2BJ8A

Nikr in closed conformation and nickel bound to high and low-affinity sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEIISSLHVHMDEHNCLEVIVVKGEAKKIKMIADKLLSLKGVKHGKLVMTSTGKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NICKEL RESPONSIVE REGULATOR
publication title Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transcription
total genus 37
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bj8A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2bj8A02
2WVBA 3VEAA 2BNWA 1Q5YA 2BJ8A 2CPGA 1MNTA 2HZVA 2F1FA 2BNZA 2K1OA 2BJ1A 2BJ9A 3H87C 1Q5VA 1U9PA 2WVEA 2RBFA 3VW4A 1IRQA 4FXEA 2BJ7A 1EA4A 1ARRA 2CA9A 1BDTA 2K29A 1PARA 2WVFA 3FT7A 2K6LA 1BDVA 2Y3YA 2WVDA 3LGHA 2KELA 4D8JA 2CAXA 2JXGA 1BAZA 2BSQE 4ME7E 2WVCA 1QTGA 1P94A 2NZCA 2PC6A 3VEBA 2CADA 2HZAA 3QSIA 2K9IA 2K5JA 1NLAA 1ARQA 3OD2A 3PHTA 2JXHA 3BKFA 3QOQA 2JXIA 2FGCA 3BKTA 3BKUA 3GXQA 2H1OE 1X93A 1B28A 2CAJA 3FMTA 1B01A 2AY0A 4HV0A 2BA3A 1MYKA 1MYLA 2BJ3A 2GPEA
chains in the Genus database with same CATH superfamily
2AGQA 1DLOB 2LU1A 1RTJA 2ASJA 4L74A 1RI7A 3R7BB 5CYQA 1K1SA 2EG2A 4KTQA 1K0TA 2QJ3A 1DQ8A 2B43A 4LF4J 2HQCA 4CP5A 4YB7A 2HS4A 1D09B 4F3OA 3EJMA 1UWBA 1S9FA 2MKYA 5IT9Y 1XMOF 2E7WA 1SPBP 2A2BA 4C0BA 2Y1IA 1S6OA 2EC0A 1FE4A 2MEWA 2NXJA 4CLUA 1UP1A 2UUWA 4DL6A 2HBQB 2KT5A 4CO0A 4DLEA 4KGVB 1X7VA 5DS7A 2G1HA 1Q1KA 1U09A 1RWXB 4O44A 3DOKB 2V50A 5HAOA 2D3ZA 2DGOA 3TVZA 3PYFA 2G4BA 2ZH3A 1TP7A 2E5LF 4MMOA 3W2VA 2CQPA 1HA1A 3CTRA 1S6QA 1F1BB 2ILYA 3IA0A 3N5BA 5GAGI 4P10A 4ZVQB 4FYYB 3CDEA 1FK9B 5F0UA 2XO7A 3CVKA 1RGVA 1ITPA 2RJZA 4F26A 2WB1D 2IRXA 1HNIB 4MJKA 4O23A 1EP4B 1F9HA 4UF4A 4CYUB 2QV6A 4OJ3A 2OAUA 2IMOA 1TUGB 4CO1A 4A8SA 2XS5A 3HCXA 5AXLA 4LSLA 4HVZA 3M4XA 4J37A 2PI4A 3FBBA 1ARRA 4MAKA 1VCTA 3GIRA 2OTJS 3OSPA 2F3JA 3UDCA 1PJ5A 2CDQA 1FF2A 1T9WA 1RWOB 4EFAC 4USKA 3KK2A 3CC7S 1UFKA 5AT1B 3X1LB 1B64A 1JLAB 3TYTA 4K7QA 5DLFA 3Q22A 4DV2J 4GO5X 3SCLE 4BHQA 4QYRA 1FERA 4LF4F 1QUPA 4AXJA 4LRBA 3TZXA 3BDEA 1T02A 2JNJA 4PG4A 1P6TA 2V63A 2Q79A 2UV8G 1DBDA 4DQIA 1SIWA 1L3UA 3IG1B 1WTFA 1BGXT 3TOQA 5HJXA 2BNZA 2YWEA 3ILLA 1RWNB 5M2UA 3IO1A 4IH6A 4D3GA 2EI5A 5DG8A 2QX0A 3QGHA 3BO3A 1BLUA 2DNQA 1FESA 3N28A 1AFIA 1RDRA 4MK7A 2NYHA 4J9VA 5D4OA 5ETSA 3ILJA 4DR1J 3T5JA 3C8YA 3ZZ0A 2Q6CA 2WONB 1SKRA 1CJKA 4QIWD 4J7CA 1H7XA 4YS2A 2B9YA 3LH2S 2R7QA 2AN7A 1KONA 3LP0B 4PWUA 3SQGB 4B08A 2W9AA 1FDNA 3UPFA 1U0HA 1CJVB 1WORA 1MYLA 3NGUA 1PG5B 2BX6A 2PEBA 4KO0A 5D78A 3OJUA 4ELVA 3VGSA 1NEEA 3VGVA 3G8SA 1JXVA 1P9YA 4PQUA 1LEOA 2J9DA 3H4BA 1TFWA 1DTQB 2HLTA 2JFDA 1UW9A 3IWXA 2FHJD 4O3SA 4OV6A 4Q8FA 1GT8A 1Q0NA 3R1HA 3K5NA 3RU0A 3MAAA 2O01C 4DJBA 2BJ7A 2MGZA 1AYEA 5AXMA 2V67A 1O51A 2DD8S 1UJ5A 1FFGB 3AQOA 1HQUA 4FKYA 4F67A 3BJYA 4DV2F 2R7XA 3BGUA 5F41A 2B6AB 1ZM3A 2AWZA 2HZAA 3NNHA 1B7FA 2HRYA 1ZM9A 3KUEA 5A8WB 3Q8QB 5I3UB 1Q79A 3D9BA 2J0SD 3B54A 4L75A 2RB7A 2OPQA 5ETVA 2DITA 2DGXA 1UPPA 1VBYA 3BSNA 5DO2A 1RE1B 2XNQA 3Q8RB 1WHXA 4NX9A 1QTMA 1UZHA 1BE4A 2I38A 1JKHB 5DM7Q 2CRLA 1T05B 3AOCA 4MH8A 4WTOB 4R0EA 4QWCA 2I0XA 4YB1P 4LF2A 4KH0B 3CJ8A 2MZJA 3EICA 2AV5A 2R7TA 2YNGB 2B4PA 3RB4A 4IO9Q 3I96A 4OZ3A 2ZZTA 4C98A 3D68A 1RT1A 3RR7A 3NNAA 2JDJA 2UZAA 4I7FA 1U8SA 1PCAA 4TU9A 3PO5A 2AJ2A 1LFWA 5G4DA 2MDAA 4RWWA 3MD1A 1UJ4A 3UD4P 4TY9A 1IKYA 2WSEC 3PW2A 2EEYA 3ZC4A 2IHR1 4ZJOA 2CPZA 1EKSA 9ATCB 1XC9A 2C2NA 1S9GB 4M63A 4OX8A 4HV0A 1N32J 2FVRA 3MPUB 1S0VA 5F9LA 4F8RA 3UR3C 4A48A 2R8GA 1CJUA 4LIWA 3PM9A 2KKEA 4ZPVR 1VRTA 2K8GA 3N79A 2H4WB 1TKDA 2DHGA 4EWTA 2VONA 1QUVA 1UFWA 4C0OC 4Z2XA 5HJYA 2HHSA 2EFQA 5IXUA 3EDQB 2V8PA 3WZ0A 2PGCA 5IV4A 3DLBA 5HLFB 2R4FA 1RTJB 3AAWB 2BVZA 2HNDB 1T9TA 2UVVA 2CPJA 2DIUA 3U1LA 2HS0A 3H98A 4F36A 4FNIA 3AJ2A 4OI1A 1U7LA 4DU7A 3HT0A 3HMJG 1SJQA 4LSNB 2DKOB 4EZ6A 2LEPA 4U96A 4KC5A 4FS2A 1UVKA 1UMJA 2LKZA 2V8DA 3K17A 4ATNA 2GA7A 2HPUA 3MXHP 2VUGA 4Q44A 2EKYA 3KJNB 2J0XA 3PW0A 5ETNA 2ALYB 4ZJQA 4DPXA 2QA1A 3PKMA 3DLKB 3D6MB 3TJAA 3EVOA 2NREA 2AU0A 3M8RA 1S99A 4ZVHA 1IBLJ 4GO7X 3V81A 4ZA1A 3KLIA 1S6QB 1HPZB 4ZCIA 3GCWP 3MOZA 4KJIA 2WOMA 3TZZA 3C15B 1EJ7L 2ZBRA 2OMOA 3BSAA 3EUNA 2ZVIA 4IO1A 2YX4A 2NZCA 1N32F 2LEBA 1V9OA 4GVBA 3K89A 4E98A 1SUQB 3V2UC 1S49A 4FPRA 4ZLJA 3W8GA 4EZ9A 4ECQA 1IBCB 3B8HA 3MDFA 3MAQA 3MFHA 4Q45A 4DSKA 2JEIA 2RDIA 4PQAA 2J7UA 2Z2MA 2G2YA 1QD1A 3ISNC 1RCXB 2XB2D 1JLCB 1UFLA 4RW4A 3M9MB 3V4IA 1FKOA 4X65J 4DSJA 1IN0A 3SMZA 3ENAA 2VA3A 4WKRA 3MM7B 2R2RA 4KFBB 4WP3A 3JYTB 1IRQA 4N76A 4JI1J 3GG1A 3CJ4A 4K4SA 1CC8A 1UEKA 3U02A 3MEDB 1PAEX 3AB4B 3PTWA 3QJJA 2KRBA 2E1AA 5CH7B 1ULRA 1XERA 2HHPA 2G1DA 2APOA 4F3QA 3IGVA 2L9WA 1FEEA 4DV0J 4DQQA 1FXLA 2YQ3A 1Q8IA 4X66J 4HL9A 1UVNA 1TVRB 2IIHA 4U7UK 3WX8A 2JHEA 1U2FA 2OP5A 1YG0A 2V2ZA 4H4OA 2QTWA 4I6AA 1OSCA 3ILOA 5D0EA 3QBCA 2MMYA 3QIDA 3UD3P 2QO3A 1LWXA 2K3KA 5ADZA 1HR0J 4HH1A 4JV1A 2V4QA 2GO8A 1S1UB 4JI0J 3IXQA 3D7SB 4QYZK 1NAQA 2D9OA 2Y1LB 4ZVTB 4IRKA 1IBLF 3LALA 3FQKA 2Y9HA 1NZ8A 2A0FB 4LMZA 2QRRA 4P7VA 4IOAQ 2KB2A 1Z1ZA 5IC6B 3VR1A 2XULA 1Z2LA 3I0SB 1CPZA 1SV5B 5E3RA 4B9SA 1CQNA 1ZAVA 1SH0A 1S79A 2DNOA 2ADLA 3QJLA 3CWJA 2M3DA 5E33A 3VZIA 3AD7C 3OV7A 1Y3KA 5KT3A 1VJQA 2G13A 2F9JA 1N6QA 2XBPA 3BYRA 2Z56B 3GR1A 3C6UB 3W5XA 2K5JA 5J1EB 2QL9B 1J5EJ 3PEJA 3WHIA 5HMZA 1U6FA 2RD5C 3MPYA 1YJ9S 1FTCA 3GYXB 1QY7A 5DDPC 2E29A 2H65B 1PYTA 4X65F 2RAQA 1J2VA 2ZOGA 1RYSA 3FCWA 4FYXB 5H9FK 1F6TA 3BQ2A 4ZCKA 3NY0A 4JI1F 1T94A 1Q5YA 2W4PA 2RKIA 2BE9B 3M30B 1Q7YT 4DS5A 1DARA 4YQWA 2H9ZA 4ZIWA 2EKNA 4DV5J 3MPWA 1HARA 3WBZA 4WP9A 4DOZA 4J9KA 4PG6A 4DV0F 2AEFA 3NNCA 2B9EA 2OPQB 3RW7A 4LBIA 4C8OA 3SCKE 1N5TA 5B0DA 3HKZD 2QSFA 4X66F 3V6JA 1P9QC 4WXOA 4FP9A 4PXDA 4J91A 4LJMA 5CZXA 3KJQB 4PWDA 1DZ5A 3NXZA 1IQZA 4WU2A 1BAZA 5HROA 3I32A 1MU2B 1ICEB 2E1RA 1HR0F 3UCUP 1ROFA 1TL4A 3GG0A 4RJVA 3P5TL 1AW0A 4JI0F 2X3GA 4UOCA 1EKRA 4NLPA 4XK8C 4J9NA 2EPIA 2EG1A 1LOUA 1S1TB 1SXLA 2YKMA 3QATA 3O5TB 2BOAA 4CO4A 3QO9A 1WEYA 3JQMA 2DHHA 3RB0A 1KRPA 4ZP9A 2EBGA 1RWKB 4WJBA 3E3XA 2IY5B 3AB2B 4AUKA 4NASA 2P2CB 3LAKA 3BV8A 1LFPA 1RBOB 2HKEA 3GJTB 4YFUA 1DQAA 2QLJB 4LFAF 3HX9A 3IR7B 4KAIA 2BRLA 3QRRA 1Y7PA 2LFVA 1NUEA 3DMJA 3PACA 5ETTA 1IKYB 1IJFB 4BDPA 2K3IA 4FYVB 3BR9A 2CG4A 2ZNYA 3R6GB 2Q43A 3W2WB 2HWIA 5A76A 1RTHA 4N5SA 1N48A 1C4CA 3RAXA 2GAHC 1J5EF 1S59A 1X5TA 1BY9A 1RU1A 2AJ4A 2VG5A 5C25A 1Q16B 4TU7A 2HVZA 3PJXA 4LR8A 4DZ6A 3Q86A 3TVYA 4CIOA 4NLDA 4DR5J 1MW7A 4OZLA 3Q8PB 3CD7A 2QEXS 2HGNA 3FFIA 3EZOA 2MHEA 3BKTA 4QIVA 1VQSA 3FGVA 3H59A 1URNA 5HMWA 3IGNA 3G6ES 1JLBB 2H1YA 4DV5F 2X7IA 2M70A 3HZGA 2JEFA 2GVDB 2NLWA 1HBNA 1CULA 3BR8A 5JJBA 1YRXA 2MKJA 2RQKA 3M8WA 3G82A 3QT5A 3PFEA 3HHLA 3KDNA 5KOWA 2W2QP 4FXVA 1Y11A 4I2QB 2FZGB 5A6PA 3TZWA 5J2PA 2CWXA 1XBWA 4RW6A 1VQYA 1KP6A 2YNHA 3OHAA 3KLGA 4OZ0A 4OZ5A 1KEKA 1FXDA 2IVFB 3WDOA 4NLQA 2D9PA 3CJ2A 3DKDA 4M5DA 2YPYA 2VFUA 4DN0A 1D9FA 1Y0HA 3GIKA 2G0JA 3UN2A 2DK2A 2EXUA 3C14B 4ZLLA 1VHIA 3P96A 2GIQA 4C0HA 4DZDA 2W9BA 3AODA 3MUTP 1T9UA 2GMJA 3V81B 1WNEA 3KLIB 2DNGA 1REVA 5H1SV 3GSDA 3K5OA 1SJ1A 1JLEA 3L4BC 1U1RA 4USUA 4FVMA 2FJDB 4JYAJ 2YWKA 3M6WA 2FY8A 3KMSA 3MFIA 3DRSA 3M6UA 1AXQA 3R27A 1TMMA 1QTNB 4CLKA 1EARA 3KLHA 2L41A 3VAGA 4RW9A 1SC1B 2UXCJ 2FZKB 2NS1B 3TEGA 1MROB 3MMCA 4DR5F 1SKUB 1X9SA 3KLEA 4EBCA 2HBZB 4Y2MA 3GJQB 5BR8J 5HVGA 3D28A 4TVAB 2CZ4A 3HM9A 4R25A 3NGRA 4FZVA 1UVIA 2B3TB 3J7YI 2VZ9A 1ZA1B 2UXDJ 2P5VA 1JLQA 2MQNA 1QLNA 3PG9A 3FK4A 3D67A 3QPIA 5H9EJ 3MCOA 2XEXA 3DLEB 2WW8A 2AW0A 2WBMA 2YXLA 5KFQA 2CG8A 3AD9C 3RBXA 4DFPA 3OSNA 2J0WA 4F50A 4DPYA 2UUAJ 4TN2A 2ZOFA 3WX4A 1NDPA 1EQMA 1O5JA 5FD1A 4HTIA 2JH3A 1J5OA 1X4HA 2FHOB 4I68A 4K2XA 5JXSA 1IR1A 3G86A 3AA9A 4B02A 1VGYA 4L3NA 2DHSA 4J9UE 1TK5A 2AQ4A 2XY5A 3H8YA 3KLFB 3BN7A 4RNFA 5KT4A 2E7XA 3P45B 2R7UA 2JXHA 2HFZA 3MM6A 3CCQS 1XTZA 4ICLA 2HSEB 5HI7A 2BJEA 2ZH6A 4JYAF 5FLXY 4G1IA 4UZCA 2DHAA 3CC4S 1RK8A 5A8KB 4LSZB 2MKCA 1IKWA 4IOCQ 4JV5J 3R5AA 5KFMA 1NK0A 2UXCF 2JZ5A 2LVWA 4ID5A 2F1FA 3TX8A 4DU8A 1TK8A 5BR8F 3HT3A 1EETB 2FDNA 3C46A 2WHOA 3AH6A 1WHYA 2AYMA 5D3GA 3OLBA 3HPOA 1OYEA 1WC3A 2GMLA 2DRDA 3G6YA 3BO4A 4M95A 3HO1A 3T6BA 5GAHU 2GC8A 2UXDF 3R8YA 4H54A 3GIIA 4AD6A 2VL1A 1OMSA 1HKAA 5HP1B 2WSFC 2IPOB 5KFCA 1VQPS 2XCAA 4RZRA 5L46A 1C1BB 5LT5A 1N5YA 1X31C 2UUAF 1ZAWA 2J9CA 2XYGB 4C8NA 3GYGA 1LXJA 2R2TA 1D1UA 1X60A 3J7Z5 4RUCA 1FE0A 1TL7A 4P2SA 1RHUB 1HHQA 1NK7A 4OIXA 2ROEA 2HMIB 5HMXA 3UN5A 5F3ZA 3P6YC 1H3DA 5ETOA 2DNMA 1NK9A 1ZPWX 2OUGA 3FMWA 1Y3JA 1SC3B 1ZBTA 2BJ9A 3UDVA 4X4VA 1TZ0A 1TAUA 1VYAA 5KFEA 1YJ7A 4LF9J 4MK9A 2M2BA 4PABA 2YVSA 2QLFB 1FWKA 5HVFA 1TV6A 1U0SA 4AL6A 1IR0A 2KELA 3GMGA 4C8LA 1FNOA 5A0YB 1HWKA 1VQ9S 2CQ4A 2HWTA 1N56A 5EHHA 4JV5F 2K06A 3O3LA 1NBEB 5C24A 1CJTB 2PD1A 3FCVA 5KFVA 1S6UA 3UCZP 3O44A 3DOLA 4URSA 4IG0A 2VQEJ 2DPJA 4LR7A 3J81U 4K4UA 5SUHA 2FZCB 1IXKA 4K0KJ 2XSFA 4MIAA 3UO0A 3I87A 1YIJS 5KG6A 4ECYA 3CDBA 3UNGC 3LGMA 4IUFA 1AZSA 2MY7A 3W63A 4JI8J 1TL3A 3M8PB 1HHTP 1FD8A 3PR5B 2VQFJ 5KT2A 1QSSA 3FFIB 3DRXA 1RADB 3IRXA 4Q2MA 2LQBA 5KFFA 4AAIA 3B6BA 4DFJA 4LRCA 5IT0A 2DNNA 2D3OR 3OTBA 5T7LA 1LW0B 3ZFVA 1OJ4A 1MMDA 4DXLA 3DCAA 1YZ7A 3M2VB 2ERRA 1L3TA 3HHLB 3FMBA 4MKBA 1HBMA 4NMLA 1T9XA 3SSQA 2B4UA 1TL1A 2R7VA 2Y0BB 2VFRA 1B01A 4DCOB 2I1RA 5BYSA 4X4RA 2CPEA 4Z7YA 2LECA 3OR2A 3CJQA 3OUYB 1X4BA 1U6BA 3L7UA 3NOCA 4ED1A 2CUYA 1FDDA 2KT3A 4M5DB 3GILA 4L76A 4LF9F 1HNVA 1HW8A 3GSIA 2DNHA 4KV8B 2H5EA 1NLKL 3BREA 3GB0A 3RRKA 2W9BB 2YTCA 4J9QA 3LPYA 4RNMA 4A8YA 1S1WA 3NBPA 1E6VA 5LMUJ 2IJNA 1R0BG 1X5OA 4LRAA 1QAXA 1YRTA 2WVDA 2HFSA 5GAGU 2VQEF 1MNEA 1FO1A 2DNZA 1F5CA 2GGPA 1X4FA 2B8QA 5JVHQ 4K0KF 4UZBA 2JBVA 5FDLA 1RHKB 2WB4A 2OPSA 2DISA 1KVIA 3W64A 4DSIA 4JI8F 3GXQA 3A13A 3TR5A 2XYPB 3O6QA 1S6PA 3G6XA 4DFKA 3PIPQ 4PPZA 2LA4A 1F3VA 2A1BA 2VQFF 3H5YA 2VJVA 4NCAA 2ZH9A 1HWJA 2HFUA 2UP1A 4NA2A 2VBWA 3KK1B 