  4KE5 A;  3ISN D;  3TAM B;  1U02 A;  3GU0 A;  4CH7 A;  3UVJ A;  4WTO B;  3KLH A;  3Q2S C;  1PC5 A;  5M2R A;  1PYS B;  3NMA A;  2W2N P;  5F3Z A;  4ID8 A;  1FCA A;  1H98 A;  5DO2 A;  1KEK A;  3LOU A;  5B0A A;  1UVI A;  2JJ4 D;  3UD4 P;  1X4B A;  2XUL A;  1JLB A;  4ZVG A;  1MMD A;  3HFK A;  3WX8 A;  4DL3 A;  1HW8 A;  2LCW A;  1PBU A;  3GIR A;  2C28 A;  4DV6 J;  2LEB A;  5CAB A;  3V4M A;  3U27 A;  3BZQ A;  1NLK L;  3RW6 A;  1T9T A;  4FNH A;  4PPZ A;  2FJV A;  2KHC A;  2DR7 A;  1LK7 A;  2I5J A;  2OEK A;  3HT0 A;  3M2U B;  4DX6 A;  1Q8I A;  2VBW A;  1L3U A;  5KG1 A;  1QAI A;  1HA1 A;  3QSI A;  3GSD A;  2YX7 A;  2BJE A;  1JLA A;  4W98 A;  5EX0 A;  1LFP A;  1X4H A;  4CLT A;  4JI8 J;  1WF0 A;  3MOJ B;  3N0V A;  3ZZY A;  1RE1 B;  1QE1 B;  2VFT A;  1F1B B;  1Y4Z B;  2GHW A;  2JVO A;  3I82 A;  5GVQ A;  1NJZ A;  3GP9 A;  2DB1 A;  4DSE A;  1FJG F;  1YZ7 A;  2DPI A;  3CCT A;  2ZWP A;  2E5L J;  2IMO A;  4WF9 Q;  3LQV A;  3TUJ C;  1VR6 A;  1VBY A;  2FPH X;  5KFD A;  3R97 A;  1SH3 A;  5I4M A;  5EUH A;  4JYA J;  4UF4 A;  5MAO A;  2J0Q D;  2YNI A;  1VIX A;  4L76 A;  3BBF A;  3OUY A;  2BOP A;  2YX4 A;  4KY3 A;  2I2Y A;  3BKT A;  2PMZ D;  2GHP A;  5K14 B;  4DUZ F;  4MJK A;  1RYR A;  1Q5Y A;  4ZCM A;  4M5I A;  3FMT A;  3JXO A;  4ZMM A;  2GW8 A;  1WI8 A;  1ACM B;  3OTO F;  2G4B A;  3R5C A;  2HFU A;  4J9P A;  1W2B R;  2ZKU A;  1DTT A;  2O01 C;  1F6T A;  2EWH A;  5D15 A;  4DV5 F;  3BDP A;  5B0G A;  2YKP A;  4FYX B;  1F5C A;  1K1Q A;  2GVZ A;  3JTP A;  5AJ3 F;  1VHI A;  3IA0 A;  5A8W B;  2DRD A;  3A1Y G;  1KHW A;  5DQG A;  2QMX A;  3D0H E;  3I9Z A;  5EGY A;  3OTO J;  1IBK F;  2M8D B;  4I67 A;  4ETX A;  3CMA S;  1ARO P;  1V3Z A;  4X4P A;  1OYE A;  4NZ0 A;  3BPD A;  4JI0 J;  3S01 A;  4DCO B;  1FRM A;  2PII A;  2Z2L A;  5MLC V;  1RT7 B;  3CW2 C;  3DGV A;  4XDD A;  4FNI A;  5B0C A;  4N41 A;  2L41 A;  3UDC A;  4CLY A;  5IM0 A;  1S49 A;  4DR2 F;  3MI7 X;  3V5R A;  2C2O B;  2VL1 A;  2KVQ E;  3DOK B;  3P96 A;  4DFM A;  2HNZ B;  3BR9 A;  2KFY A;  3BGO P;  2MXY A;  4K0K F;  3PW7 A;  1RWK B;  5ETP A;  4KGX B;  3VCD A;  3F73 A;  3LAM A;  1X5T A;  4I2Q A;  3THP A;  1H7X A;  2ZBP A;  1SH0 A;  1MWQ A;  2OI2 A;  2SXL A;  2RU3 A;  2RUS A;  5D0H A;  3MEC A;  5F3T A;  2F1F A;  1B01 A;  4LSL A;  1KDN A;  1JXL A;  2D69 A;  1T05 