2MXYA 3NGTA 3RB6A 4ES2A 2AT1B 5CHCB 2K1RB 3B82A 1TAQA 5EWGA 5EGYA 5KG3A 1SIZA 3DYAA 3I6PA 4OMFG 5K20B 4U7CA 2HQFA 1P1LA 4GKKJ 4CM2A 2OKQA 4OI2A 2U1AA 3THTA 2BDPA 2G0CA 4TQSA 4DV4J 3Q0AA 4ED2A 4ILRA 1B7YB 1VDHA 1DRZA 3NG8A 5DGAA 2XI2A 2UXBJ 4DDFA 3BQ1A 2AEJA 4QCLA 1O6XA 4OV1A 2D3O1 2BM0A 1RBLA 4PAAA 3D0IE 2XMAA 2V2VA 2KHDA 1T03A 2XZTB 1J5OB 3TRGA 1JLGA 3EE3A 2DNKA 4OX9J 2V8VA 3H2UB 2RF2A 2QMWA 2DR5A 2ZBIA 1W7WA 4EI2A 2VHGA 4OI3A 4IFVA 3HDSA 3M8QA 3QGGA 3I4PA 6AT1B 4F0KA 2HHQA 3DRRA 2LLZA 1VRQC 2BR0A 5E7OB 4RPFA 3G8TA 2CJYB 2DNRA 3QAUA 4GVLA 5LMUF 2IDEA 5HMYA 3W60A 3KJVA 3V6DA 1M1GA 2KG1A 4LFCJ 3QT6A 4OZ1A 1P1TA 2E1PA 1EA4A 2RT3A 3PIOQ 1X8DA 2RU3A 4QWDA 3TAMA 3OVSA 2AX1A 2ZH4A 4UOGA 4WFYA 1I94J 2DH9A 4A8QA 4E8UA 2MQOA 3E01B 4FPIA 4HACB 4GKJJ 2J8AA 1WWHA 4LF5J 2PC6A 5CCLA 3EZ5A 1TKZA 1YJRA 4P6QA 4ECUA 2B5JA 3OTDA 2GVZB 2QG9B 2KXHA 2PA3A 4DV3J 4ED3A 2D74B 2HNYA 5B0AA 3T9ZA 1WF2A 3K57A 2H54B 2D3UA 3L09A 2LU2A 1JLFB 5DDOC 3CDAA 3LW5C 3LO3A 2OD6A 3Q8VA 1IKXB 2HVDA 3GCXP 1G4CA 3MGJA 4QR1A 2SXLA 4GKKF 3TW0A 2F4FA 3KG4A 4N8NA 4Z37A 3FQLA 3I56S 1FHTA 2YBVA 2RH3A 3R5JB 4DV4F 2UV8A 4K4TA 2VPXB 1FRJA 2A2DA 1NJWA 4H4KA 4ED5A 2UXBF 3GQCA 3MCNA 5EWEA 4J9SA 2EW9A 1T3OA 3B4DA 1HBOB 4KB7A 2CPFA 4Q0BB 3M8SA 3ZZOA 2ZHBA 2WRMA 3BBBA 1XQIA 2K7JA 2MYFA 1TK0A 2DY1A 4DF8A 3BSCA 4OX9F 1S7IA 2HVIA 2XHCA 4CLPA 3VAKA 1D0EA 4RW8A 1VC6A 2VODA 2Q6BA 3PHTA 3RYLA 1LK7A 5KFDA 1Q4RA 4F02A 1BQNB 3OFGA 3POTA 3M32B 2RHSB 5HQ8A 1UVJA 4QWAA 4K2JA 3BO2A 3DM2A 5L1KA 2BV3A 4KKOB 1PIEA 3M2UA 3CEDA 2PI5A 4LFCF 2JC1A 3EYZA 1SKSA 4K4YA 4DEZA 4RO0A 1CLFA 3CE8A 2H4YB 5IM0A 2V4JB 1I94F 1KQKA 1SQEA 4GKJF 4KGKA 5HSPA 3H5SA 1NSAA 4LF5F 2EVZA 4IG0B 5F3TA 3U1MA 4BBYA 2R7SA 1OQ3A 1KHWA 1VC0A 3DRPA 3UDLA 1WC6A 3DN9A 4DV3F 3DLHA 3UN3A 3IP0A 1KWMA 1H0HB 2HQIA 4J9RA 3H90A 1X5PA 2IAJA 2ZVSA 2P6TA 1OY9A 3B78A 4MYTA 3PRVA 1Y9OA 2HHHJ 3GV7B 1QAJA 3EGVA 4F4WA 5DZ6A 3CNQP 4ECWA 4O3QA 3J80Y 1YX2A 3BZQA 2HBYB 5I42B 2C2EA 2VG7A 5IQ6A 4XTTA 4E0DA 2C2DA 4CLTA 3WC0A 1KD1T 2V68A 3HZEA 1RT7B 1SL2A 2CPGA 1NXIA 2QFIA 1LQ9A 2D1CA 5T7LB 5DDQC 2EFNA 4DG1A 4U67Q 2HHWA 1QDUB 5KFJA 3S1TA 2NUHA 2DXDA 2M4MA 3H87C 2CQ1A 1BXNA 2WBRA 2ZFHA 1T9YA 1ZH5A 2XMTA 2BBEA 1TKXB 2D7SA 2DGQA 3TAQA 4X4TA 4RBTA 1RYRA 1R0AB 2X1FA 6FDRA 2DPIA 1VQ7S 1PARA 4XDCA 4LF6F 2HRUA 4AT1B 5E3QA 3NP5A 3CMAS 2GNKA 3ICLA 2ZD1B 2QYCA 4ZPWR 5KFNA 3ZTQA 2BQRA 1OO0B 3QRPA 4F4ZA 4I2PB 3EXYA 5EDWA 1NDCA 3AFGA 2LXFA 1YJWS 1M1HA 3LPEA 2XLIA 2WCXA 1QM9A 2E44A 1GH8A 1XEZA 2IJRA 2DGSA 2BE2B 1HL6A 2RRAA 5L39A 2CQ3A 2CQHA 4MTPA 3CIZA 3D0HE 2MQLA 3KXDA 2DR7A 2CIMA 3D6HB 1OG7A 4FVCA 3NL0A 1C2PA 3OL7A 2IVYA 3TP2A 3TJ9A 1G1XA 3CCZA 5KOXA 1ZZFA 2VICA 3VWSA 1NB7A 2IC3A 2GJ2A 1EQ0A 2VD3A 2RBFA 1GFWB 2CPDA 3I31A 1TMJA 2R3VA 2CJXB 4OYWA 1S6PB 4IDKA 3IBFB 2HHHF 3S01A 1JXEA 3HSZA 2ZHAA 1NB2A 3AJ1A 2PMHA 3NWRA 2R8IA 2PEHA 4KPCA 4KGXB 3RR8A 3CCLS 1I51B 2AP6A 2NYIA 1EB0A 3KK3A 1KLMB 3GFXA 1SVDA 1YBTA 1DFDA 4I4BA 4M5HA 1T11A 2WSCC 4HLBA 3EPIA 3RBEA 4OX6A 1HNXJ 2Z2YB 1O0PA 1RAFB 4XIUA 3LP1B 3ET6A 2LQ8A 3SBMA 2A6OA 1U4BA 1R8BA 4N8OA 4R8UA 4RNHA 2E1CA 4GC6A 4CTAB 4ED8A 4K4VA 5L1IA 2RF2B 4ZJLA 3DOMB 3CMQA 3PYEA 2MQPA 3M8QB 8RUCA 3CCMS 4TU8A 3US5A 2B8PA 1RT4A 1FRKA 5KFTA 5JVGQ 1P27B 3K0JA 1WDTA 1QE1A 2HRTA 5B09A 2J9DE 1TU0B 2XMMA 4B3OB 2YH0A 3J7AN 3BGFA 2CAJA 2XY6A 1RISA 2HHUA 3ULHA 5J2MA 3TI0A 2FY1A 5KFBA 2XSJA 3T5HA 2OGUA 4NYZA 1RTIB 4ZIVA 3IMQJ 4ZN3A 3M05A 1S97A 3D2WA 4F0HA 2B5JB 2AZ1A 4F2SA 1NJZA 4PYAA 3PKYA 3ZTSA 3HHEA 4CRJA 1NK5A 1JMTA 1K73T 3EGNA 2FJAB 2CVEA 4JV2A 2H3EB 5HQLA 4W92B 1NJIT 2ZE2A 3C16B 5EX3A 3IRWP 1RT3B 2ZEJA 1ZA2B 4G6VB 3UCGA 3MM9B 1H2VZ 3IM8A 2AKWB 2LDYA 2I2YA 3PEHA 4IFYA 4JI6J 1D8ZA 2FTRA 2O3DA 5C5JA 1UW4A 4OYMA 3I5CA 2R7OA 1KNZA 5IOLA 4PXCA 3AOBA 3GONA 3HI9A 1N88A 2VG6A 2QA4G 7FD1A 2XM3A 5DDRC 2FGCA 1D9AA 2A10A 4OLPA 1KR4A 3NGSA 1VRUB 2V94A 1HNXF 5J1PA 1FWPA 4ZCMA 2FD2A 5L1JA 5D0HA 1TUWA 3MEEA 3MR2A 1C4AA 1PILA 5D6GA 1OSDA 3FBEA 1X4EA 2GZOA 2FIUA 4LIRA 1LXNA 4Q2LA 3TNVA 1F9EB 2Z2LA 2JJ4D 4JI7F 4UOFA 4YY3J 1VQ5S 1X9MA 5ETLA 3UFCX 4USJC 4C9DA 3KDOA 3C6TB 1TFYA 5K8MA 2B0GA 4URQU 3POTB 4H4MA 1VQOS 2X1BA 4K8RA 2G0IA 2PFFB 1NPKA 3CJKA 2IA0A 2VIHA 1V6HA 4D8JA 4ELTA 4DSEA 3PX0A 3QAEA 1VS3A 4PUOB 2W9CA 5BJRA 3M1VB 1S1XA 4DPTA 2DGTA 4I64A 2FPHX 4C3KA 2YWHA 3DI6B 4B9TA 2KZMA 4G65A 2W7OA 1MYKA 1YDLA 4CT9A 2GPEA 2HQGA 2VBYA 2UVUA 1JJHA 4OHWA 1U1NA 1FNMA 4NEYA 1WD6A 3JAMU 3FRYA 3S7RA 2DVIA 1MNTA 2DEIA 1V3ZA 4CLZA 3Q2TC 3M8YA 3DLLQ 4FF4A 2QZ8A 4JI6F 4YR0A 2AIRB 1QVFR 1M5HA 1FNXH 2HYIB 1XR5A 3M6XA 5IZHA 5CAAA 2ZWOA 2MB0B 4B9LA 4M5IA 4EUVA 1HQEA 2XMVA 3R7SB 2ATLA 3A8EA 4KRWA 4B3MJ 4Y6IA 3EMTA 4ZPAA 4HDGA 3QNWB 4RBVA 1PJ6A 3OR1B 2GS8A 2OFHX 4DG1B 3CSKA 2W4CA 3BKFA 2GW8A 2HW3A 3DLGA 5HBMA 1A7GE 2MZRA 3NCPA 4YY3F 1I5OB 2CPHA 1FJ7A 4QQBA 2VU5A 3W7BA 2JX2A 4OJ1A 3HK2A 2YNFA 4UTGA 3Q8SB 1JQGA 3TZYA 3QLHB 1KLNA 1FKPB 1BWEA 2BJ8A 1FVSA 1RLCL 1LWEB 3W1YC 1Z4UA 5LM7E 4JP8A 2R42A 2RRBA 2YKNA 3OPKA 4EMDA 3MEKA 5E3CA 3VF0B 2HURA 2XZWA 4AXIA 3HFVA 1HMVA 4NI2A 3CCUS 1L3KA 3R5GA 1SKWA 4R0JA 1RT5B 3M6VA 3QIPA 1XR7A 4UUXA 3NS5A 3LANA 4ZK7M 1U1MA 4HH0A 1IUJA 4B3RJ 3KLVA 1HWUA 4RUAA 3HJVA 1NH7A 4ECTA 1RT6A 3PR4A 1HI0P 3BH7B 2J7KA 4GC7A 1F0XA 4O3PA 1Q81T 4UQTA 2W01A 3OL9A 1FRIA 1PBAA 5KG5A 4CM0A 3LWMA 1V3SA 1B4SA 1C1CA 2B7BB 2AHOB 5EUHA 4BC9A 2W2PP 3H5UA 1VISA 2BW7A 5C42B 1MMLA 3CJRA 4DV6J 1RT2A 3TUPA 3FSYA 2OEMA 4X4PA 4FYWB 4X4OA 3LJPA 2XLJA 1PC4A 2XCPA 3S6EA 3MECA 3G4SS 3NCQA 3W3SA 5J2NB 3PYDA 3Q24A 2FQQB 3J7YU 1R89A 3OJSA 4B3MF 4FXDA 2YWWA 3P5BP 5B7WA 3M9NB 1BQMB 3MR7A 3BS9A 1FRHA 1R6VA 3N01A 2PT0A 3MMAB 4LF8J 1C0TB 1GXUA 2GIRA 2RQMA 4OL8A 4WE1B 3CCSS 2DRBA 4Y2IA 1WKKA 2R2SA 4CT8A 1RQ0A 1SJ3P 2XMKA 3T1AA 1DTTB 2NSBA 4I56A 1G3OA 4WPAA 2CXEA 3PDNA 3PFOA 5F8IA 4ECVA 5E3PA 2MTLA 1YKWA 3MPVA 1GX6A 3KNAA 3M2RA 3BGRA 3VALA 1LW2B 1X4DA 4WCEQ 2HIQA 3GR0A 1XNQJ 3SQOP 4K4WA 2W8LA 3KUHA 2MQMA 2CQGA 1HBUA 4M5JA 2AD9A 1RT4B 2VOOA 1Y5IB 3BGOP 5KFZA 5IT9U 1FX2A 1LV5A 1KFDA 5KG1A 4B3RF 2KRRA 3ZZZA 2JL9A 1U02A 5CZVA 3JSMA 2V8GA 1R8CA 3NLCA 4FF2A 1RWVB 3ZXWA 2X1AA 1OY6A 2XLKA 1SJFA 1U8WA 2ADBA 4PCQA 4I69A 3KJFB 4OYZA 4HR2A 1N33J 3NKYA 4PG7A 1X0PA 1V5IB 4DV6F 2Y0SD 5HN0A 2WAQD 2YNIB 3OQ2A 1NM2A 2ASDA 2AJFE 2OO4A 4Y34A 3D0GE 4YMEA 2CNNB 1B28A 4J5OA 3TUZC 2V34A 4OHXA 1HQ2A 1WHVA 4DR1F 2QYGA 2ZOMA 3F0NA 2PN6A 1V3RA 1GMVA 3OVBA 4RWXA 4WF9Q 4WK3A 4LF8F 1NDLA 3OTEA 1UVMA 4XPCA 4CCHA 3R5CA 4LRFA 1Y5LB 1N4LA 2VG6B 2IM3A 3LP2A 1KVKA 4U7UD 4R5PB 2GHWA 3ZZRA 1RBAA 3MMBB 5A6WA 4CLYA 4AYBD 1QAYA 2I9SA 1TKTA 2CQIA 2QIFA 5AXKA 2HBRB 3H5XA 1KC8T 4K50A 4I1TA 1TL5A 2JWNA 1V5VA 3LGHA 2CYYA 2DGUA 3ITHB 2OSQA 1Q7LB 3L3CA 2H5IB 3OXLA 3CO9A 1WDDA 1Y10A 3HVTA 4LRDA 4CDIA 1I1GA 3OBIA 1N34J 1DLOA 4QIEA 3O2IA 1XNQF 3NAHA 2H3AA 3LAMA 3NRBA 2OHDA 4MIBA 1WG4A 4OI0A 3MM8B 2OPPB 4P7TA 4H4MB 1HYSB 5CCMA 1GXLA 5DQGA 4PG5A 2DB1A 3AXKA 4QJVA 5IC4B 3FUYA 5CYMB 4OYAA 4K59A 2C3PA 2IMWP 1FRLA 2LDIA 3TQ1A 3A8IA 3FJ2A 5CYQB 3W9IA 3DOKA 1N33F 3K7RA 1K47A 2VBZA 1REGX 1U1LA 3UW1A 2RRNA 2XO6A 2NQPA 1UWBB 3V5RA 2YKAA 4QWEA 4P75A 4ED6A 4HHHA 1PO6A 2YWGA 3L7OA 5HQMA 2Z0GA 1FK9A 3OD2A 2AX0A 3I5AA 4J9PA 2VJUA 2B4OA 4MK8A 4PRFA 3MCMA 5AE1A 2CWKA 2WZ1A 1KHVA 1HNIA 1W26A 2JLEA 1EP4A 2CDRB 4CYUA 4TY8A 4O44B 3NGDA 5H9EK 1SJRA 4XAKA 3W2VB 3FKBA 3H2VE 4PPDA 2XG8A 1L3VA 4J9MA 1NKBA 1KTVA 4JV0A 1RTDA 3ZTRA 3OHBA 2KM8B 1PC5A 1UZDA 3RZAA 5IV3A 3HSGA 2OMLA 5DGBA 3AA8A 1NK4A 4Y2CA 5HBMB 1JNZB 2B9XA 1X4CA 2KVIA 2MZTA 5ETKA 3QJPA 1N34F 2ZDPA 1JLAA 3JTOA 1UJ6A 2L3MA 2W1BA 4WBFA 5THWA 1EX8A 2CQDA 4LSLB 2XHWA 5M2PA 1VQ4S 4ED0A 1YTYA 1RSCA 4ETZA 5GMKa 2ASLA 2L9NA 2EFVA 4LVNP 4MKVA 3RUBL 5IT4A 2XI3A 3Q83A 2ZZNA 1WC5A 3IBCB 5ETQA 4K5RA 1HMVB 1WG1A 2XC9A 4FF1A 3H4DA 1N52B 3IG1A 1X93A 3KK2B 3C3LA 5A2QY 3QIPB 2X51A 6FD1A 1ZYQA 3H20A 4J90A 3W8PA 4ZVUB 1RT6B 2FHJA 1G7CB 1F2HA 1X9WA 1NK8A 1SQGA 3GFYA 1YRUA 4QPTA 3L9ZA 2WONA 3RGIA 2GIFA 3TQEA 4RU2A 4UOHA 5J2QA 4USWA 1C1CB 1R8HA 1SIWB 1AUDA 1SC6A 3CD6S 2K29A 2D69A 1H2TZ 1QVGR 2KHCA 4DL0C 1N36J 3X3UA 3T5LA 2DTJA 2F7VA 2ZC4A 3LP0A 3TJ8A 5JUMA 3MCSA 1KFSA 2COLA 4U9RA 4CLSA 1RLDA 1CJVA 4NPOA 2GX8A 3G5OA 3TUIC 1J27A 4KH1B 3QOQA 3RTVA 4HEA9 5KFIA 1DY3A 2MKSA 2W7AA 1DTQA 4Y65A 1VC5A 3ENWA 3I4HX 1CJKB 3F73A 5DM6Q 1WOOA 4MIWA 4DR7J 7FDRA 1RKJA 4PWWA 2NPIA 2EBEA 2FLNA 2BNWA 1U0HB 1M5PC 4WYLA 4KO0B 2XMUA 3EM1A 2ALZA 4HKQA 2HHXA 4IQMA 4PQUB 5GADI 3LOUA 4NLSA 2OH2A 2B6AA 2DNPA 1NH8A 2DNYA 3UE2A 4K5SA 3SFUA 5EX0A 4ZCLA 3CDUA 1FI4A 4CH7A 5I3UA 9RUBA 3R5BA 2NXUA 3MAAB 4A47A 3BDPA 4NRTA 1R8PA 2MGZB 3UI3A 1E6YA 3KUGA 1O8BA 1HI8A 2V4RA 3D54A 2ZH7A 3QQCD 1JKHA 1HQUB 1T05A 3RG6A 4M8LA 3VZHA 1ZTTA 3ZNJ1 3D1HA 5C2GA 5K8OA 4BWMA 1EAYC 4Y3CA 1SB6A 2YNGA 5K5MA 2G9OA 2P9EA 2I8EA 1IJEB 4QR0A 1X0FA 2E9TA 3KHRA 1N36F 2J7WA 2NZ4A 1NSPA 3DFEA 1RAAB 3VW4A 3CCWA 4CO2A 2RQCA 3DDNA 5LSRA 3Q89A 2DO4A 4OI4A 2W4DA 2QL7B 2OD4A 2I6WA 4CLLA 2Y3YA 4NOHA 2B51A 3ELHA 3GFZA 2LQ5A 1WF1A 1W25A 1S9GA 3JB9k 2E5HA 4LREA 1JK9B 1RT1B 2N3OA 3PX6A 4DR7F 1FRXA 4X84A 1FRMA 3OW2R 4I7FB 4NLUA 1UL3A 2Q1LA 1MWZA 1ZZNA 2V8HA 1R43A 3LP2B 2ZZMA 4XDDA 3BPDA 3AXMA 3QFHA 1RB0A 4C11A 4ID8A 5DRKA 5AJ3J 1JIHA 1OPIA 4YUDA 3EXCX 3PY8A 1U49A 3V6KA 1G6BA 1NSKL 3W65A 3NS6A 1PAUB 3DU6A 2N7YA 3W9JA 1EZZB 4YDDB 3FNNA 2KJWA 2QT7A 3A3PB 3BBCA 5HLFA 4F4AA 2ROGA 1Q5VA 3GZ7A 2DR8A 1CJUB 2HNDA 2BMBA 1YQHA 2ZUAA 4S0MA 3FEYB 4OHZA 2XYHB 3VVUA 2JC0A 1VRTB 1L5UA 1F3FA 3OFEA 5LJ3Y 2EFOA 2W2NP 4CLWA 2RNEA 4U95A 4G1QA 3ZZUA 3EWGA 1R27B 4LFBJ 2WW4A 3FRZA 1X4GA 4LSNA 2C22A 4ME7E 2MPUA 1FWLA 1SL0A 3SV3A 1EHWA 3T41A 2RDJA 3QRQA 2JEGA 1MWQA 1S1VA 1Q86T 2HK2A 3I9ZA 3KFWX 2QMXA 1YVFA 4CH0S 1EIYB 3FCHA 3IN5A 2V9WA 3U1NA 2HNZA 3DLKA 3VGTA 2C3UA 1QJHA 2P9GA 2PDAA 3BF4A 2KT2A 5GVQA 2JLGA 4JI2J 4A8XA 4M5MA 4AL5A 4IKAA 3R9LA 3VAMA 4V19X 1HPZA 1H98A 4UY85 1A9NB 3OXGA 5AXNA 1RWPB 4HTJA 3F44A 1GK8A 3C15A 3WC2A 3WIVA 1XK8A 1HWIA 3J81j 1H38A 4TY8B 1SUQA 2JFKA 3CD0A 5F8MA 1S7HA 3A3OB 2ZH5A 1A0OB 3IAS9 3FZBA 5DG9A 3JTPA 4AL7A 1GQEA 3OT9A 2E5IA 3JSYA 5F0WA 2YQ0A 1JWWA 1YBAA 5AJ3F 2DRAA 1RTDB 3AY0A 4O0IA 2WOMB 1YHQS 3KMQA 1VHFA 1RACB 1JLCA 2DR6A 1WEXA 1CSJA 2FLLA 2NXCA 4DHVA 4GVBB 3PW7A 4DX6A 3P8BB 1B70B 4KPYA 2EFPA 1WF0A 3MM7A 4KFBA 3JYTA 5DQIA 1VI7A 1S57A 1M5VC 2BZ2A 4X4QA 2QA4S 2UUTA 4OJGA 4FBUA 3MEDA 3J7A1 4MJWA 4RR5A 4YDXA 2P9CA 2XZDB 4LFBF 2QLXA 4IH7A 2HS3A 4C7QA 1WOSA 4RW4B 3BH6B 5KG4A 3V4IB 4LT6A 1FKOB 2XGPA 1TVRA 2WVFA 4TYBA 4KYZA 3MUMP 1M0SA 3OTOJ 4Y2AA 3A3NB 4NLVA 4TLRA 3IM9A 2MJUA 3CMES 3NMAA 2KYXA 1U2CA 3AOAA 2AYEA 4F4XA 1S1UA 2FJWA 2KFZA 4QOTA 2VC1A 3VQSA 4JI2F 1UAWA 5J2QB 4MKYA 2ZWPA 5GMEA 4U8VA 1Z2ZA 2B56A 2CQ2A 2KFYA 1YJVA 4XO0A 1BUXA 1QSYA 5T14A 4WK1A 2ZJRQ 4DV7J 3SDEA 3JQJA 3I0SA 4H4OB 1SV5A 3RBZA 1YGYA 2XTJP 4DBQA 4TQRA 3K8VA 2M8DB 2KO1A 5KFKA 2NPFA 3CD5A 1APSA 1VFJA 3HHKA 2H48B 4ANEA 1ZS6A 4OQJA 2XGQA 1RHQB 2V2KA 2V2QA 3FSXA 1U9PA 3HXMA 3R6LB 4YB5A 3PJWA 2C2RA 1NO8A 5LXRA 1NMEB 4ECRA 4KHPJ 1R0CB 3F56A 5A8RA 5D15A 5KFSA 2ZC3A 2Y8YA 5K14A 4PR6A 4DR6J 3C6UA 1QSLA 5J1EA 1DHMA 2J6SA 2QSWA 1H2UX 2IRUA 1YSJA 2J6UA 3B4MA 1AB8A 1Q8BA 2E7VA 4NCBA 2LEAA 3C66A 3IFEA 3LWLA 4WWSA 2E1MC 5DJBA 3ZNUA 2B7CB 3NMRA 1WSRA 1JJ2R 3VAFA 1BMQB 5E5NA 3M30A 1N6QB 1T3NA 1M1KT 1FFWB 4CH1A 2MZQA 3HULA 4N47A 5J1NA 5SZTA 3GLJA 3KTQA 1CS4A 3GJSB 1E6YB 3ONQA 5C2CA 1RA7A 3F41A 2E9RX 3ZZYA 3OTOF 4NYOA 2V69A 4URGA 4MFBA 1Q8LA 2CPXA 4OHYA 2RKIB 1LNQA 1MU2A 5E3AA 4ES1A 1GEHA 1NJXA 2Z8QA 1S9EA 4KHRA 4USVA 4A8OA 2X3DA 3N0VA 1VIXA 3PJ9A 3QWUA 1UETA 5LSOA 3MOJB 2YPZA 1S1TA 1YJUA 4CI0B 4HT7A 4A8MP 4WKYA 1VJWA 2MSTA 1RHMB 5LL6d 3OXFA 2RIJA 3V6HA 3RW6A 4ZLPA 4KIAA 4IG3A 4C4WA 4PWDB 4NLOA 2BM1A 1FJEB 2QFJA 4DV7F 1XIQA 3N9UC 4MYUA 1B99A 3IR7A 3BKUA 1NK6A 5HROB 3PVXA 1SJ4P 4U6PA 2MHNA 3PRDA 3ENVA 4A8KA 3VAIA 3E2EA 4KHPF 5AE3A 4RBUA 1WG5A 4C8MA 3W2WA 1IKVA 2YKMB 3QO9B 3G96A 1BQXA 4NA1A 2Y8WA 2J5AA 4DR6F 4ZVOB 4WIIA 2XNRA 4PYDA 1XWLA 2O67A 1Q16A 1ZPVA 3MUVP 3HFZB 3Q23A 4FXEA 3MHYA 1R8AA 4NZ0A 3T3FA 3CO0P 3VQTA 1ZTWA 2XS2A 4C11B 3DMJB 2ROPA 2IA6A 1N5QA 4B9UA 4JI4J 4CQ1A 3VAHA 3NOGA 3N4WA 1RA6A 1RTHB 4P74A 2WVCA 4DUTA 1JLBA 3WQPA 5I4MA 2K9IA 3W62A 2AJQA 4NA3A 4EYIB 2KM8C 1FVQA 1PBUA 1NLAA 2FJXA 2GVDA 2O66A 3Q2SC 2VG5B 1NDKA 5C25B 2ILZA 3JXOA 3TA1A 2ZH8A 5I3PA 1SCJB 5KAKA 4ZVRB 1Y4ZB 2A18A 3QFWA 4G1QB 4I2QA 3KG0A 4HI1A 2I5JA 4TKTA 2NUUG 5IS2A 3MI7X 3GP9A 4C3LA 2K1OA 2CZ9A 1HBNB 1S1VB 1CULB 3HKWA 1KBRA 2RHQB 2KN4A 4FN5A 2GFFA 4WIQA 2A6MA 3G8QA 3G82B 3KOAA 1RXOB 4OZJA 2HNZB 5DZ7A 5HL7Q 3G9CA 2FVQA 2CPYA 3C14A 2H5JB 2PIIA 5J2PB 2CQCA 5DG7A 1TELA 5FLXU 4RW6B 3TO8A 5FJ4A 3T5KA 2M52A 3K5MA 2BA9A 1F5AA 2CQ0A 2YNHB 2NCKL 2N82B 3KLGB 5EWFA 5AE2A 3EGWB 2Q3PA 2YH1A 5LSLA 1XR6A 1RAIB 4LR9A 5K8PA 1UEVA 5HANA 4EU0A 3PCOB 1UA0A 1Q53A 5D4PA 1OY8A 3M7VA 4GMKA 4ZOSA 4ZVSB 2V9KA 2IBKA 4AE5A 2Z30B 1MROA 3T1YJ 4JI3J 1VMBA 3HHLD 1FA0A 4IOBA 3MEGA 1REVB 4JI4F 4RNNA 1D3WA 1JLEB 1LKZA 1NPRA 2W25A 2W2OP 1CC7A 3HSDA 3EX7B 2HHVA 3DRSB 3CCVS 1GAOA 5M2RA 2HGLA 2CVIA 3NO7A 1JJ4A 3DLEA 3OFHA 3KLHB 1GMWA 4RW9B 1WC0A 3MMCB 3QSIA 4P9SA 5KFGA 4ZVGA 2VDHA 3KLEB 2RU9A 4EO8A 3GU0A 1NKCA 2LXUA 2RS8A 1CBKA 3CPWR 5C7PA 5DLGA 1RHJB 2A3JA 1FEHA 3I82A 4N7TA 2L08A 4KGMA 2YX1A 1JLQB 1NPPA 3K5LA 5E0OA 2KKHA 1NCLA 4J9LA 1L3SA 1WUUA 1RP5A 2ZKTA 3PNIA 1NNDA 1FT8A 1CVJA 2HFNA 2XQCA 4DX8H 4IR9A 2CQBA 2PSZA 3N5FA 2XWXA 4RL1A 4P52A 1NHVA 3T6JA 4KSEB 2KG0A 1R3NA 2XMWA 2MQQA 4WFNQ 2R2UA 2BE7D 2C3MA 5F8NA 1KOOA 3GYNA 4IRCA 3KLFA 4DR2J 2VPWB 1VQLS 1AROP 1WC4A 3D5MA 2HFOA 2ZM6J 3SDEB 1BWVA 4LFAJ 3D1QA 2UU9J 2E5GA 5A8KA 3PXGa 1W2BR 3JTNA 4P73A 1RHRB 2Z4PA 3NAIA 2CNLB 4Q43A 1FJGJ 4PG8A 1ARQA 2G2ZA 3QZ8A 3THVA 1PGZA 2F8EX 2KJVA 4LBHA 1TUVA 2OEJA 2DGVA 3ISZA 3ILIA 4OYXA 5A8RB 3T1YF 5K14B 4JI3F 1F60B 1EETA 4KR0B 3N6MA 1T95A 5B0EA 3I0RA 3MM6B 3I5BA 4RKUC 4ICLB 4QBUA 3M9OB 1KQGB 3EVMA 4NLWA 1YWXA 1IKWB 4I0WA 1KTQA 2DT9A 5HP1A 4NWBA 4BWJA 4TYAA 5KFOA 1JXLA 1MSWD 2LQJA 2N4DA 1VBZA 4DF4A 3Q8YA 4ID5B 1N0VC 2M8HA 4LVOP 1KOHA 1C1BA 1YK9A 2ZKUA 4AFFA 4QU6A 4GRSA 4F4YA 4NCGA 3W9HA 4O3NA 5D3GB 3BM7A 4DR3J 1YJTA 2BUNA 4M94A 2PE8A 5HO4A 1FDAA 2HG4A 5KFHA 1CS4B 1ELOA 2AYBA 3D6TB 1I6JA 1SBRA 2ACMA 3TX0A 2OEKA 2YY3A 4M5KA 3SYZA 4BCAA 4KBIA 4IR1A 4MFBB 2HMIA 4Y00A 2BQUA 4DL4A 3FMTA 3G87A 1FKAF 4ANCA 4FKXA 1ZOTA 1N5YB 1RUSA 8ATCB 1S9EB 4CWBA 2CNKB 2EK6A 3O1LA 1UKUA 2IRYA 2O5DA 1S0NA 5LOQA 1OHNA 3QYYA 4USTA 2F8HA 5B0GA 1U1KA 4DR2F 4F0MA 4NYPA 1TL7B 2FC8A 3R3TA 1R7IA 1T9VA 1S0MA 4IG3B 1RAHB 3IWLA 2WVEA 2DNLA 5KFLA 4P2FA 2ZM6F 5U47A 5L9XA 3DRYA 2UU9F 2Z2ZA 2HVEA 2FHKA 1HNWJ 1UVLA 4JB8B 1PKUA 5A0YA 1FJGF 3LA0A 4PXBA 4NLGA 1S4FA 1CJTA 4NZ6A 2IM1A 4BLGA 1B0TA 5JMNA 4L3KA 2VASA 3SCJE 3KYLA 1IKVB 3QMQA 3FBCA 3RB3A 2ZNZA 5D77A 3ZTPA 1Q95G 1OQ6A 4ZPBA 2DO0A 4DCPB 1N8RT 1TV6B 1Q78A 2CJBA 1MMNA 3M8PA 4M5GA 3D3BJ 3A8KA 2RUSA 5CA5A 2BJ3A 2KXFA 1WSVA 5C24B 2QE5A 1K44A 5EN1A 2NXNA 3DOLB 3D1OA 1YBUA 3PRBA 1U6ZA 4M1KA 1DQ9A 1XMQJ 2ABYA 1JX4A 4USHA 4RUHA 4QZVB 4DR3F 2UVRA 1H73A 3OLAA 2BOPA 5KFXA 4C8YA 1AZSB 2KU7A 3DU5A 4DSFA 1P8GA 5BXIA 1AUSL 1LW0A 1TL3B 4B9NA 2G2OA 3IR5B 3M2VA 4HYKA 4X62J 2OJ3A 1RCOB 5IQQA 4Y2KA 4C8ZA 1HHSA 2HHTA 4ZN1A 2NSCA 2BACA 2I5JB 2K2PA 3VAJA 3IRXB 2LA6A 1U1OA 3OUYA 4C2MA 3QWPA 3GPAA 1RAOA 4WXWA 5CQGA 3SI8A 1NU4A 5L1LA 2MY8A 2JEJA 3EPGA 3IS9A 4KV8A 1ZM2A 3P4UB 4LF7J 4OZNA 4YEAA 2ZBCA 2GJIA 4OLOA 4OYPA 2JVRA 1HBMB 1RWWB 1HNWF 1S10A 2MQ8A 4B17A 1TL1B 1H7WA 3AD8C 1BC6A 2HZVA 2V0NA 5B0CA 4DL2A 4MT1A 2IYGA 3OR2B 2F4VJ 3KHGA 5DQHA 1CQMA 5ETMA 5DETA 5IWAJ 4K4XA 4YB6A 5IFMA 1F5BA 2MKIA 1HNVB 4RUBA 3WIUA 4EO6A 1I3OB 3UNYA 2Y1RI 2QA2A 2VFSA 2CAXA 3EDRB 2XMJA 2ZH2A 1FXRA 3GJRB 4TXSA 3DGPA 3OTCA 4UY8T 1Q8KA 3DGVA 2BKPA 4N41A 3VEBA 4LRVA 3VTIA 2CKWA 2N7CA 1U47A 3IR6B 1G2EA 1S1WB 3NBPB 1VBXA 1E6VB 5D0GA 4K4ZA 3MEGB 2DCUB 3NEKA 3KK1A 3LUYA 5CXTA 3NS7B 4DX7A 3T19A 2GGPB 5F9NA 2K1RA 3PW4A 2KOEA 2AY0A 1XMQF 1MWYA 1FX4A 2CNOB 5FDLB 2OPSB 3BSOA 3VEAA 4CNZA 4U8YA 2HAFA 1X4AA 1YLXA 3IWNC 2V5HG 1U1QA 3J81Y 5KFWA 1DAXA 3CF5Q 3DC2A 1NSQA 4X62F 1SQFA 1KN6A 2R8KA 1YZ6A 5L38A 3TA2A 2PA8D 4O4RA 3P3DA 3MURP 3HVWA 2BRKA 3L7PA 4B9MA 2B9WA 1BDVA 4OYOA 2RS2A 1K9MT 3G71S 3CB4A 2KDOA 3QZ7A 3DYAB 2MZ1A 1VLOA 3OL6A 2IM0A 4KGZB 2C2ZB 3HSJA 2CADA 4WFAQ 1SL1A 4LF7F 2RE1A 1IWGA 1DURA 3G6VA 2R8JA 4RX6A 3P49B 2FC9A 1GMWD 4WZMA 3HFKA 3CIMA 3BB5A 1MN7A 2AGOA 3TWZA 1HW9A 2F4VF 3GTYX 4N56A 2ZH1A 5F8LA 5IWAF 2DXFA 2XY7A 4L73A 3TVKA 1T03B 4KQZA 2W8KA 1JLGB 3TARA 3RAMA 2VC0A 4IFVB 1KSPA 3E01A 4HACA 2U2FA 2VA2A 2GQ2A 2RUGA 3DRRB 2GHVC 1T8EA 2N3LA 4HHJA 1B0VA 1NKEA 4JI5J 4M5NA 5BYRA 2LP4A 3KJVB 1K1QA 2OSRA 2VH7A 1LWCA 3V6DB 3ZTOA 3KNGA 2GVZA 3I0RB 1HLWA 3U27A 3VGUA 2VF3A 3MTJA 2VPYB 3TAMB 3SSRA 3OL8A 1U48A 3J80U 1JB0C 1KDNA 2YQ1A 5D4NA 3O8WA 1FTRA 1JLFA 2JXIA 4Q5VA 4QYZJ 1IKXA 3EGZA 5CD4A 4ZLNA 3HHDA 3CJSA 2C2KB 3RBDA 1TKZB 3MR5A 1XJWB 3PO4A 5GADU 4L72B 2BQ3A 4F7VA 3H7HB 2MLYA 1H6KX 2O1PA 2FJVA 1U25A 4NCGB 2L9DA 1SH3A 2BANA 1FFSB 3TA0A 2E66A 3FEXB 3R2CJ 4ZP7A 4EK2A 1HFEL 2HNYB 1SI9A 3MAHA 3W66A 4DMZA 1HBOA 4Q0BA 1UTAA 1S48A 1Y00A 3FBFA 3R7NB 3TUJC 3GE9A 2F9DA 1JJCB 4LBPA 2ZJQQ 1TQLA 4UW2A 1PYSB 2P6SA 1D8YA 3R2DJ 4IQXA 4PZVA 3PHEA 4ILLA 1TTHB 1S0OA 1BQNA 3M32A 5CYJA 4ZPTR 2F8MA 4G3IA 1F2GA 4ENOA 3D66A 4KKOA 4ZHRA 3MR6A 1AFJA 8AT1B 2VKRA 3TEHB 2AJ1A 3GV8B 5H9FJ 3C2PA 4NZ7A 1S4EA 2PO4A 2V4JA 3HHLC 5KFAA 4FF3A 4RW8B 4FS1A 4ETXA 2OPRA 2EWHA 4DQPA 4FXWA 4TNOA 2DJWA 2VBXA 4QIFA 3SIPB 3MM5A 4ZVFA 1VQMS 3MD3A 4JI5F 3QGIA 2KI2A 3DM2B 3LQVA 3ZZPA 3M2UB 3GIMA 2BYCA 3CDWA 3U7JA 2GHPA 2F65A 3FVYA 1D9DA 4WFZA 1OWXA 2YX7A 2EFGA 4W90B 4A8FA 4BC7A 5IM0B 4ECSA 4Y28C 4OYIA 3CJ5A 2C3OA 2DGWA 2CJAA 2UUCJ 2ZBQA 4C3MA 3H2LA 1OIAA 4HHUA 1LWFA 1A6LA 3R5DA 2LCWA 2QL5B 4OYBA 5GAEU 3DXBA 5I42A 2L48A 3DRPB 4ZDNA 3BGLA 2BABA 1GXTA 1RT7A 2VV5A 1CG2A 2H51B 4HT5A 1IM6A 2IAJB 1M5KC 1U2RA 4I6WA 3T9NA 2M0GB 2WVBA 4F25A 2FJBB 2GAGC 4WYWA 1TKXA 4USMA 1FCAA 1R0AA 1C0UA 2ATCB 2IFXA 2VPZB 5KFRA 4A46A 2FVCA 4A8WA 2HVHA 1MLAA 3W5YA 4X4NA 2NR0A 3KKFA 2AJ0A 3K2YA 5MLCV 2FVSA 2ZD1A 2VG7B 1FD2A 4IRDA 2VFVA 3Q8UA 1M5SA 4I2PA 4Q7AA 3L95X 3IS9B 1VQNS 3SSSA 1HWLA 3UD5A 5BYQA 1S12A 4ZP6A 1AA1B 2QN6B 3D6FB 5KFUA 4X64J 1NJYA 2C1EB 3RRGA 3CCTA 1QTGA 5KG0A 1RABB 4X4SA 3BEGB 2RSQA 1U24A 1VK8A 3A1YG 4C97A 4FBTA 4WFXA 1S5ZA 1HD1A 4NLXA 2BE2A 1RZMA 2QGFB 3H25A 3AT1B 3R97A 1PJ7A 3MF5A 4UQGA 3MWBA 4ER8A 4ZVPB 2EK1A 4NMXA 1VOMA 2AMCB 2YKQA 5KFPA 4F4KA 4W98A 1W2IA 2UUBJ 4RNOA 1RAJA 4LQ9A 3D4JA 3HVRA 1KKHA 2K7KA 2Z58B 2N4CA 3DGPB 4JBCA 3UVJA 4O0NA 4D3HA 4C6AA 4C48A 5E2QA 4DQRA 3EZUA 5FIIA 1B3TA 3I9V9 2UUCF 3MR3A 2LXIA 2HWHA 3I55S 2PFDA 2J8SA 3QSYB 2JRSA 3H42A 3QT8A 2CA9A 3PYGA 4FDFA 3ZZTA 1QAIA 2XWYA 2OFGX 4ITSA 3MMJA 4P71A 3CULA 2IC3B 2PMZD 4F2RA 4KHMA 4NE9C 4C8KA 1KLMA 3FC9A 5E41A 4DL3A 1VBKA 2R8HA 3D3CJ 2MSSA 4RU9A 4IDKB 4ED4A 5ETPA 4QWBA 3ZO7A 4OI6A 5LJ5Y 3KG1A 4O3RA 3RJMB 4JOUA 4EGLA 3LP1A 2AGPA 1K0VA 4IYQA 5D0RA 3ENQA 3DHWC 2W2MP 5G0RA 3FZ2A 4P2XA 3E51A 4B3TJ 2GMHA 5LMNJ 4ES3A 3N6NA 4NXNJ 3TAPA 3DLJA 4CTAA 3KK3B 4TLQA 2JLFA 1SH2A 4OZ2A 2WTFA 3DOMA 2QLBB 2LYVA 4NXMJ 3DDKA 5KG7A 3K8WA 1BHNA 4X64F 3GIJA 2OI2A 3PW5A 2QC3A 1WEZA 1VLYA 1MN9A 2HGMA 4PEOA 1WC1A 2GQCA 4WP8A 3ET6B 2ACYA 1OYDA 1GMUA 3UR0A 4P72A 4ZVEA 4B3OA 4R8UB 5B0FA 4DUYJ 4RW7A 4DR4J 3GV5B 4ZMMA 1ZAXA 5KT7A 2J6TA 1OPZA 3IBWA 2PMWA 4ED7A 1NRKA 2UUBF 1HIYA 2ADCA 3K58A 4DPOA 2QLWA 3T1HJ 2EC2A 4ELUA 4ZS6A 3V4MA 1RTIA 4M5LA 2JOQA 1HNZJ 3IC1A 1WKJA 4DX5A 1QE1B 3NGKA 1LWCB 3SEOA 2KH9A 2Y1JA 3C16A 4E2FB 1BD6A 1RT3A 3HD2A 1GX5A 2JSXA 2X1GA 5KT6A 1RKIA 2E5JA 3MM9A 5J2MB 2BJDA 2DR9A 2RQ4A 3S8SA 5LXYA 1UCNA 3FDSA 