B;  1FHT A;  1V5I B;  3AA9 A;  1FO1 A;  3LP2 A;  2RBF A;  4B3R J;  4G3I A;  5K8O A;  1XER A;  3D0I E;  2RD5 C;  1R0B G;  2WCX A;  3L4B C;  4DR5 J;  1T03 A;  4KH0 B;  3OL7 A;  1NK9 A;  4M5L A;  4IDK B;  3BDE A;  3EE3 A;  5FDL A;  5A0Y A;  3W60 A;  1TMM A;  2IAJ A;  4Q8E A;  2COL A;  3FKB A;  4ECX A;  2IDL A;  3PEJ A;  2V9W A;  3Q86 A;  4P73 A;  3J80 U;  3H98 A;  4DUT A;  1NK8 A;  3A4T A;  3EX7 B;  3W5X A;  2CQP A;  5L9N A;  2GHV C;  2CPI A;  1FDN A;  2XZW A;  4WU3 A;  2AGP A;  4GKK F;  3F56 A;  2AEF A;  3NS5 A;  2YNI B;  3NS7 B;  4WP9 A;  2B4V A;  2UZA A;  4WFB Q;  4Y2C A;  2JFD A;  2D9O A;  4RBU A;  2HMI A;  4QPX A;  2YNF A;  1UL3 A;  3US5 A;  2ZHA A;  5IT4 A;  4LFB J;  1TL1 A;  4KH1 B;  3H2V E;  3QJL A;  1YTY A;  3JQJ A;  1CJK A;  3UPF A;  1MRO B;  1D9D A;  4RL1 A;  1M5K C;  4OV6 A;  3NGK A;  1S1W B;  2KYZ A;  1T9V A;  5KFA A;  3TA0 A;  2XYP B;  1F5A A;  2M0G B;  3H7H B;  5G4D A;  3VEA A;  5B09 A;  1HD1 A;  2UUB F;  3KK1 B;  4PXB A;  3I56 S;  3IBW A;  2FJA B;  3A3O B;  3L7U A;  4NYP A;  4NI2 B;  1B99 A;  1FDB A;  2OPP B;  3MM5 B;  2HQI A;  4RW6 A;  3TO8 A;  4ZPC A;  2OPR B;  1CJT B;  2HS4 A;  3CDE A;  4WFZ A;  4XPE A;  5A6P A;  3LP0 B;  3MEE B;  4N77 A;  4GC7 A;  2KH9 A;  1OMS A;  3FT7 A;  3MR7 A;  5A6W A;  3AHP A;  3TAQ A;  3MTK A;  2HVZ A;  4HI2 A;  1NPP A;  5E3P A;  2KM8 C;  2Y1J A;  2DNG A;  2HQ3 A;  3QO9 A;  2YWE A;  1LWE B;  1UAW A;  3RGI A;  5GAG I;  1EX8 A;  3NGS A;  3W2W B;  2LQ9 A;  4WKY A;  5HMX A;  2QLB B;  2ZFH A;  3DLJ A;  4BHQ A;  2XWY A;  3QFH A;  1LW0 B;  3BSA A;  1CJK B;  2C3P A;  3OHB A;  5HLF B;  4UZC A;  2BW2 A;  1S0O A;  4I6W A;  1U8W A;  2V8P A;  2AZ3 A;  1XNR F;  2Z4P A;  2YKM A;  4OZJ A;  1UEK A;  5GAE I;  3LP1 A;  3MOZ A;  2KKE A;  1X4E A;  1X60 A;  2HRT A;  1TKZ A;  4FN5 A;  5B0D A;  5DM6 Q;  4KHP J;  4PAB A;  2VIH A;  3P49 B;  1R43 A;  3AH6 A;  5JMN A;  4JBC A;  2CJY B;  3JTN A;  2VG5 A;  1J5O A;  1HNX F;  4DHV A;  2HLU A;  1RT6 A;  2N4D A;  3FEZ A;  4URG A;  2HGL A;  3R2C J;  2VFV A;  1M5O C;  1PJ7 A;  5SZT A;  3H2L A;  2ZDP A;  2DEJ A;  5K9F A;  3ELH A;  2RU9 A;  4IG0 A;  5GMD A;  4YDD B;  3EPG A;  1J5E F;  2DR5 A;  1U2F A;  1N0V C;  2G2O A;  4PYD A;  3D66 A;  2R7R A;  2V8D A;  3CNQ P;  3DU6 A;  3HVT B;  2OPS A;  4NYZ A;  3T9N A;  2MGZ B;  3SI8 A;  2HHH