2M7SA 2M88A 3CC2S 2CFXA 3ADAC 3ETOA 2DXEA 2XSJB 4NEZA 2HQ3A 2ASYA 4PXEA 3CXCR 2YKPA 3A8JA 1WELA 1K8AT 1KQSR 3A12A 4DQSA 1IVZA 2UVWA 2MKHA 1R31A 2BANB 4LUBA 1KQFB 1VRUA 2VOPA 1NZAA 4I6YA 3LGNA 2CJQA 4B3SJ 2W24A 2ZE2B 3CJTA 4DWIA 2FB0A 2A2CA 5HATA 3PZPA 1IBKJ 4AQYJ 1RAGB 2MKKA 1OS5A 5K9FA 1S77D 1ZETA 4B3TF 4O4GA 5LMNF 5KG2A 4NXNF 4IFYB 3PX4A 3SXLA 2FVPA 4LF1A 4WU3A 3SV4A 1VIOA 2HFVA 3MZIA 4NXMF 4LF6J 4X2BA 3C6TA 4HI2A 5F8GA 4ZKAA 3BBFA 3HHNB 2DY9A 1RWMB 3BQ0A 4DL7A 3K59A 4XPEA 3H0PA 4OX7A 1DJ0A 7AT1B 3MEEB 1S76D 4NRUA 1WJ9A 4ZHRB 4W4MA 4UT4A 4Y0FA 4DUYF 1NHKL 5L9NA 2KZZA 4DR4F 2FLPA 3AQPA 5GMDA 3UWTA 4PUOA 2RILA 2M9KA 3M1VA 2DEJA 2K6LA 1M90T 1S72S 2C42A 2J0QD 2OPRB 2IDLA 4FNHA 3DI6A 3T1HF 1RAEB 3G2XA 1VQ8S 2C2OB 3MM5B 1H72C 2DYAA 3PV8A 1HNZF 3CW2C 3VHQA 2F40A 4V19J 2OIHA 4QPXA 1H74A 3A4TA 4NLYA 3CJKB 4WTYA 1FDBA 1NHUA 4CNYA 2H1OE 2GQQA 4DS4A 2FUG9 5T41A 2IYIA 2W9CB 1VK3A 1VR6A 2C3YA 4L6V3 2OTLS 3DNCA 4BS2A 1S1XB 2KL8A 4DCJB 3DXSX 2R7RA 1U26A 4V1Ak 3SCIE 3W61A 2VKZG 3QT7A 1LWFB 2HZCA 1KVJA 2HIYA 4MKAA 5D4LA 1GTEA 2GO9A 5I3QA 4FYDA 2FYXA 4PKDB 4QU7A 2HAIA 4P2MA 1ZM4A 4CZCA 2FGOA 2AYGA 3HP6A 1F9FA 3JSBA 4ZPDA 1UWAA 4B3SF 2POKA 3OR1A 4QIGA 4QW9A 2KFNA 1IBKF 4AQYF 2Z57B 3QGPA 3RAQA 3VVTA 3BPSP 5B0BA 2Q66A 1X5SA 4UUWA 4EBEA 3HLUA 4Z7CA 1C0UB 1XNRJ 1Q82T 1M5OC 4LQ3A 5HVHA 5RUBA 1KS2A 1N5VA 2D41A 4YOEA 1HQEB 1LK5A 3QLHA 4USIA 1FKPA 1LWEA 2GJFA 4DLGA 1YITS 4ZITA 3BN4A 2J76E 2B4VA 4ILMA 4KY3A 1U45A 3M8ZA 2E9ZA 1B0PA 3W5ZA 5F8HA 5ITHA 3DLGB 4YN3B 2IJFA 2ZJPQ 2KXNB 3K5PA 2MJNA 2MLZA 3HVAA 1RT5A 1YI2S 2BEFA 3TANA 1PYOB 3JQKA 2AEMA 3LTOA 1MG7A 2YNFB 4YR3A 1UA1A 2Q2KA 4ZP8A 3CUNA 1GNKA 2LQ9A 1PSDA 3E8OA 1BDTA 3HD1A 2R7WA 5B08A 2YKNB 4DPWA 3DDIA 4IH5A 2R9LA 1N54B 3SZ2A 1T0TV 1N5SA 4NI2B 4YHHJ 2F63A 4WFBQ 2JXGA 1IWAA 2BSQE 4EBDA 1P94A 1N0UA 1GTHA 3LF0A 4A4JA 2VDIA 5MAOA 3UVJB 2F5GA 3JSRA 1T7PA 3VCDA 5C42A 4DI6A 3CGIA 2DBBA 2ZDOA 4QR2A 4HDHA 2W7PA 3CCJS 3ETMA 5J2NA 2RMLA 4F04B 4NL5A 2IBOA 3AHPA 1BQMA 5CABA 3MMAA 1URRA 2OLWA 1C0TA 3GFHA 5HK4A 4WE1A 4EEYA 3H40A 3SQGA 3KWMA 1VQKS 1RT2B 2WK4A 4X4UA 3JAMY 2IM2A 3N6LA 1XMBA 4ZPCA 3C19A 1XNRF 3MPDA 1CEZA 1RU2A 4DFMA 1SC4B 2CZVC 2ZUGA 3MECB 3FT7A 1DTTA 5KTQA 3BYPA 1IR2A 2DIVA 2KTQA 4YP3A 5G0RB 2BKOA 1WOPA 4ANDA 1WHWA 2ZHOA 3FSIA 1RWUA 3CT9A 4OFZA 4NLTA 4CLFA 2CJKA 4JI7J 4Q8EA 2YWFA 4DUZJ 3AJDA 1LW2A 2XS7A 4DV1J 2VFTA 3THPA 3IAM9 5GAHI 2GCFA 2FJEB 2DH7A 4NLRA 2VB6A 1IBMJ 3CCES 1RJJA 4QW8A 5K8NA 3UDEA 2ZITA 1JNRB 5F8JA 1AT1B 5L8RC 2J9EA 4H4KC 1UPMB 2AF6A 3SFGA 3OFFA 4RW7B 3M2RB 3BGRB 2LMIA 2CJ9A 2C2MB 4DPUA 5A8WA 4ECXA 4G1PA 2BJ1A 2RDDA 4ERDA 3HF5A 3ISND 4CO3A 4N77A 4ALZA 4YHHF 1WACA 1HD0A 3KHLA 1HBUB 3RRHA 4F3MA 3KHHA 2YKOA 2DCLA 4JUZA 3EVWA 5ETRA 4YR2A 2YNIA 3JSMB 2GV1A 1YJNS 4I67A 2FHMA 5KT5A 2C28A 1XMOJ 3MTKA 4OJHA 1VQ6S 4ECZA 4EYHB 2CPIA 2HEKA 2OELA 3CCRS 3NNEA 3DHXA 1R6YA 1WTBA 4OHVA 1XN9A 1ACMB 3HJFA 4CO5A 2E5LJ 4R5PA 2KVQE 3MMBA 1IM4A 5CD4H 3VV2B 3GWCA 4DSLA 2JVOA 2DHXA 2FLOA 3ITHA 4O4GB 1RTZA 4B9VA 2KYZA 2HK3A 4DUZF 1HI1A 2MZSA 1UEUA 2BKNA 4DV1F 2RVJA 1WI8A 3CJ3A 2BW2A 2BXJA 1IBMF 4DN9A 3J7ZT 3NCRA 4DL5A 2HQDA 1WI6A 3CJ0A 3NWGA 4J9OA 3MM8A 1Y5NB 2DH8A 2OPPA 3JS9A 1HYSA 3FEZA 1FJCA 2ZBPA 5KFYA 2NXEA 1TKTB 4KE5A 3R1LA 2P8IA 5A2QU 2HLUA 3OVAA 4WZQA 2M5YA 1WKLA 2MLXA 5D8HB 5GAEI 2V6AA 3UQSA 2AZ3A 1TR0A 1U1PA 1IQTA 2IVMA 4KT0C 2BA3A 3HVTB 5CYMA 4O3OA 4RLEA 2QMUB
chains in the Genus database with same CATH topology
2WVBA 3VEAA 2BNWA 1Q5YA 2BJ8A 2CPGA 1MNTA 2HZVA 2F1FA 2BNZA 2K1OA 2BJ1A 2BJ9A 3H87C 1Q5VA 1U9PA 2WVEA 2RBFA 3VW4A 1IRQA 4FXEA 2BJ7A 1EA4A 1ARRA 2CA9A 1BDTA 2K29A 1PARA 2WVFA 3FT7A 2K6LA 1BDVA 2Y3YA 2WVDA 3LGHA 2KELA 4D8JA 2CAXA 2JXGA 1BAZA 2BSQE 4ME7E 2WVCA 1QTGA 1P94A 2NZCA 2PC6A 3VEBA 2CADA 2HZAA 3QSIA 2K9IA 2K5JA 1NLAA 1ARQA 3OD2A 3PHTA 2JXHA 3BKFA 3QOQA 2JXIA 2FGCA 3BKTA 3BKUA 3GXQA 2H1OE 1X93A 1B28A 2CAJA 3FMTA 1B01A 2AY0A 4HV0A 2BA3A 1MYKA 1MYLA 2BJ3A 2GPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVB A;  3VEA A;  2BNW A;  1Q5Y A;  2BJ8 A;  2CPG A;  1MNT A;  2HZV A;  2F1F A;  2BNZ A;  2K1O A;  2BJ1 A;  2BJ9 A;  3H87 C;  1Q5V A;  1U9P A;  2WVE A;  2RBF A;  3VW4 A;  1IRQ A;  4FXE A;  2BJ7 A;  1EA4 A;  1ARR A;  2CA9 A;  1BDT A;  2K29 A;  1PAR A;  2WVF A;  3FT7 A;  2K6L A;  1BDV A;  2Y3Y A;  2WVD A;  3LGH A;  2KEL A;  4D8J A;  2CAX A;  2JXG A;  1BAZ A;  2BSQ E;  4ME7 E;  2WVC A;  1QTG A;  1P94 A;  2NZC A;  2PC6 A;  3VEB A;  2CAD A;  2HZA A;  3QSI A;  2K9I A;  2K5J A;  1NLA A;  1ARQ A;  3OD2 A;  3PHT A;  2JXH A;  3BKF A;  3QOQ A;  2JXI A;  2FGC A;  3BKT A;  3BKU A;  3GXQ A;  2H1O E;  1X93 A;  1B28 A;  2CAJ A;  3FMT A;  1B01 A;  2AY0 A;  4HV0 A;  2BA3 A;  1MYK A;  1MYL A;  2BJ3 A;  2GPE A; 
#chains in the Genus database with same CATH topology
 2AGQ A;  1DLO B;  2LU1 A;  1RTJ A;  2ASJ A;  4L74 A;  1RI7 A;  3R7B B;  5CYQ A;  1K1S A;  2EG2 A;  4KTQ A;  1K0T A;  2QJ3 A;  1DQ8 A;  2B43 A;  4LF4 J;  2HQC A;  4CP5 A;  4YB7 A;  2HS4 A;  1D09 B;  4F3O A;  3EJM A;  1UWB A;  1S9F A;  2MKY A;  5IT9 Y;  1XMO F;  2E7W A;  1SPB P;  2A2B A;  4C0B A;  2Y1I A;  1S6O A;  2EC0 A;  1FE4 A;  2MEW A;  2NXJ A;  4CLU A;  1UP1 A;  2UUW A;  4DL6 A;  2HBQ B;  2KT5 A;  4CO0 A;  4DLE A;  4KGV B;  1X7V A;  5DS7 A;  2G1H A;  1Q1K A;  1U09 A;  1RWX B;  4O44 A;  3DOK B;  2V50 A;  5HAO A;  2D3Z A;  2DGO A;  3TVZ A;  3PYF A;  2G4B A;  2ZH3 A;  1TP7 A;  2E5L F;  4MMO A;  3W2V A;  2CQP A;  1HA1 A;  3CTR A;  1S6Q A;  1F1B B;  2ILY A;  3IA0 A;  3N5B A;  5GAG I;  4P10 A;  4ZVQ B;  4FYY B;  3CDE A;  1FK9 B;  5F0U A;  2XO7 A;  3CVK A;  1RGV A;  1ITP A;  2RJZ A;  4F26 A;  2WB1 D;  2IRX A;  1HNI B;  4MJK A;  4O23 A;  1EP4 B;  1F9H A;  4UF4 A;  4CYU B;  2QV6 A;  4OJ3 A;  2OAU A;  2IMO A;  1TUG B;  4CO1 A;  4A8S A;  2XS5 A;  3HCX A;  5AXL A;  4LSL A;  4HVZ A;  3M4X A;  4J37 A;  2PI4 A;  3FBB A;  1ARR A;  4MAK A;  1VCT A;  3GIR A;  2OTJ S;  3OSP A;  2F3J A;  3UDC A;  1PJ5 A;  2CDQ A;  1FF2 A;  1T9W A;  1RWO B;  4EFA C;  4USK A;  3KK2 A;  3CC7 S;  1UFK A;  5AT1 B;  3X1L B;  1B64 A;  1JLA B;  3TYT A;  4K7Q A;  5DLF A;  3Q22 A;  4DV2 J;  4GO5 X;  3SCL E;  4BHQ A;  4QYR A;  1FER A;  4LF4 F;  1QUP A;  4AXJ A;  4LRB A;  3TZX A;  3BDE A;  1T02 A;  2JNJ A;  4PG4 A;  1P6T A;  2V63 A;  2Q79 A;  2UV8 G;  1DBD A;  4DQI A;  1SIW A;  1L3U A;  3IG1 B;  1WTF A;  1BGX T;  3TOQ A;  5HJX A;  2BNZ A;  2YWE A;  3ILL A;  1RWN B;  5M2U A;  3IO1 A;  4IH6 A;  4D3G A;  2EI5 A;  5DG8 A;  2QX0 A;  3QGH A;  3BO3 A;  1BLU A;  2DNQ A;  1FES A;  3N28 A;  1AFI A;  1RDR A;  4MK7 A;  2NYH A;  4J9V A;  5D4O A;  5ETS A;  3ILJ A;  4DR1 J;  3T5J A;  3C8Y A;  3ZZ0 A;  2Q6C A;  2WON B;  1SKR A;  1CJK A;  4QIW D;  4J7C A;  1H7X A;  4YS2 A;  2B9Y A;  3LH2 S;  2R7Q A;  2AN7 A;  1KON A;  3LP0 B;  4PWU A;  3SQG B;  4B08 A;  2W9A A;  1FDN A;  3UPF A;  1U0H A;  1CJV B;  1WOR A;  1MYL A;  3NGU A;  1PG5 B;  2BX6 A;  2PEB A;  4KO0 A;  5D78 A;  3OJU A;  4ELV A;  3VGS A;  1NEE A;  3VGV A;  3G8S A;  1JXV A;  1P9Y A;  4PQU A;  1LEO A;  2J9D A;  3H4B A;  1TFW A;  1DTQ B;  2HLT A;  2JFD A;  1UW9 A;  3IWX A;  2FHJ D;  4O3S A;  4OV6 A;  4Q8F A;  1GT8 A;  1Q0N A;  3R1H A;  3K5N A;  3RU0 A;  3MAA A;  2O01 C;  4DJB A;  2BJ7 A;  2MGZ A;  1AYE A;  5AXM A;  2V67 A;  1O51 A;  2DD8 S;  1UJ5 A;  1FFG B;  3AQO A;  1HQU A;  4FKY A;  4F67 A;  3BJY A;  4DV2 F;  2R7X A;  3BGU A;  5F41 A;  2B6A B;  1ZM3 A;  2AWZ A;  2HZA A;  3NNH A;  1B7F A;  2HRY A;  1ZM9 A;  3KUE A;  5A8W B;  3Q8Q B;  5I3U B;  1Q79 A;  3D9B A;  2J0S D;  3B54 A;  4L75 A;  2RB7 A;  2OPQ A;  5ETV A;  2DIT A;  2DGX A;  1UPP A;  1VBY A;  3BSN A;  5DO2 A;  1RE1 B;  2XNQ A;  3Q8R B;  1WHX A;  4NX9 A;  1QTM A;  1UZH A;  1BE4 A;  2I38 A;  1JKH B;  5DM7 Q;  2CRL A;  1T05 B;  3AOC A;  4MH8 A;  4WTO B;  4R0E A;  4QWC A;  2I0X A;  4YB1 P;  4LF2 A;  4KH0 B;  3CJ8 A;  2MZJ A;  3EIC A;  2AV5 A;  2R7T A;  2YNG B;  2B4P A;  3RB4 A;  4IO9 Q;  3I96 A;  4OZ3 A;  2ZZT A;  4C98 A;  3D68 A;  1RT1 A;  3RR7 A;  3NNA A;  2JDJ A;  2UZA A;  4I7F A;  1U8S A;  1PCA A;  4TU9 A;  3PO5 A;  2AJ2 A;  1LFW A;  5G4D A;  2MDA A;  4RWW A;  3MD1 A;  1UJ4 A;  3UD4 P;  4TY9 A;  1IKY A;  2WSE C;  3PW2 A;  2EEY A;  3ZC4 A;  2IHR 1;  4ZJO A;  2CPZ A;  1EKS A;  9ATC B;  1XC9 A;  2C2N A;  1S9G B;  4M63 A;  4OX8 A;  4HV0 A;  1N32 J;  2FVR A;  3MPU B;  1S0V A;  5F9L A;  4F8R A;  3UR3 C;  4A48 A;  2R8G A;  1CJU A;  4LIW A;  3PM9 A;  2KKE A;  4ZPV R;  1VRT A;  2K8G A;  3N79 A;  2H4W B;  1TKD A;  2DHG A;  4EWT A;  2VON A;  1QUV A;  1UFW A;  4C0O C;  4Z2X A;  5HJY A;  2HHS A;  2EFQ A;  5IXU A;  3EDQ B;  2V8P A;  3WZ0 A;  2PGC A;  5IV4 A;  3DLB A;  5HLF B;  2R4F A;  1RTJ B;  3AAW B;  2BVZ A;  2HND B;  1T9T A;  2UVV A;  2CPJ A;  2DIU A;  3U1L A;  2HS0 A;  3H98 A;  4F36 A;  4FNI A;  3AJ2 A;  4OI1 A;  1U7L A;  4DU7 A;  3HT0 A;  3HMJ G;  1SJQ A;  4LSN B;  2DKO B;  4EZ6 A;  2LEP A;  4U96 A;  4KC5 A;  4FS2 A;  1UVK A;  1UMJ A;  2LKZ A;  2V8D A;  3K17 A;  4ATN A;  2GA7 A;  2HPU A;  3MXH P;  2VUG A;  4Q44 A;  2EKY A;  3KJN B;  2J0X A;  3PW0 A;  5ETN A;  2ALY B;  4ZJQ A;  4DPX A;  2QA1 A;  3PKM A;  3DLK B;  3D6M B;  3TJA A;  3EVO A;  2NRE A;  2AU0 A;  3M8R A;  1S99 A;  4ZVH A;  1IBL J;  4GO7 X;  3V81 A;  4ZA1 A;  3KLI A;  1S6Q B;  1HPZ B;  4ZCI A;  3GCW P;  3MOZ A;  4KJI A;  2WOM A;  3TZZ A;  3C15 B;  1EJ7 L;  2ZBR A;  2OMO A;  3BSA A;  3EUN A;  2ZVI A;  4IO1 A;  2YX4 A;  2NZC A;  1N32 F;  2LEB A;  1V9O A;  4GVB A;  3K89 A;  4E98 A;  1SUQ B;  3V2U C;  1S49 A;  4FPR A;  4ZLJ A;  3W8G A;  4EZ9 A;  4ECQ A;  1IBC B;  3B8H A;  3MDF A;  3MAQ A;  3MFH A;  4Q45 A;  4DSK A;  2JEI A;  2RDI A;  4PQA A;  2J7U A;  2Z2M A;  2G2Y A;  1QD1 A;  3ISN C;  1RCX B;  2XB2 D;  1JLC B;  1UFL A;  4RW4 A;  3M9M B;  3V4I A;  1FKO A;  4X65 J;  4DSJ A;  1IN0 A;  3SMZ A;  3ENA A;  2VA3 A;  4WKR A;  3MM7 B;  2R2R A;  4KFB B;  4WP3 A;  3JYT B;  1IRQ A;  4N76 A;  4JI1 J;  3GG1 A;  3CJ4 A;  4K4S A;  1CC8 A;  1UEK A;  3U02 A;  3MED B;  1PAE X;  3AB4 B;  3PTW A;  3QJJ A;  2KRB A;  2E1A A;  5CH7 B;  1ULR A;  1XER A;  2HHP A;  2G1D A;  2APO A;  4F3Q A;  3IGV A;  2L9W A;  1FEE A;  4DV0 J;  4DQQ A;  1FXL A;  2YQ3 A;  1Q8I A;  4X66 J;  4HL9 A;  1UVN A;  1TVR B;  2IIH A;  4U7U K;  3WX8 A;  2JHE A;  1U2F A;  2OP5 A;  1YG0 A;  2V2Z A;  4H4O A;  2QTW A;  4I6A A;  1OSC A;  3ILO A;  5D0E A;  3QBC A;  2MMY A;  3QID A;  3UD3 P;  2QO3 A;  1LWX A;  2K3K A;  5ADZ A;  1HR0 J;  4HH1 A;  4JV1 A;  2V4Q A;  2GO8 A;  1S1U B;  4JI0 J;  3IXQ A;  3D7S B;  4QYZ K;  1NAQ A;  2D9O A;  2Y1L B;  4ZVT B;  4IRK A;  1IBL F;  3LAL A;  3FQK A;  2Y9H A;  1NZ8 A;  2A0F B;  4LMZ A;  2QRR A;  4P7V A;  4IOA Q;  2KB2 A;  1Z1Z A;  5IC6 B;  3VR1 A;  2XUL A;  1Z2L A;  3I0S B;  1CPZ A;  1SV5 B;  5E3R A;  4B9S A;  1CQN A;  1ZAV A;  1SH0 A;  1S79 A;  2DNO A;  2ADL A;  3QJL A;  3CWJ A;  2M3D A;  5E33 A;  3VZI A;  3AD7 C;  3OV7 A;  1Y3K A;  5KT3 A;  1VJQ A;  2G13 A;  2F9J A;  1N6Q A;  2XBP A;  3BYR A;  2Z56 B;  3GR1 A;  3C6U B;  3W5X A;  2K5J A;  5J1E B;  2QL9 B;  1J5E J;  3PEJ A;  3WHI A;  5HMZ A;  1U6F A;  2RD5 C;  3MPY A;  1YJ9 S;  1FTC A;  3GYX B;  1QY7 A;  5DDP C;  2E29 A;  2H65 B;  1PYT A;  4X65 F;  2RAQ A;  1J2V A;  2ZOG A;  1RYS A;  3FCW A;  4FYX B;  5H9F K;  1F6T A;  3BQ2 A;  4ZCK A;  3NY0 A;  4JI1 F;  1T94 A;  1Q5Y A;  2W4P A;  2RKI A;  2BE9 B;  3M30 B;  1Q7Y T;  4DS5 A;  1DAR A;  4YQW A;  2H9Z A;  4ZIW A;  2EKN A;  4DV5 J;  3MPW A;  1HAR A;  3WBZ A;  4WP9 A;  4DOZ A;  4J9K A;  4PG6 A;  4DV0 F;  2AEF A;  3NNC A;  2B9E A;  2OPQ B;  3RW7 A;  4LBI A;  4C8O A;  3SCK E;  1N5T A;  5B0D A;  3HKZ D;  2QSF A;  4X66 F;  3V6J A;  1P9Q C;  4WXO A;  4FP9 A;  4PXD A;  4J91 A;  4LJM A;  5CZX A;  3KJQ B;  4PWD A;  1DZ5 A;  3NXZ A;  1IQZ A;  4WU2 A;  1BAZ A;  5HRO A;  3I32 A;  1MU2 B;  1ICE B;  2E1R A;  1HR0 F;  3UCU P;  1ROF A;  1TL4 A;  3GG0 A;  4RJV A;  3P5T L;  1AW0 A;  4JI0 F;  2X3G A;  4UOC A;  1EKR A;  4NLP A;  4XK8 C;  4J9N A;  2EPI A;  2EG1 A;  1LOU A;  1S1T B;  1SXL A;  2YKM A;  3QAT A;  3O5T B;  2BOA A;  4CO4 A;  3QO9 A;  1WEY A;  3JQM A;  2DHH A;  3RB0 A;  1KRP A;  4ZP9 A;  2EBG A;  1RWK B;  4WJB A;  3E3X A;  2IY5 B;  3AB2 B;  4AUK A;  4NAS A;  2P2C B;  3LAK A;  3BV8 A;  1LFP A;  1RBO B;  2HKE A;  3GJT B;  4YFU A;  1DQA A;  2QLJ B;  4LFA F;  3HX9 A;  3IR7 B;  4KAI A;  2BRL A;  3QRR A;  1Y7P A;  2LFV A;  1NUE A;  3DMJ A;  3PAC A;  5ETT A;  1IKY B;  1IJF B;  4BDP A;  2K3I A;  4FYV B;  3BR9 A;  2CG4 A;  2ZNY A;  3R6G B;  2Q43 A;  3W2W B;  2HWI A;  5A76 A;  1RTH A;  4N5S A;  1N48 A;  1C4C A;  3RAX A;  2GAH C;  1J5E F;  1S59 A;  1X5T A;  1BY9 A;  1RU1 A;  2AJ4 A;  2VG5 A;  5C25 A;  1Q16 B;  4TU7 A;  2HVZ A;  3PJX A;  4LR8 A;  4DZ6 A;  3Q86 A;  3TVY A;  4CIO A;  4NLD A;  4DR5 J;  1MW7 A;  4OZL A;  3Q8P B;  3CD7 A;  2QEX S;  2HGN A;  3FFI A;  3EZO A;  2MHE A;  3BKT A;  4QIV A;  1VQS A;  3FGV A;  3H59 A;  1URN A;  5HMW A;  3IGN A;  3G6E S;  1JLB B;  2H1Y A;  4DV5 F;  2X7I A;  2M70 A;  3HZG A;  2JEF A;  2GVD B;  2NLW A;  1HBN A;  1CUL A;  3BR8 A;  5JJB A;  1YRX A;  2MKJ A;  2RQK A;  3M8W A;  3G82 A;  3QT5 A;  3PFE A;  3HHL A;  3KDN A;  5KOW A;  2W2Q P;  4FXV A;  1Y11 A;  4I2Q B;  2FZG B;  5A6P A;  3TZW A;  5J2P A;  2CWX A;  1XBW A;  4RW6 A;  1VQY A;  1KP6 A;  2YNH A;  3OHA A;  3KLG A;  4OZ0 A;  4OZ5 A;  1KEK A;  1FXD A;  2IVF B;  3WDO A;  4NLQ A;  2D9P A;  3CJ2 A;  3DKD A;  4M5D A;  2YPY A;  2VFU A;  4DN0 A;  1D9F A;  1Y0H A;  3GIK A;  2G0J A;  3UN2 A;  2DK2 A;  2EXU A;  3C14 B;  4ZLL A;  1VHI A;  3P96 A;  2GIQ A;  4C0H A;  4DZD A;  2W9B A;  3AOD A;  3MUT P;  1T9U A;  2GMJ A;  3V81 B;  1WNE A;  3KLI B;  2DNG A;  1REV A;  5H1S V;  3GSD A;  3K5O A;  1SJ1 A;  1JLE A;  3L4B C;  1U1R A;  4USU A;  4FVM A;  2FJD B;  4JYA J;  2YWK A;  3M6W A;  2FY8 A;  3KMS A;  3MFI A;  3DRS A;  3M6U A;  1AXQ A;  3R27 A;  1TMM A;  1QTN B;  4CLK A;  1EAR A;  3KLH A;  2L41 A;  3VAG A;  4RW9 A;  1SC1 B;  2UXC J;  2FZK B;  2NS1 B;  3TEG A;  1MRO B;  3MMC A;  4DR5 F;  1SKU B;  1X9S A;  3KLE A;  4EBC A;  2HBZ B;  4Y2M A;  3GJQ B;  5BR8 J;  5HVG A;  3D28 A;  4TVA B;  2CZ4 A;  3HM9 A;  4R25 A;  3NGR A;  4FZV A;  1UVI A;  2B3T B;  3J7Y I;  2VZ9 A;  1ZA1 B;  2UXD J;  2P5V A;  1JLQ A;  2MQN A;  1QLN A;  3PG9 A;  3FK4 A;  3D67 A;  3QPI A;  5H9E J;  3MCO A;  2XEX A;  3DLE B;  2WW8 A;  2AW0 A;  2WBM A;  2YXL A;  5KFQ A;  2CG8 A;  3AD9 C;  3RBX A;  4DFP A;  3OSN A;  2J0W A;  4F50 A;  4DPY A;  2UUA J;  4TN2 A;  2ZOF A;  3WX4 A;  1NDP A;  1EQM A;  1O5J A;  5FD1 A;  4HTI A;  2JH3 A;  1J5O A;  1X4H A;  2FHO B;  4I68 A;  4K2X A;  5JXS A;  1IR1 A;  3G86 A;  3AA9 A;  4B02 A;  1VGY A;  4L3N A;  2DHS A;  4J9U E;  1TK5 A;  2AQ4 A;  2XY5 A;  3H8Y A;  3KLF B;  3BN7 A;  4RNF A;  5KT4 A;  2E7X A;  3P45 B;  2R7U A;  2JXH A;  2HFZ A;  3MM6 A;  3CCQ S;  1XTZ A;  4ICL A;  2HSE B;  5HI7 A;  2BJE A;  2ZH6 A;  4JYA F;  5FLX Y;  4G1I A;  4UZC A;  2DHA A;  3CC4 S;  1RK8 A;  5A8K B;  4LSZ B;  2MKC A;  1IKW A;  4IOC Q;  4JV5 J;  3R5A A;  5KFM A;  1NK0 A;  2UXC F;  2JZ5 A;  2LVW A;  4ID5 A;  2F1F A;  3TX8 A;  4DU8 A;  1TK8 A;  5BR8 F;  3HT3 A;  1EET B;  2FDN A;  3C46 A;  2WHO A;  3AH6 A;  1WHY A;  2AYM A;  5D3G A;  3OLB A;  3HPO A;  1OYE A;  1WC3 A;  2GML A;  2DRD A;  3G6Y A;  3BO4 A;  4M95 A;  3HO1 A;  3T6B A;  5GAH U;  2GC8 A;  2UXD F;  3R8Y A;  4H54 A;  3GII A;  4AD6 A;  2VL1 A;  1OMS A;  1HKA A;  5HP1 B;  2WSF C;  2IPO B;  5KFC A;  1VQP S;  2XCA A;  4RZR A;  5L46 A;  1C1B B;  5LT5 A;  1N5Y A;  1X31 C;  2UUA F;  1ZAW A;  2J9C A;  2XYG B;  4C8N A;  3GYG A;  1LXJ A;  2R2T A;  1D1U A;  1X60 A;  3J7Z 5;  4RUC A;  1FE0 A;  1TL7 A;  4P2S A;  1RHU B;  1HHQ A;  1NK7 A;  4OIX A;  2ROE A;  2HMI B;  5HMX A;  3UN5 A;  5F3Z A;  3P6Y C;  1H3D A;  5ETO A;  2DNM A;  1NK9 A;  1ZPW X;  2OUG A;  3FMW A;  1Y3J A;  1SC3 B;  1ZBT A;  2BJ9 A;  3UDV A;  4X4V A;  1TZ0 A;  1TAU A;  1VYA A;  5KFE A;  1YJ7 A;  4LF9 J;  4MK9 A;  2M2B A;  4PAB A;  2YVS A;  2QLF B;  1FWK A;  5HVF A;  1TV6 A;  1U0S A;  4AL6 A;  1IR0 A;  2KEL A;  3GMG A;  4C8L A;  1FNO A;  5A0Y B;  1HWK A;  1VQ9 S;  2CQ4 A;  2HWT A;  1N56 A;  5EHH A;  4JV5 F;  2K06 A;  3O3L A;  1NBE B;  5C24 A;  1CJT B;  2PD1 A;  3FCV A;  5KFV A;  1S6U A;  3UCZ P;  3O44 A;  3DOL A;  4URS A;  4IG0 A;  2VQE J;  2DPJ A;  4LR7 A;  3J81 U;  4K4U A;  5SUH A;  2FZC B;  1IXK A;  4K0K J;  2XSF A;  4MIA A;  3UO0 A;  3I87 A;  1YIJ S;  5KG6 A;  4ECY A;  3CDB A;  3UNG C;  3LGM A;  4IUF A;  1AZS A;  2MY7 A;  3W63 A;  4JI8 J;  1TL3 A;  3M8P B;  1HHT P;  1FD8 A;  3PR5 B;  2VQF J;  5KT2 A;  1QSS A;  3FFI B;  3DRX A;  1RAD B;  3IRX A;  4Q2M A;  2LQB A;  5KFF A;  4AAI A;  3B6B A;  4DFJ A;  4LRC A;  5IT0 A;  2DNN A;  2D3O R;  3OTB A;  5T7L A;  1LW0 B;  3ZFV A;  1OJ4 A;  1MMD A;  4DXL A;  3DCA A;  1YZ7 A;  3M2V B;  2ERR A;  1L3T A;  3HHL B;  3FMB A;  4MKB A;  1HBM A;  4NML A;  1T9X A;  3SSQ A;  2B4U A;  1TL1 A;  2R7V A;  2Y0B B;  2VFR A;  1B01 A;  4DCO B;  2I1R A;  5BYS A;  4X4R A;  2CPE A;  4Z7Y A;  2LEC A;  3OR2 A;  3CJQ A;  3OUY B;  1X4B A;  1U6B A;  3L7U A;  3NOC A;  4ED1 A;  2CUY A;  1FDD A;  2KT3 A;  4M5D B;  3GIL A;  4L76 A;  4LF9 F;  1HNV A;  1HW8 A;  3GSI A;  2DNH A;  4KV8 B;  2H5E A;  1NLK L;  3BRE A;  3GB0 A;  3RRK A;  2W9B B;  2YTC A;  4J9Q A;  3LPY A;  4RNM A;  4A8Y A;  1S1W A;  3NBP A;  1E6V A;  5LMU J;  2IJN A;  1R0B G;  1X5O A;  4LRA A;  1QAX A;  1YRT A;  2WVD A;  2HFS A;  5GAG U;  2VQE F;  1MNE A;  1FO1 A;  2DNZ A;  1F5C A;  2GGP A;  1X4F A;  2B8Q A;  5JVH Q;  4K0K F;  4UZB A;  2JBV A;  5FDL A;  1RHK B;  2WB4 A;  2OPS A;  2DIS A;  1KVI A;  3W64 A;  4DSI A;  4JI8 F;  3GXQ A;  3A13 A;  3TR5 A;  2XYP B;  3O6Q A;  1S6P A;  3G6X A;  4DFK A;  3PIP Q;  4PPZ A;  2LA4 A;  1F3V A;  2A1B A;  2VQF F;  3H5Y A;  2VJV A;  4NCA A;  2ZH9 A;  1HWJ A;  2HFU A;  2UP1 A;  4NA2 A;  2VBW A;  3KK1 B;  2MXY A;  3NGT A;  3RB6 A;  4ES2 A;  2AT1 B;  5CHC B;  2K1R B;  3B82 A;  1TAQ A;  5EWG A;  5EGY A;  5KG3 A;  1SIZ A;  3DYA A;  3I6P A;  4OMF G;  5K20 B;  4U7C A;  2HQF A;  1P1L A;  4GKK J;  4CM2 A;  2OKQ A;  4OI2 A;  2U1A A;  3THT A;  2BDP A;  2G0C A;  4TQS A;  4DV4 J;  3Q0A A;  4ED2 A;  4ILR A;  1B7Y B;  1VDH A;  1DRZ A;  3NG8 A;  5DGA A;  2XI2 A;  2UXB J;  4DDF A;  3BQ1 A;  2AEJ A;  4QCL A;  1O6X A;  4OV1 A;  2D3O 1;  2BM0 A;  1RBL A;  4PAA A;  3D0I E;  2XMA A;  2V2V A;  2KHD A;  1T03 A;  2XZT B;  1J5O B;  3TRG A;  1JLG A;  3EE3 A;  2DNK A;  4OX9 J;  2V8V A;  3H2U B;  2RF2 A;  2QMW A;  2DR5 A;  2ZBI A;  1W7W A;  4EI2 A;  2VHG A;  4OI3 A;  4IFV A;  3HDS A;  3M8Q A;  3QGG A;  3I4P A;  6AT1 B;  4F0K A;  2HHQ A;  3DRR A;  2LLZ A;  1VRQ C;  2BR0 A;  5E7O B;  4RPF A;  3G8T A;  2CJY B;  2DNR A;  3QAU A;  4GVL A;  5LMU F;  2IDE A;  5HMY A;  3W60 A;  3KJV A;  3V6D A;  1M1G A;  2KG1 A;  4LFC J;  3QT6 A;  4OZ1 A;  1P1T A;  2E1P A;  1EA4 A;  2RT3 A;  3PIO Q;  1X8D A;  2RU3 A;  4QWD A;  3TAM A;  3OVS A;  2AX1 A;  2ZH4 A;  4UOG A;  4WFY A;  1I94 J;  2DH9 A;  4A8Q A;  4E8U A;  2MQO A;  3E01 B;  4FPI A;  4HAC B;  4GKJ J;  2J8A A;  1WWH A;  4LF5 J;  2PC6 A;  5CCL A;  3EZ5 A;  1TKZ A;  1YJR A;  4P6Q A;  4ECU A;  2B5J A;  3OTD A;  2GVZ B;  2QG9 B;  2KXH A;  2PA3 A;  4DV3 J;  4ED3 A;  2D74 B;  2HNY A;  5B0A A;  3T9Z A;  1WF2 A;  3K57 A;  2H54 B;  2D3U A;  3L09 A;  2LU2 A;  1JLF B;  5DDO C;  3CDA A;  3LW5 C;  3LO3 A;  2OD6 A;  3Q8V A;  1IKX B;  2HVD A;  3GCX P;  1G4C A;  3MGJ A;  4QR1 A;  2SXL A;  4GKK F;  3TW0 A;  2F4F A;  3KG4 A;  4N8N A;  4Z37 A;  3FQL A;  3I56 S;  