J;  1B7F A;  2CDQ A;  1OIA A;  1S99 A;  3GCW P;  4N47 A;  2M3D A;  1N33 F;  1KRP A;  3JSR A;  1RAB B;  1S5Z A;  2W4D A;  3D3C J;  3U1L A;  3CCE S;  1BAZ A;  5HLF A;  4J9V A;  2BM1 A;  5GME A;  1X93 A;  2MQM A;  2YX1 A;  4USH A;  5KFK A;  3N9U C;  1GMW D;  2P9G A;  3Q8Q B;  1Y00 A;  3BGR A;  1NJI T;  1N36 J;  2LFV A;  1RA6 A;  3P4U B;  5KT5 A;  4J9M A;  1XEZ A;  2KFN A;  3UW1 A;  3KLI B;  5IQ6 A;  1AFI A;  4MK8 A;  3VGU A;  3BN4 A;  4XK8 C;  3PYG A;  2VH7 A;  3VZH A;  5KFH A;  1R89 A;  6AT1 B;  2LMI A;  2Q2K A;  3EDQ B;  2DY9 A;  1ZPV A;  5KG3 A;  4DR5 F;  1SC6 A;  3N5F A;  2LQ8 A;  3RBZ A;  2ADC A;  2ALY B;  1X9M A;  3QJP A;  3RZA A;  1UJ6 A;  1FRX A;  5KFS A;  3J7Y U;  2UUC F;  2HZC A;  3IFE A;  1PG5 B;  3CO0 P;  2QL7 B;  4UOH A;  3H90 A;  5E0O A;  3W2V B;  4WFA Q;  4XIU A;  2YH0 A;  3H25 A;  1UA0 A;  2ZZM A;  4Y34 A;  2OD6 A;  4M5N A;  1R0A B;  4JP8 A;  2OTL S;  1Q79 A;  2B51 A;  2VG6 A;  4NMX A;  1KP6 A;  2JX2 A;  1S79 A;  1LW0 A;  1YBU A;  3DGP B;  2WON A;  1I94 J;  3HHD A;  2Q6B A;  4FKY A;  1VQM S;  1R8A A;  3M2V A;  3MPV A;  4DL4 A;  4M5D A;  3AA8 A;  2IPO B;  4OZ5 A;  4UW2 A;  2HBY B;  2ZNZ A;  4WYL A;  3S8S A;  2AX0 A;  2H9Z A;  2Z0G A;  1RT2 B;  1WOR A;  3CJ3 A;  1UFK A;  4A8X A;  4DWI A;  2MKK A;  4HR2 A;  2BEF A;  4RW7 A;  2QLX A;  2V4J A;  3BO4 A;  3C2P A;  4EO6 A;  4WP3 A;  3EXY A;  1BQM A;  1EQM A;  4CM0 A;  4KHP F;  2CPF A;  2VOP A;  4OX8 A;  3FNN A;  2K8G A;  3TX0 A;  1U2C A;  2ZE2 B;  1HBM B;  1KFD A;  2BYC A;  3DXB A;  2UUA F;  1T05 A;  4LR9 A;  4RW4 B;  4RW9 B;  3C46 A;  2IBO A;  4R0E A;  3T1H J;  4B3S F;  4DFJ A;  2CJB A;  2ZWO A;  3GG1 A;  1KQG B;  3GYX B;  2ZH7 A;  1U1Q A;  3QRR A;  1J2V A;  2CQC A;  2QLJ B;  1KKH A;  1K1S A;  1GX6 A;  4NEY A;  3PHE A;  3MR6 A;  2OMO A;  3AXK A;  1SC1 B;  4H4M A;  4ZVO B;  2MHE A;  3AFG A;  3PRB A;  2CZ9 A;  1R8C A;  2CRL A;  2M5Y A;  2OTJ S;  2N3L A;  4ZVT B;  2R2S A;  2O3D A;  1E6Y B;  4PQU A;  3K0J A;  1WSV A;  2O5D A;  2DGQ A;  2J7K A;  3CT9 A;  1PAR A;  5HI7 A;  3R7S B;  3TJ9 A;  1U45 A;  3MM8 A;  1KN6 A;  2FD2 A;  2E7X A;  3L09 A;  1JJ2 R;  2XHW A;  4B9S A;  3KHR A;  2PMH A;  3MPD A;  1RDR A;  4OZL A;  1PO6 A;  3CJ0 A;  1Q5V A;  2YNH B;  4CI0 B;  3KK2 A;  3KG4 A;  5M2P A;  3OVA A;  3C6U A;  4WJB A;  1VIO A;  3K5M A;  1IJF