1FHT A;  2YBV A;  2RH3 A;  3R5J B;  4DV4 F;  2UV8 A;  4K4T A;  2VPX B;  1FRJ A;  2A2D A;  1NJW A;  4H4K A;  4ED5 A;  2UXB F;  3GQC A;  3MCN A;  5EWE A;  4J9S A;  2EW9 A;  1T3O A;  3B4D A;  1HBO B;  4KB7 A;  2CPF A;  4Q0B B;  3M8S A;  3ZZO A;  2ZHB A;  2WRM A;  3BBB A;  1XQI A;  2K7J A;  2MYF A;  1TK0 A;  2DY1 A;  4DF8 A;  3BSC A;  4OX9 F;  1S7I A;  2HVI A;  2XHC A;  4CLP A;  3VAK A;  1D0E A;  4RW8 A;  1VC6 A;  2VOD A;  2Q6B A;  3PHT A;  3RYL A;  1LK7 A;  5KFD A;  1Q4R A;  4F02 A;  1BQN B;  3OFG A;  3POT A;  3M32 B;  2RHS B;  5HQ8 A;  1UVJ A;  4QWA A;  4K2J A;  3BO2 A;  3DM2 A;  5L1K A;  2BV3 A;  4KKO B;  1PIE A;  3M2U A;  3CED A;  2PI5 A;  4LFC F;  2JC1 A;  3EYZ A;  1SKS A;  4K4Y A;  4DEZ A;  4RO0 A;  1CLF A;  3CE8 A;  2H4Y B;  5IM0 A;  2V4J B;  1I94 F;  1KQK A;  1SQE A;  4GKJ F;  4KGK A;  5HSP A;  3H5S A;  1NSA A;  4LF5 F;  2EVZ A;  4IG0 B;  5F3T A;  3U1M A;  4BBY A;  2R7S A;  1OQ3 A;  1KHW A;  1VC0 A;  3DRP A;  3UDL A;  1WC6 A;  3DN9 A;  4DV3 F;  3DLH A;  3UN3 A;  3IP0 A;  1KWM A;  1H0H B;  2HQI A;  4J9R A;  3H90 A;  1X5P A;  2IAJ A;  2ZVS A;  2P6T A;  1OY9 A;  3B78 A;  4MYT A;  3PRV A;  1Y9O A;  2HHH J;  3GV7 B;  1QAJ A;  3EGV A;  4F4W A;  5DZ6 A;  3CNQ P;  4ECW A;  4O3Q A;  3J80 Y;  1YX2 A;  3BZQ A;  2HBY B;  5I42 B;  2C2E A;  2VG7 A;  5IQ6 A;  4XTT A;  4E0D A;  2C2D A;  4CLT A;  3WC0 A;  1KD1 T;  2V68 A;  3HZE A;  1RT7 B;  1SL2 A;  2CPG A;  1NXI A;  2QFI A;  1LQ9 A;  2D1C A;  5T7L B;  5DDQ C;  2EFN A;  4DG1 A;  4U67 Q;  2HHW A;  1QDU B;  5KFJ A;  3S1T A;  2NUH A;  2DXD A;  2M4M A;  3H87 C;  2CQ1 A;  1BXN A;  2WBR A;  2ZFH A;  1T9Y A;  1ZH5 A;  2XMT A;  2BBE A;  1TKX B;  2D7S A;  2DGQ A;  3TAQ A;  4X4T A;  4RBT A;  1RYR A;  1R0A B;  2X1F A;  6FDR A;  2DPI A;  1VQ7 S;  1PAR A;  4XDC A;  4LF6 F;  2HRU A;  4AT1 B;  5E3Q A;  3NP5 A;  3CMA S;  2GNK A;  3ICL A;  2ZD1 B;  2QYC A;  4ZPW R;  5KFN A;  3ZTQ A;  2BQR A;  1OO0 B;  3QRP A;  4F4Z A;  4I2P B;  3EXY A;  5EDW A;  1NDC A;  3AFG A;  2LXF A;  1YJW S;  1M1H A;  3LPE A;  2XLI A;  2WCX A;  1QM9 A;  2E44 A;  1GH8 A;  1XEZ A;  2IJR A;  2DGS A;  2BE2 B;  1HL6 A;  2RRA A;  5L39 A;  2CQ3 A;  2CQH A;  4MTP A;  3CIZ A;  3D0H E;  2MQL A;  3KXD A;  2DR7 A;  2CIM A;  3D6H B;  1OG7 A;  4FVC A;  3NL0 A;  1C2P A;  3OL7 A;  2IVY A;  3TP2 A;  3TJ9 A;  1G1X A;  3CCZ A;  5KOX A;  1ZZF A;  2VIC A;  3VWS A;  1NB7 A;  2IC3 A;  2GJ2 A;  1EQ0 A;  2VD3 A;  2RBF A;  1GFW B;  2CPD A;  3I31 A;  1TMJ A;  2R3V A;  2CJX B;  4OYW A;  1S6P B;  4IDK A;  3IBF B;  2HHH F;  3S01 A;  1JXE A;  3HSZ A;  2ZHA A;  1NB2 A;  3AJ1 A;  2PMH A;  3NWR A;  2R8I A;  2PEH A;  4KPC A;  4KGX B;  3RR8 A;  3CCL S;  1I51 B;  2AP6 A;  2NYI A;  1EB0 A;  3KK3 A;  1KLM B;  3GFX A;  1SVD A;  1YBT A;  1DFD A;  4I4B A;  4M5H A;  1T11 A;  2WSC C;  4HLB A;  3EPI A;  3RBE A;  4OX6 A;  1HNX J;  2Z2Y B;  1O0P A;  1RAF B;  4XIU A;  3LP1 B;  3ET6 A;  2LQ8 A;  3SBM A;  2A6O A;  1U4B A;  1R8B A;  4N8O A;  4R8U A;  4RNH A;  2E1C A;  4GC6 A;  4CTA B;  4ED8 A;  4K4V A;  5L1I A;  2RF2 B;  4ZJL A;  3DOM B;  3CMQ A;  3PYE A;  2MQP A;  3M8Q B;  8RUC A;  3CCM S;  4TU8 A;  3US5 A;  2B8P A;  1RT4 A;  1FRK A;  5KFT A;  5JVG Q;  1P27 B;  3K0J A;  1WDT A;  1QE1 A;  2HRT A;  5B09 A;  2J9D E;  1TU0 B;  2XMM A;  4B3O B;  2YH0 A;  3J7A N;  3BGF A;  2CAJ A;  2XY6 A;  1RIS A;  2HHU A;  3ULH A;  5J2M A;  3TI0 A;  2FY1 A;  5KFB A;  2XSJ A;  3T5H A;  2OGU A;  4NYZ A;  1RTI B;  4ZIV A;  3IMQ J;  4ZN3 A;  3M05 A;  1S97 A;  3D2W A;  4F0H A;  2B5J B;  2AZ1 A;  4F2S A;  1NJZ A;  4PYA A;  3PKY A;  3ZTS A;  3HHE A;  4CRJ A;  1NK5 A;  1JMT A;  1K73 T;  3EGN A;  2FJA B;  2CVE A;  4JV2 A;  2H3E B;  5HQL A;  4W92 B;  1NJI T;  2ZE2 A;  3C16 B;  5EX3 A;  3IRW P;  1RT3 B;  2ZEJ A;  1ZA2 B;  4G6V B;  3UCG A;  3MM9 B;  1H2V Z;  3IM8 A;  2AKW B;  2LDY A;  2I2Y A;  3PEH A;  4IFY A;  4JI6 J;  1D8Z A;  2FTR A;  2O3D A;  5C5J A;  1UW4 A;  4OYM A;  3I5C A;  2R7O A;  1KNZ A;  5IOL A;  4PXC A;  3AOB A;  3GON A;  3HI9 A;  1N88 A;  2VG6 A;  2QA4 G;  7FD1 A;  2XM3 A;  5DDR C;  2FGC A;  1D9A A;  2A10 A;  4OLP A;  1KR4 A;  3NGS A;  1VRU B;  2V94 A;  1HNX F;  5J1P A;  1FWP A;  4ZCM A;  2FD2 A;  5L1J A;  5D0H A;  1TUW A;  3MEE A;  3MR2 A;  1C4A A;  1PIL A;  5D6G A;  1OSD A;  3FBE A;  1X4E A;  2GZO A;  2FIU A;  4LIR A;  1LXN A;  4Q2L A;  3TNV A;  1F9E B;  2Z2L A;  2JJ4 D;  4JI7 F;  4UOF A;  4YY3 J;  1VQ5 S;  1X9M A;  5ETL A;  3UFC X;  4USJ C;  4C9D A;  3KDO A;  3C6T B;  1TFY A;  5K8M A;  2B0G A;  4URQ U;  3POT B;  4H4M A;  1VQO S;  2X1B A;  4K8R A;  2G0I A;  2PFF B;  1NPK A;  3CJK A;  2IA0 A;  2VIH A;  1V6H A;  4D8J A;  4ELT A;  4DSE A;  3PX0 A;  3QAE A;  1VS3 A;  4PUO B;  2W9C A;  5BJR A;  3M1V B;  1S1X A;  4DPT A;  2DGT A;  4I64 A;  2FPH X;  4C3K A;  2YWH A;  3DI6 B;  4B9T A;  2KZM A;  4G65 A;  2W7O A;  1MYK A;  1YDL A;  4CT9 A;  2GPE A;  2HQG A;  2VBY A;  2UVU A;  1JJH A;  4OHW A;  1U1N A;  1FNM A;  4NEY A;  1WD6 A;  3JAM U;  3FRY A;  3S7R A;  2DVI A;  1MNT A;  2DEI A;  1V3Z A;  4CLZ A;  3Q2T C;  3M8Y A;  3DLL Q;  4FF4 A;  2QZ8 A;  4JI6 F;  4YR0 A;  2AIR B;  1QVF R;  1M5H A;  1FNX H;  2HYI B;  1XR5 A;  3M6X A;  5IZH A;  5CAA A;  2ZWO A;  2MB0 B;  4B9L A;  4M5I A;  4EUV A;  1HQE A;  2XMV A;  3R7S B;  2ATL A;  3A8E A;  4KRW A;  4B3M J;  4Y6I A;  3EMT A;  4ZPA A;  4HDG A;  3QNW B;  4RBV A;  1PJ6 A;  3OR1 B;  2GS8 A;  2OFH X;  4DG1 B;  3CSK A;  2W4C A;  3BKF A;  2GW8 A;  2HW3 A;  3DLG A;  5HBM A;  1A7G E;  2MZR A;  3NCP A;  4YY3 F;  1I5O B;  2CPH A;  1FJ7 A;  4QQB A;  2VU5 A;  3W7B A;  2JX2 A;  4OJ1 A;  3HK2 A;  2YNF A;  4UTG A;  3Q8S B;  1JQG A;  3TZY A;  3QLH B;  1KLN A;  1FKP B;  1BWE A;  2BJ8 A;  1FVS A;  1RLC L;  1LWE B;  3W1Y C;  1Z4U A;  5LM7 E;  4JP8 A;  2R42 A;  2RRB A;  2YKN A;  3OPK A;  4EMD A;  3MEK A;  5E3C A;  3VF0 B;  2HUR A;  2XZW A;  4AXI A;  3HFV A;  1HMV A;  4NI2 A;  3CCU S;  1L3K A;  3R5G A;  1SKW A;  4R0J A;  1RT5 B;  3M6V A;  3QIP A;  1XR7 A;  4UUX A;  3NS5 A;  3LAN A;  4ZK7 M;  1U1M A;  4HH0 A;  1IUJ A;  4B3R J;  3KLV A;  1HWU A;  4RUA A;  3HJV A;  1NH7 A;  4ECT A;  1RT6 A;  3PR4 A;  1HI0 P;  3BH7 B;  2J7K A;  4GC7 A;  1F0X A;  4O3P A;  1Q81 T;  4UQT A;  2W01 A;  3OL9 A;  1FRI A;  1PBA A;  5KG5 A;  4CM0 A;  3LWM A;  1V3S A;  1B4S A;  1C1C A;  2B7B B;  2AHO B;  5EUH A;  4BC9 A;  2W2P P;  3H5U A;  1VIS A;  2BW7 A;  5C42 B;  1MML A;  3CJR A;  4DV6 J;  1RT2 A;  3TUP A;  3FSY A;  2OEM A;  4X4P A;  4FYW B;  4X4O A;  3LJP A;  2XLJ A;  1PC4 A;  2XCP A;  3S6E A;  3MEC A;  3G4S S;  3NCQ A;  3W3S A;  5J2N B;  3PYD A;  3Q24 A;  2FQQ B;  3J7Y U;  1R89 A;  3OJS A;  4B3M F;  4FXD A;  2YWW A;  3P5B P;  5B7W A;  3M9N B;  1BQM B;  3MR7 A;  3BS9 A;  1FRH A;  1R6V A;  3N01 A;  2PT0 A;  3MMA B;  4LF8 J;  1C0T B;  1GXU A;  2GIR A;  2RQM A;  4OL8 A;  4WE1 B;  3CCS S;  2DRB A;  4Y2I A;  1WKK A;  2R2S A;  4CT8 A;  1RQ0 A;  1SJ3 P;  2XMK A;  3T1A A;  1DTT B;  2NSB A;  4I56 A;  1G3O A;  4WPA A;  2CXE A;  3PDN A;  3PFO A;  5F8I A;  4ECV A;  5E3P A;  2MTL A;  1YKW A;  3MPV A;  1GX6 A;  3KNA A;  3M2R A;  3BGR A;  3VAL A;  1LW2 B;  1X4D A;  4WCE Q;  2HIQ A;  3GR0 A;  1XNQ J;  3SQO P;  4K4W A;  2W8L A;  3KUH A;  2MQM A;  2CQG A;  1HBU A;  4M5J A;  2AD9 A;  1RT4 B;  2VOO A;  1Y5I B;  3BGO P;  5KFZ A;  5IT9 U;  1FX2 A;  1LV5 A;  1KFD A;  5KG1 A;  4B3R F;  2KRR A;  3ZZZ A;  2JL9 A;  1U02 A;  5CZV A;  3JSM A;  2V8G A;  1R8C A;  3NLC A;  4FF2 A;  1RWV B;  3ZXW A;  2X1A A;  1OY6 A;  2XLK A;  1SJF A;  1U8W A;  2ADB A;  4PCQ A;  4I69 A;  3KJF B;  4OYZ A;  4HR2 A;  1N33 J;  3NKY A;  4PG7 A;  1X0P A;  1V5I B;  4DV6 F;  2Y0S D;  5HN0 A;  2WAQ D;  2YNI B;  3OQ2 A;  1NM2 A;  2ASD A;  2AJF E;  2OO4 A;  4Y34 A;  3D0G E;  4YME A;  2CNN B;  1B28 A;  4J5O A;  3TUZ C;  2V34 A;  4OHX A;  1HQ2 A;  1WHV A;  4DR1 F;  2QYG A;  2ZOM A;  3F0N A;  2PN6 A;  1V3R A;  1GMV A;  3OVB A;  4RWX A;  4WF9 Q;  4WK3 A;  4LF8 F;  1NDL A;  3OTE A;  1UVM A;  4XPC A;  4CCH A;  3R5C A;  4LRF A;  1Y5L B;  1N4L A;  2VG6 B;  2IM3 A;  3LP2 A;  1KVK A;  4U7U D;  4R5P B;  2GHW A;  3ZZR A;  1RBA A;  3MMB B;  5A6W A;  4CLY A;  4AYB D;  1QAY A;  2I9S A;  1TKT A;  2CQI A;  2QIF A;  5AXK A;  2HBR B;  3H5X A;  1KC8 T;  4K50 A;  4I1T A;  1TL5 A;  2JWN A;  1V5V A;  3LGH A;  2CYY A;  2DGU A;  3ITH B;  2OSQ A;  1Q7L B;  3L3C A;  2H5I B;  3OXL A;  3CO9 A;  1WDD A;  1Y10 A;  3HVT A;  4LRD A;  4CDI A;  1I1G A;  3OBI A;  1N34 J;  1DLO A;  4QIE A;  3O2I A;  1XNQ F;  3NAH A;  2H3A A;  3LAM A;  3NRB A;  2OHD A;  4MIB A;  1WG4 A;  4OI0 A;  3MM8 B;  2OPP B;  4P7T A;  4H4M B;  1HYS B;  5CCM A;  1GXL A;  5DQG A;  4PG5 A;  2DB1 A;  3AXK A;  4QJV A;  5IC4 B;  3FUY A;  5CYM B;  4OYA A;  4K59 A;  2C3P A;  2IMW P;  1FRL A;  2LDI A;  3TQ1 A;  3A8I A;  3FJ2 A;  5CYQ B;  3W9I A;  3DOK A;  1N33 F;  3K7R A;  1K47 A;  2VBZ A;  1REG X;  1U1L A;  3UW1 A;  2RRN A;  2XO6 A;  2NQP A;  1UWB B;  3V5R A;  2YKA A;  4QWE A;  4P75 A;  4ED6 A;  4HHH A;  1PO6 A;  2YWG A;  3L7O A;  5HQM A;  2Z0G A;  1FK9 A;  3OD2 A;  2AX0 A;  3I5A A;  4J9P A;  2VJU A;  2B4O A;  4MK8 A;  4PRF A;  3MCM A;  5AE1 A;  2CWK A;  2WZ1 A;  1KHV A;  1HNI A;  1W26 A;  2JLE A;  1EP4 A;  2CDR B;  4CYU A;  4TY8 A;  4O44 B;  3NGD A;  5H9E K;  1SJR A;  4XAK A;  3W2V B;  3FKB A;  3H2V E;  4PPD A;  2XG8 A;  1L3V A;  4J9M A;  1NKB A;  1KTV A;  4JV0 A;  1RTD A;  3ZTR A;  3OHB A;  2KM8 B;  1PC5 A;  1UZD A;  3RZA A;  5IV3 A;  3HSG A;  2OML A;  5DGB A;  3AA8 A;  1NK4 A;  4Y2C A;  5HBM B;  1JNZ B;  2B9X A;  1X4C A;  2KVI A;  2MZT A;  5ETK A;  3QJP A;  1N34 F;  2ZDP A;  1JLA A;  3JTO A;  1UJ6 A;  2L3M A;  2W1B A;  4WBF A;  5THW A;  1EX8 A;  2CQD A;  4LSL B;  2XHW A;  5M2P A;  1VQ4 S;  4ED0 A;  1YTY A;  1RSC A;  4ETZ A;  5GMK a;  2ASL A;  2L9N A;  2EFV A;  4LVN P;  4MKV A;  3RUB L;  5IT4 A;  2XI3 A;  3Q83 A;  2ZZN A;  1WC5 A;  3IBC B;  5ETQ A;  4K5R A;  1HMV B;  1WG1 A;  2XC9 A;  4FF1 A;  3H4D A;  1N52 B;  3IG1 A;  1X93 A;  3KK2 B;  3C3L A;  5A2Q Y;  3QIP B;  2X51 A;  6FD1 A;  1ZYQ A;  3H20 A;  4J90 A;  3W8P A;  4ZVU B;  1RT6 B;  2FHJ A;  1G7C B;  1F2H A;  1X9W A;  1NK8 A;  1SQG A;  3GFY A;  1YRU A;  4QPT A;  3L9Z A;  2WON A;  3RGI A;  2GIF A;  3TQE A;  4RU2 A;  4UOH A;  5J2Q A;  4USW A;  1C1C B;  1R8H A;  1SIW B;  1AUD A;  1SC6 A;  3CD6 S;  2K29 A;  2D69 A;  1H2T Z;  1QVG R;  2KHC A;  4DL0 C;  1N36 J;  3X3U A;  3T5L A;  2DTJ A;  2F7V A;  2ZC4 A;  3LP0 A;  3TJ8 A;  5JUM A;  3MCS A;  1KFS A;  2COL A;  4U9R A;  4CLS A;  1RLD A;  1CJV A;  4NPO A;  2GX8 A;  3G5O A;  3TUI C;  1J27 A;  4KH1 B;  3QOQ A;  3RTV A;  4HEA 9;  5KFI A;  1DY3 A;  2MKS A;  2W7A A;  1DTQ A;  4Y65 A;  1VC5 A;  3ENW A;  3I4H X;  1CJK B;  3F73 A;  5DM6 Q;  1WOO A;  4MIW A;  4DR7 J;  7FDR A;  1RKJ A;  4PWW A;  2NPI A;  2EBE A;  2FLN A;  2BNW A;  1U0H B;  1M5P C;  4WYL A;  4KO0 B;  2XMU A;  3EM1 A;  2ALZ A;  4HKQ A;  2HHX A;  4IQM A;  4PQU B;  5GAD I;  3LOU A;  4NLS A;  2OH2 A;  2B6A A;  2DNP A;  1NH8 A;  2DNY A;  3UE2 A;  4K5S A;  3SFU A;  5EX0 A;  4ZCL A;  3CDU A;  1FI4 A;  4CH7 A;  5I3U A;  9RUB A;  3R5B A;  2NXU A;  3MAA B;  4A47 A;  3BDP A;  4NRT A;  1R8P A;  2MGZ B;  3UI3 A;  1E6Y A;  3KUG A;  1O8B A;  1HI8 A;  2V4R A;  3D54 A;  2ZH7 A;  3QQC D;  1JKH A;  1HQU B;  1T05 A;  3RG6 A;  4M8L A;  3VZH A;  1ZTT A;  3ZNJ 1;  3D1H A;  5C2G A;  5K8O A;  4BWM A;  1EAY C;  4Y3C A;  1SB6 A;  2YNG A;  5K5M A;  2G9O A;  2P9E A;  2I8E A;  1IJE B;  4QR0 A;  1X0F A;  2E9T A;  3KHR A;  1N36 F;  2J7W A;  2NZ4 A;  1NSP A;  3DFE A;  1RAA B;  3VW4 A;  3CCW A;  4CO2 A;  2RQC A;  3DDN A;  5LSR A;  3Q89 A;  2DO4 A;  4OI4 A;  2W4D A;  2QL7 B;  2OD4 A;  2I6W A;  4CLL A;  2Y3Y A;  4NOH A;  2B51 A;  3ELH A;  3GFZ A;  2LQ5 A;  1WF1 A;  1W25 A;  1S9G A;  3JB9 k;  2E5H A;  4LRE A;  1JK9 B;  1RT1 B;  2N3O A;  3PX6 A;  4DR7 F;  1FRX A;  4X84 A;  1FRM A;  3OW2 R;  4I7F B;  4NLU A;  1UL3 A;  2Q1L A;  1MWZ A;  1ZZN A;  2V8H A;  1R43 A;  3LP2 B;  2ZZM A;  4XDD A;  3BPD A;  3AXM A;  3QFH A;  1RB0 A;  4C11 A;  4ID8 A;  5DRK A;  5AJ3 J;  1JIH A;  1OPI A;  4YUD A;  3EXC X;  3PY8 A;  1U49 A;  3V6K A;  1G6B A;  1NSK L;  3W65 A;  3NS6 A;  1PAU B;  3DU6 A;  2N7Y A;  3W9J A;  1EZZ B;  4YDD B;  3FNN A;  2KJW A;  2QT7 A;  3A3P B;  3BBC A;  5HLF A;  4F4A A;  2ROG A;  1Q5V A;  3GZ7 A;  2DR8 A;  1CJU B;  2HND A;  2BMB A;  1YQH A;  2ZUA A;  4S0M A;  3FEY B;  4OHZ A;  2XYH B;  3VVU A;  2JC0 A;  1VRT B;  1L5U A;  1F3F A;  3OFE A;  5LJ3 Y;  2EFO A;  2W2N P;  4CLW A;  2RNE A;  4U95 A;  4G1Q A;  3ZZU A;  3EWG A;  1R27 B;  4LFB J;  2WW4 A;  3FRZ A;  1X4G A;  4LSN A;  2C22 A;  4ME7 E;  2MPU A;  1FWL A;  1SL0 A;  3SV3 A;  1EHW A;  3T41 A;  2RDJ A;  3QRQ A;  2JEG A;  1MWQ A;  1S1V A;  1Q86 T;  2HK2 A;  3I9Z A;  3KFW X;  2QMX A;  1YVF A;  4CH0 S;  1EIY B;  3FCH A;  3IN5 A;  2V9W A;  3U1N A;  2HNZ A;  3DLK A;  3VGT A;  2C3U A;  1QJH A;  2P9G A;  2PDA A;  3BF4 A;  2KT2 A;  5GVQ A;  2JLG A;  4JI2 J;  4A8X A;  4M5M A;  4AL5 A;  4IKA A;  3R9L A;  3VAM A;  4V19 X;  1HPZ A;  1H98 A;  4UY8 5;  1A9N B;  3OXG A;  5AXN A;  1RWP B;  4HTJ A;  3F44 A;  1GK8 A;  3C15 A;  3WC2 A;  3WIV A;  1XK8 A;  1HWI A;  3J81 j;  1H38 A;  4TY8 B;  1SUQ A;  2JFK A;  3CD0 A;  5F8M A;  1S7H A;  3A3O B;  2ZH5 A;  1A0O B;  3IAS 9;  3FZB A;  5DG9 A;  3JTP A;  4AL7 A;  1GQE A;  3OT9 A;  2E5I A;  3JSY A;  5F0W A;  2YQ0 A;  1JWW A;  1YBA A;  5AJ3 F;  2DRA A;  1RTD B;  3AY0 A;  4O0I A;  2WOM B;  1YHQ S;  3KMQ A;  1VHF A;  1RAC B;  1JLC A;  2DR6 A;  1WEX A;  1CSJ A;  2FLL A;  2NXC A;  4DHV A;  4GVB B;  3PW7 A;  4DX6 A;  3P8B B;  1B70 B;  4KPY A;  2EFP A;  1WF0 A;  3MM7 A;  4KFB A;  3JYT A;  5DQI A;  1VI7 A;  1S57 A;  1M5V C;  2BZ2 A;  4X4Q A;  2QA4 S;  2UUT A;  4OJG A;  4FBU A;  3MED A;  3J7A 1;  4MJW A;  4RR5 A;  4YDX A;  2P9C A;  2XZD B;  4LFB F;  2QLX A;  4IH7 A;  2HS3 A;  4C7Q A;  1WOS A;  4RW4 B;  3BH6 B;  5KG4 A;  3V4I B;  4LT6 A;  1FKO B;  2XGP A;  1TVR A;  2WVF A;  4TYB A;  4KYZ A;  3MUM P;  1M0S A;  3OTO J;  4Y2A A;  3A3N B;  4NLV A;  4TLR A;  3IM9 A;  2MJU A;  3CME S;  3NMA A;  2KYX A;  1U2C A;  3AOA A;  2AYE A;  4F4X A;  1S1U A;  2FJW A;  2KFZ A;  4QOT A;  2VC1 A;  3VQS A;  4JI2 F;  1UAW A;  5J2Q B;  4MKY A;  2ZWP A;  5GME A;  4U8V A;  1Z2Z A;  2B56 A;  2CQ2 A;  2KFY A;  1YJV A;  4XO0 A;  1BUX A;  1QSY A;  5T14 A;  4WK1 A;  2ZJR Q;  4DV7 J;  3SDE A;  3JQJ A;  3I0S A;  4H4O B;  1SV5 A;  3RBZ A;  1YGY A;  2XTJ P;  4DBQ A;  4TQR A;  3K8V A;  2M8D B;  2KO1 A;  5KFK A;  2NPF A;  3CD5 A;  1APS A;  1VFJ A;  3HHK A;  2H48 B;  4ANE A;  1ZS6 A;  4OQJ A;  2XGQ A;  1RHQ B;  2V2K A;  2V2Q A;  3FSX A;  1U9P A;  3HXM A;  3R6L B;  4YB5 A;  3PJW A;  2C2R A;  1NO8 A;  5LXR A;  1NME B;  4ECR A;  4KHP J;  1R0C B;  3F56 A;  5A8R A;  5D15 A;  5KFS A;  2ZC3 A;  2Y8Y A;  5K14 A;  4PR6 A;  4DR6 J;  3C6U A;  1QSL A;  5J1E A;  1DHM A;  2J6S A;  2QSW A;  1H2U X;  2IRU A;  1YSJ A;  2J6U A;  3B4M A;  1AB8 A;  1Q8B A;  2E7V A;  4NCB A;  2LEA A;  3C66 A;  3IFE A;  3LWL A;  4WWS A;  2E1M C;  5DJB A;  3ZNU A;  2B7C B;  3NMR A;  1WSR A;  1JJ2 R;  3VAF A;  1BMQ B;  5E5N A;  3M30 A;  1N6Q B;  1T3N A;  1M1K T;  1FFW B;  4CH1 A;  2MZQ A;  3HUL A;  4N47 A;  5J1N A;  5SZT A;  3GLJ A;  3KTQ A;  1CS4 A;  3GJS B;  1E6Y B;  3ONQ A;  5C2C A;  1RA7 A;  3F41 A;  2E9R X;  3ZZY A;  3OTO F;  4NYO A;  2V69 A;  4URG A;  4MFB A;  1Q8L A;  2CPX A;  4OHY A;  2RKI B;  1LNQ A;  1MU2 A;  5E3A A;  4ES1 A;  1GEH A;  1NJX A;  2Z8Q A;  1S9E A;  4KHR A;  4USV A;  4A8O A;  2X3D A;  3N0V A;  1VIX A;  3PJ9 A;  3QWU A;  1UET A;  5LSO A;  3MOJ B;  2YPZ A;  1S1T A;  1YJU A;  4CI0 B;  4HT7 A;  4A8M P;  4WKY A;  1VJW A;  2MST A;  1RHM B;  5LL6 d;  3OXF A;  2RIJ A;  3V6H A;  3RW6 A;  4ZLP A;  4KIA A;  4IG3 A;  4C4W A;  4PWD B;  4NLO A;  2BM1 A;  1FJE B;  2QFJ A;  4DV7 F;  1XIQ A;  3N9U C;  4MYU A;  1B99 A;  3IR7 A;  3BKU A;  1NK6 A;  5HRO B;  3PVX A;  1SJ4 P;  4U6P A;  2MHN A;  3PRD A;  3ENV A;  4A8K A;  3VAI A;  3E2E A;  4KHP F;  5AE3 A;  4RBU A;  1WG5 A;  4C8M A;  3W2W A;  1IKV A;  2YKM B;  3QO9 B;  3G96 A;  1BQX A;  4NA1 A;  2Y8W A;  2J5A A;  4DR6 F;  4ZVO B;  4WII A;  2XNR A;  4PYD A;  1XWL A;  2O67 A;  1Q16 A;  1ZPV A;  3MUV P;  3HFZ B;  3Q23 A;  4FXE A;  3MHY A;  1R8A A;  4NZ0 A;  3T3F A;  3CO0 P;  3VQT A;  1ZTW A;  2XS2 A;  4C11 B;  3DMJ B;  2ROP A;  2IA6 A;  1N5Q A;  4B9U A;  4JI4 J;  4CQ1 A;  3VAH A;  3NOG A;  3N4W A;  1RA6 A;  1RTH B;  4P74 A;  2WVC A;  4DUT A;  1JLB A;  3WQP A;  5I4M A;  2K9I A;  3W62 A;  2AJQ A;  4NA3 A;  4EYI B;  2KM8 C;  1FVQ A;  1PBU A;  1NLA A;  2FJX A;  2GVD A;  2O66 A;  3Q2S C;  2VG5 B;  1NDK A;  5C25 B;  2ILZ A;  3JXO A;  3TA1 A;  2ZH8 A;  5I3P A;  1SCJ B;  5KAK A;  4ZVR B;  1Y4Z B;  2A18 A;  3QFW A;  4G1Q B;  4I2Q A;  3KG0 A;  4HI1 A;  2I5J A;  4TKT A;  2NUU G;  5IS2 A;  3MI7 X;  3GP9 A;  4C3L A;  2K1O A;  2CZ9 A;  1HBN B;  1S1V B;  1CUL B;  3HKW A;  1KBR A;  2RHQ B;  2KN4 A;  4FN5 A;  2GFF A;  4WIQ A;  2A6M A;  3G8Q A;  3G82 B;  3KOA A;  1RXO B;  4OZJ A;  2HNZ B;  5DZ7 A;  5HL7 Q;  3G9C A;  2FVQ A;  2CPY A;  3C14 A;  2H5J B;  2PII A;  5J2P B;  2CQC A;  5DG7 A;  1TEL A;  5FLX U;  4RW6 B;  3TO8 A;  5FJ4 A;  3T5K A;  2M52 A;  3K5M A;  2BA9 A;  1F5A A;  2CQ0 A;  2YNH B;  2NCK L;  2N82 B;  3KLG B;  5EWF A;  5AE2 A;  3EGW B;  2Q3P A;  2YH1 A;  5LSL A;  1XR6 A;  1RAI B;  4LR9 A;  5K8P A;  1UEV A;  5HAN A;  4EU0 A;  3PCO B;  1UA0 A;  1Q53 A;  5D4P A;  1OY8 A;  3M7V A;  4GMK A;  4ZOS A;  4ZVS B;  2V9K A;  2IBK A;  4AE5 A;  2Z30 B;  1MRO A;  3T1Y J;  4JI3 J;  1VMB A;  3HHL D;  1FA0 A;  4IOB A;  3MEG A;  1REV B;  4JI4 F;  4RNN A;  1D3W A;  1JLE B;  1LKZ A;  1NPR A;  2W25 A;  2W2O P;  1CC7 A;  3HSD A;  3EX7 B;  2HHV A;  3DRS B;  3CCV S;  1GAO A;  5M2R A;  2HGL A;  2CVI A;  3NO7 A;  1JJ4 A;  3DLE A;  3OFH A;  3KLH B;  1GMW A;  4RW9 B;  1WC0 A;  3MMC B;  3QSI A;  4P9S A;  5KFG A;  4ZVG A;  2VDH A;  3KLE B;  2RU9 A;  4EO8 A;  3GU0 A;  1NKC A;  2LXU A;  2RS8 A;  1CBK A;  3CPW R;  5C7P A;  5DLG A;  1RHJ B;  2A3J A;  1FEH A;  3I82 A;  4N7T A;  2L08 A;  4KGM A;  2YX1 A;  1JLQ B;  1NPP A;  3K5L A;  5E0O A;  2KKH A;  1NCL A;  4J9L A;  1L3S A;  1WUU A;  1RP5 A;  2ZKT A;  3PNI A;  1NND A;  1FT8 A;  1CVJ A;  2HFN A;  2XQC A;  4DX8 H;  4IR9 A;  2CQB A;  2PSZ A;  3N5F A;  2XWX A;  4RL1 A;  4P52 A;  1NHV A;  3T6J A;  4KSE B;  2KG0 A;  1R3N A;  2XMW A;  2MQQ A;  4WFN Q;  2R2U A;  2BE7 D;  2C3M A;  5F8N A;  1KOO A;  3GYN A;  4IRC A;  3KLF A;  4DR2 J;  2VPW B;  1VQL S;  1ARO P;  1WC4 A;  3D5M A;  2HFO A;  2ZM6 J;  3SDE B;  1BWV A;  4LFA J;  3D1Q A;  2UU9 J;  2E5G A;  5A8K A;  3PXG a;  1W2B R;  3JTN A;  4P73 A;  1RHR B;  2Z4P A;  3NAI A;  2CNL B;  4Q43 A;  1FJG J;  4PG8 A;  1ARQ A;  2G2Z A;  3QZ8 A;  3THV A;  1PGZ A;  2F8E X;  2KJV A;  4LBH A;  1TUV A;  2OEJ A;  2DGV A;  3ISZ A;  3ILI A;  4OYX A;  5A8R B;  3T1Y F;  5K14 B;  4JI3 F;  1F60 B;  1EET A;  4KR0 B;  3N6M A;  1T95 A;  5B0E A;  3I0R A;  3MM6 B;  3I5B A;  4RKU C;  4ICL B;  4QBU A;  3M9O B;  1KQG B;  3EVM A;  4NLW A;  1YWX A;  1IKW B;  4I0W A;  1KTQ A;  2DT9 A;  5HP1 A;  4NWB A;  4BWJ A;  4TYA A;  5KFO A;  1JXL A;  1MSW D;  2LQJ A;  2N4D A;  1VBZ A;  4DF4 A;  3Q8Y A;  4ID5 B;  1N0V C;  2M8H A;  4LVO P;  1KOH A;  1C1B A;  1YK9 A;  2ZKU A;  4AFF A;  4QU6 A;  4GRS A;  4F4Y A;  4NCG A;  3W9H A;  4O3N A;  5D3G B;  3BM7 A;  4DR3 J;  1YJT A;  2BUN A;  4M94 A;  2PE8 A;  5HO4 A;  1FDA A;  2HG4 A;  5KFH A;  1CS4 B;  1ELO A;  2AYB A;  3D6T B;  1I6J A;  1SBR A;  2ACM A;  3TX0 A;  2OEK