B;  3CCQ S;  1OY8 A;  2XWX A;  3AQP A;  2ASY A;  2OEM A;  5AE3 A;  4AD6 A;  1X9W A;  2CG4 A;  3MCO A;  3EZ5 A;  4J9N A;  4ER8 A;  1XC9 A;  2MQL A;  4DZD A;  2KEL A;  4EBD A;  1B0T A;  1RTI B;  4F7V A;  5I3P A;  1N0U A;  2FZG B;  3FJ2 A;  5ETO A;  3R6G B;  4DEZ A;  4Q5V A;  1H6K X;  2F40 A;  2BJ1 A;  3M2U A;  1IR0 A;  3OVS A;  1VFJ A;  2HHX A;  2A2D A;  5KFI A;  3W7B A;  4DFP A;  3CCV S;  3EYZ A;  3KK3 A;  4QWC A;  1MU2 A;  1S59 A;  3CJS A;  1J5E J;  2CQG A;  3SYZ A;  3UN5 A;  2B9W A;  3D1O A;  3DXS X;  1DLO A;  1RT4 B;  2RH3 A;  3G9C A;  3DRY A;  1NZA A;  2F9J A;  2Z8Q A;  1UVM A;  1N6Q B;  1QUP A;  1RAJ A;  2HAF A;  2NXU A;  3TWZ A;  1W25 A;  1YWX A;  3BKF A;  3HLU A;  2IRX A;  4CO5 A;  1IKW B;  1RU1 A;  2Y1I A;  5D3G B;  2DT9 A;  2W7A A;  1T11 A;  3KLH B;  5C24 A;  2RT3 A;  4ELV A;  1OHN A;  2VQE F;  1LV5 A;  4KFB B;  2FLO A;  5BYR A;  5F8I A;  1HHT P;  2K1O A;  3LPY A;  3SCJ E;  1CQN A;  3BBC A;  4OMF G;  5FD1 A;  4WXO A;  5DLG A;  3SDE B;  3A12 A;  4X84 A;  3T1H F;  1H7W A;  3MR2 A;  4K4V A;  1NJX A;  4C9D A;  4PCQ A;  3HDS A;  2HK3 A;  4OYI A;  2OPP A;  3BQ2 A;  1AT1 B;  2D1C A;  3M8Y A;  4C2M A;  1X0F A;  1N48 A;  1N32 F;  4C8M A;  5DDO C;  1T0T V;  2IDE A;  5LM7 E;  4UTG A;  1NB2 A;  4J37 A;  4X64 J;  1N5Q A;  4WXW A;  1GQE A;  2HHT A;  1JWW A;  3RB3 A;  3H4D A;  2VB6 A;  2I0X A;  3OR2 B;  1JLE B;  2XMJ A;  4DDF A;  1EHW A;  3ENQ A;  2B5J B;  1Y9O A;  3PO4 A;  1F0X A;  4HH1 A;  3OHA A; 
#chains in the Genus database with same CATH homology
 2BJ8 A;  2K1O A;  1ARQ A;  2BA3 A;  2CAJ A;  2HZV A;  2JXG A;  2CAX A;  3OD2 A;  2BJ1 A;  2BJ3 A;  2K5J A;  3BKT A;  2BNZ A;  1MYL A;  3PHT A;  3LGH A;  3FT7 A;  1Q5Y A;  3FMT A;  2K6L A;  4HV0 A;  1IRQ A;  2K29 A;  2Y3Y A;  2BNW A;  1PAR A;  3BKU A;  1MYK A;  2GPE A;  3QSI A;  2NZC A;  4D8J A;  2BJ7 A;  1EA4 A;  1Q5V A;  2CPG A;  2WVC A;  3QOQ A;  2JXI A;  1P94 A;  2BSQ E;  2F1F A;  2KEL A;  3VW4 A;  1B01 A;  4ME7 E;  3VEB A;  2FGC A;  2PC6 A;  1QTG A;  2WVE A;  1U9P A;  2K9I A;  3BKF A;  3GXQ A;  1BAZ A;  2HZA A;  2H1O E;  2RBF A;  1X93 A;  2WVF A;  1B28 A;  2JXH A;  1BDT A;  1BDV A;  2BJ9 A;  2WVB A;  3H87 C;  1MNT A;  4FXE A;  3VEA A;  2AY0 A;  1NLA A;  2CA9 A;  2WVD A;  2CAD A;  1ARR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...