A;  2YY3 A;  4M5K A;  3SYZ A;  4BCA A;  4KBI A;  4IR1 A;  4MFB B;  2HMI A;  4Y00 A;  2BQU A;  4DL4 A;  3FMT A;  3G87 A;  1FKA F;  4ANC A;  4FKX A;  1ZOT A;  1N5Y B;  1RUS A;  8ATC B;  1S9E B;  4CWB A;  2CNK B;  2EK6 A;  3O1L A;  1UKU A;  2IRY A;  2O5D A;  1S0N A;  5LOQ A;  1OHN A;  3QYY A;  4UST A;  2F8H A;  5B0G A;  1U1K A;  4DR2 F;  4F0M A;  4NYP A;  1TL7 B;  2FC8 A;  3R3T A;  1R7I A;  1T9V A;  1S0M A;  4IG3 B;  1RAH B;  3IWL A;  2WVE A;  2DNL A;  5KFL A;  4P2F A;  2ZM6 F;  5U47 A;  5L9X A;  3DRY A;  2UU9 F;  2Z2Z A;  2HVE A;  2FHK A;  1HNW J;  1UVL A;  4JB8 B;  1PKU A;  5A0Y A;  1FJG F;  3LA0 A;  4PXB A;  4NLG A;  1S4F A;  1CJT A;  4NZ6 A;  2IM1 A;  4BLG A;  1B0T A;  5JMN A;  4L3K A;  2VAS A;  3SCJ E;  3KYL A;  1IKV B;  3QMQ A;  3FBC A;  3RB3 A;  2ZNZ A;  5D77 A;  3ZTP A;  1Q95 G;  1OQ6 A;  4ZPB A;  2DO0 A;  4DCP B;  1N8R T;  1TV6 B;  1Q78 A;  2CJB A;  1MMN A;  3M8P A;  4M5G A;  3D3B J;  3A8K A;  2RUS A;  5CA5 A;  2BJ3 A;  2KXF A;  1WSV A;  5C24 B;  2QE5 A;  1K44 A;  5EN1 A;  2NXN A;  3DOL B;  3D1O A;  1YBU A;  3PRB A;  1U6Z A;  4M1K A;  1DQ9 A;  1XMQ J;  2ABY A;  1JX4 A;  4USH A;  4RUH A;  4QZV B;  4DR3 F;  2UVR A;  1H73 A;  3OLA A;  2BOP A;  5KFX A;  4C8Y A;  1AZS B;  2KU7 A;  3DU5 A;  4DSF A;  1P8G A;  5BXI A;  1AUS L;  1LW0 A;  1TL3 B;  4B9N A;  2G2O A;  3IR5 B;  3M2V A;  4HYK A;  4X62 J;  2OJ3 A;  1RCO B;  5IQQ A;  4Y2K A;  4C8Z A;  1HHS A;  2HHT A;  4ZN1 A;  2NSC A;  2BAC A;  2I5J B;  2K2P A;  3VAJ A;  3IRX B;  2LA6 A;  1U1O A;  3OUY A;  4C2M A;  3QWP A;  3GPA A;  1RAO A;  4WXW A;  5CQG A;  3SI8 A;  1NU4 A;  5L1L A;  2MY8 A;  2JEJ A;  3EPG A;  3IS9 A;  4KV8 A;  1ZM2 A;  3P4U B;  4LF7 J;  4OZN A;  4YEA A;  2ZBC A;  2GJI A;  4OLO A;  4OYP A;  2JVR A;  1HBM B;  1RWW B;  1HNW F;  1S10 A;  2MQ8 A;  4B17 A;  1TL1 B;  1H7W A;  3AD8 C;  1BC6 A;  2HZV A;  2V0N A;  5B0C A;  4DL2 A;  4MT1 A;  2IYG A;  3OR2 B;  2F4V J;  3KHG A;  5DQH A;  1CQM A;  5ETM A;  5DET A;  5IWA J;  4K4X A;  4YB6 A;  5IFM A;  1F5B A;  2MKI A;  1HNV B;  4RUB A;  3WIU A;  4EO6 A;  1I3O B;  3UNY A;  2Y1R I;  2QA2 A;  2VFS A;  2CAX A;  3EDR B;  2XMJ A;  2ZH2 A;  1FXR A;  3GJR B;  4TXS A;  3DGP A;  3OTC A;  4UY8 T;  1Q8K A;  3DGV A;  2BKP A;  4N41 A;  3VEB A;  4LRV A;  3VTI A;  2CKW A;  2N7C A;  1U47 A;  3IR6 B;  1G2E A;  1S1W B;  3NBP B;  1VBX A;  1E6V B;  5D0G A;  4K4Z A;  3MEG B;  2DCU B;  3NEK A;  3KK1 A;  3LUY A;  5CXT A;  3NS7 B;  4DX7 A;  3T19 A;  2GGP B;  5F9N A;  2K1R A;  3PW4 A;  2KOE A;  2AY0 A;  1XMQ F;  1MWY A;  1FX4 A;  2CNO B;  5FDL B;  2OPS B;  3BSO A;  3VEA A;  4CNZ A;  4U8Y A;  2HAF A;  1X4A A;  1YLX A;  3IWN C;  2V5H G;  1U1Q A;  3J81 Y;  5KFW A;  1DAX A;  3CF5 Q;  3DC2 A;  1NSQ A;  4X62 F;  1SQF A;  1KN6 A;  2R8K A;  1YZ6 A;  5L38 A;  3TA2 A;  2PA8 D;  4O4R A;  3P3D A;  3MUR P;  3HVW A;  2BRK A;  3L7P A;  4B9M A;  2B9W A;  1BDV A;  4OYO A;  2RS2 A;  1K9M T;  3G71 S;  3CB4 A;  2KDO A;  3QZ7 A;  3DYA B;  2MZ1 A;  1VLO A;  3OL6 A;  2IM0 A;  4KGZ B;  2C2Z B;  3HSJ A;  2CAD A;  4WFA Q;  1SL1 A;  4LF7 F;  2RE1 A;  1IWG A;  1DUR A;  3G6V A;  2R8J A;  4RX6 A;  3P49 B;  2FC9 A;  1GMW D;  4WZM A;  3HFK A;  3CIM A;  3BB5 A;  1MN7 A;  2AGO A;  3TWZ A;  1HW9 A;  2F4V F;  3GTY X;  4N56 A;  2ZH1 A;  5F8L A;  5IWA F;  2DXF A;  2XY7 A;  4L73 A;  3TVK A;  1T03 B;  4KQZ A;  2W8K A;  1JLG B;  3TAR A;  3RAM A;  2VC0 A;  4IFV B;  1KSP A;  3E01 A;  4HAC A;  2U2F A;  2VA2 A;  2GQ2 A;  2RUG A;  3DRR B;  2GHV C;  1T8E A;  2N3L A;  4HHJ A;  1B0V A;  1NKE A;  4JI5 J;  4M5N A;  5BYR A;  2LP4 A;  3KJV B;  1K1Q A;  2OSR A;  2VH7 A;  1LWC A;  3V6D B;  3ZTO A;  3KNG A;  2GVZ A;  3I0R B;  1HLW A;  3U27 A;  3VGU A;  2VF3 A;  3MTJ A;  2VPY B;  3TAM B;  3SSR A;  3OL8 A;  1U48 A;  3J80 U;  1JB0 C;  1KDN A;  2YQ1 A;  5D4N A;  3O8W A;  1FTR A;  1JLF A;  2JXI A;  4Q5V A;  4QYZ J;  1IKX A;  3EGZ A;  5CD4 A;  4ZLN A;  3HHD A;  3CJS A;  2C2K B;  3RBD A;  1TKZ B;  3MR5 A;  1XJW B;  3PO4 A;  5GAD U;  4L72 B;  2BQ3 A;  4F7V A;  3H7H B;  2MLY A;  1H6K X;  2O1P A;  2FJV A;  1U25 A;  4NCG B;  2L9D A;  1SH3 A;  2BAN A;  1FFS B;  3TA0 A;  2E66 A;  3FEX B;  3R2C J;  4ZP7 A;  4EK2 A;  1HFE L;  2HNY B;  1SI9 A;  3MAH A;  3W66 A;  4DMZ A;  1HBO A;  4Q0B A;  1UTA A;  1S48 A;  1Y00 A;  3FBF A;  3R7N B;  3TUJ C;  3GE9 A;  2F9D A;  1JJC B;  4LBP A;  2ZJQ Q;  1TQL A;  4UW2 A;  1PYS B;  2P6S A;  1D8Y A;  3R2D J;  4IQX A;  4PZV A;  3PHE A;  4ILL A;  1TTH B;  1S0O A;  1BQN A;  3M32 A;  5CYJ A;  4ZPT R;  2F8M A;  4G3I A;  1F2G A;  4ENO A;  3D66 A;  4KKO A;  4ZHR A;  3MR6 A;  1AFJ A;  8AT1 B;  2VKR A;  3TEH B;  2AJ1 A;  3GV8 B;  5H9F J;  3C2P A;  4NZ7 A;  1S4E A;  2PO4 A;  2V4J A;  3HHL C;  5KFA A;  4FF3 A;  4RW8 B;  4FS1 A;  4ETX A;  2OPR A;  2EWH A;  4DQP A;  4FXW A;  4TNO A;  2DJW A;  2VBX A;  4QIF A;  3SIP B;  3MM5 A;  4ZVF A;  1VQM S;  3MD3 A;  4JI5 F;  3QGI A;  2KI2 A;  3DM2 B;  3LQV A;  3ZZP A;  3M2U B;  3GIM A;  2BYC A;  3CDW A;  3U7J A;  2GHP A;  2F65 A;  3FVY A;  1D9D A;  4WFZ A;  1OWX A;  2YX7 A;  2EFG A;  4W90 B;  4A8F A;  4BC7 A;  5IM0 B;  4ECS A;  4Y28 C;  4OYI A;  3CJ5 A;  2C3O A;  2DGW A;  2CJA A;  2UUC J;  2ZBQ A;  4C3M A;  3H2L A;  1OIA A;  4HHU A;  1LWF A;  1A6L A;  3R5D A;  2LCW A;  2QL5 B;  4OYB A;  5GAE U;  3DXB A;  5I42 A;  2L48 A;  3DRP B;  4ZDN A;  3BGL A;  2BAB A;  1GXT A;  1RT7 A;  2VV5 A;  1CG2 A;  2H51 B;  4HT5 A;  1IM6 A;  2IAJ B;  1M5K C;  1U2R A;  4I6W A;  3T9N A;  2M0G B;  2WVB A;  4F25 A;  2FJB B;  2GAG C;  4WYW A;  1TKX A;  4USM A;  1FCA A;  1R0A A;  1C0U A;  2ATC B;  2IFX A;  2VPZ B;  5KFR A;  4A46 A;  2FVC A;  4A8W A;  2HVH A;  1MLA A;  3W5Y A;  4X4N A;  2NR0 A;  3KKF A;  2AJ0 A;  3K2Y A;  5MLC V;  2FVS A;  2ZD1 A;  2VG7 B;  1FD2 A;  4IRD A;  2VFV A;  3Q8U A;  1M5S A;  4I2P A;  4Q7A A;  3L95 X;  3IS9 B;  1VQN S;  3SSS A;  1HWL A;  3UD5 A;  5BYQ A;  1S12 A;  4ZP6 A;  1AA1 B;  2QN6 B;  3D6F B;  5KFU A;  4X64 J;  1NJY A;  2C1E B;  3RRG A;  3CCT A;  1QTG A;  5KG0 A;  1RAB B;  4X4S A;  3BEG B;  2RSQ A;  1U24 A;  1VK8 A;  3A1Y G;  4C97 A;  4FBT A;  4WFX A;  1S5Z A;  1HD1 A;  4NLX A;  2BE2 A;  1RZM A;  2QGF B;  3H25 A;  3AT1 B;  3R97 A;  1PJ7 A;  3MF5 A;  4UQG A;  3MWB A;  4ER8 A;  4ZVP B;  2EK1 A;  4NMX A;  1VOM A;  2AMC B;  2YKQ A;  5KFP A;  4F4K A;  4W98 A;  1W2I A;  2UUB J;  4RNO A;  1RAJ A;  4LQ9 A;  3D4J A;  3HVR A;  1KKH A;  2K7K A;  2Z58 B;  2N4C A;  3DGP B;  4JBC A;  3UVJ A;  4O0N A;  4D3H A;  4C6A A;  4C48 A;  5E2Q A;  4DQR A;  3EZU A;  5FII A;  1B3T A;  3I9V 9;  2UUC F;  3MR3 A;  2LXI A;  2HWH A;  3I55 S;  2PFD A;  2J8S A;  3QSY B;  2JRS A;  3H42 A;  3QT8 A;  2CA9 A;  3PYG A;  4FDF A;  3ZZT A;  1QAI A;  2XWY A;  2OFG X;  4ITS A;  3MMJ A;  4P71 A;  3CUL A;  2IC3 B;  2PMZ D;  4F2R A;  4KHM A;  4NE9 C;  4C8K A;  1KLM A;  3FC9 A;  5E41 A;  4DL3 A;  1VBK A;  2R8H A;  3D3C J;  2MSS A;  4RU9 A;  4IDK B;  4ED4 A;  5ETP A;  4QWB A;  3ZO7 A;  4OI6 A;  5LJ5 Y;  3KG1 A;  4O3R A;  3RJM B;  4JOU A;  4EGL A;  3LP1 A;  2AGP A;  1K0V A;  4IYQ A;  5D0R A;  3ENQ A;  3DHW C;  2W2M P;  5G0R A;  3FZ2 A;  4P2X A;  3E51 A;  4B3T J;  2GMH A;  5LMN J;  4ES3 A;  3N6N A;  4NXN J;  3TAP A;  3DLJ A;  4CTA A;  3KK3 B;  4TLQ A;  2JLF A;  1SH2 A;  4OZ2 A;  2WTF A;  3DOM A;  2QLB B;  2LYV A;  4NXM J;  3DDK A;  5KG7 A;  3K8W A;  1BHN A;  4X64 F;  3GIJ A;  2OI2 A;  3PW5 A;  2QC3 A;  1WEZ A;  1VLY A;  1MN9 A;  2HGM A;  4PEO A;  1WC1 A;  2GQC A;  4WP8 A;  3ET6 B;  2ACY A;  1OYD A;  1GMU A;  3UR0 A;  4P72 A;  4ZVE A;  4B3O A;  4R8U B;  5B0F A;  4DUY J;  4RW7 A;  4DR4 J;  3GV5 B;  4ZMM A;  1ZAX A;  5KT7 A;  2J6T A;  1OPZ A;  3IBW A;  2PMW A;  4ED7 A;  1NRK A;  2UUB F;  1HIY A;  2ADC A;  3K58 A;  4DPO A;  2QLW A;  3T1H J;  2EC2 A;  4ELU A;  4ZS6 A;  3V4M A;  1RTI A;  4M5L A;  2JOQ A;  1HNZ J;  3IC1 A;  1WKJ A;  4DX5 A;  1QE1 B;  3NGK A;  1LWC B;  3SEO A;  2KH9 A;  2Y1J A;  3C16 A;  4E2F B;  1BD6 A;  1RT3 A;  3HD2 A;  1GX5 A;  2JSX A;  2X1G A;  5KT6 A;  1RKI A;  2E5J A;  3MM9 A;  5J2M B;  2BJD A;  2DR9 A;  2RQ4 A;  3S8S A;  5LXY A;  1UCN A;  3FDS A;  2M7S A;  2M88 A;  3CC2 S;  2CFX A;  3ADA C;  3ETO A;  2DXE A;  2XSJ B;  4NEZ A;  2HQ3 A;  2ASY A;  4PXE A;  3CXC R;  2YKP A;  3A8J A;  1WEL A;  1K8A T;  1KQS R;  3A12 A;  4DQS A;  1IVZ A;  2UVW A;  2MKH A;  1R31 A;  2BAN B;  4LUB A;  1KQF B;  1VRU A;  2VOP A;  1NZA A;  4I6Y A;  3LGN A;  2CJQ A;  4B3S J;  2W24 A;  2ZE2 B;  3CJT A;  4DWI A;  2FB0 A;  2A2C A;  5HAT A;  3PZP A;  1IBK J;  4AQY J;  1RAG B;  2MKK A;  1OS5 A;  5K9F A;  1S77 D;  1ZET A;  4B3T F;  4O4G A;  5LMN F;  5KG2 A;  4NXN F;  4IFY B;  3PX4 A;  3SXL A;  2FVP A;  4LF1 A;  4WU3 A;  3SV4 A;  1VIO A;  2HFV A;  3MZI A;  4NXM F;  4LF6 J;  4X2B A;  3C6T A;  4HI2 A;  5F8G A;  4ZKA A;  3BBF A;  3HHN B;  2DY9 A;  1RWM B;  3BQ0 A;  4DL7 A;  3K59 A;  4XPE A;  3H0P A;  4OX7 A;  1DJ0 A;  7AT1 B;  3MEE B;  1S76 D;  4NRU A;  1WJ9 A;  4ZHR B;  4W4M A;  4UT4 A;  4Y0F A;  4DUY F;  1NHK L;  5L9N A;  2KZZ A;  4DR4 F;  2FLP A;  3AQP A;  5GMD A;  3UWT A;  4PUO A;  2RIL A;  2M9K A;  3M1V A;  2DEJ A;  2K6L A;  1M90 T;  1S72 S;  2C42 A;  2J0Q D;  2OPR B;  2IDL A;  4FNH A;  3DI6 A;  3T1H F;  1RAE B;  3G2X A;  1VQ8 S;  2C2O B;  3MM5 B;  1H72 C;  2DYA A;  3PV8 A;  1HNZ F;  3CW2 C;  3VHQ A;  2F40 A;  4V19 J;  2OIH A;  4QPX A;  1H74 A;  3A4T A;  4NLY A;  3CJK B;  4WTY A;  1FDB A;  1NHU A;  4CNY A;  2H1O E;  2GQQ A;  4DS4 A;  2FUG 9;  5T41 A;  2IYI A;  2W9C B;  1VK3 A;  1VR6 A;  2C3Y A;  4L6V 3;  2OTL S;  3DNC A;  4BS2 A;  1S1X B;  2KL8 A;  4DCJ B;  3DXS X;  2R7R A;  1U26 A;  4V1A k;  3SCI E;  3W61 A;  2VKZ G;  3QT7 A;  1LWF B;  2HZC A;  1KVJ A;  2HIY A;  4MKA A;  5D4L A;  1GTE A;  2GO9 A;  5I3Q A;  4FYD A;  2FYX A;  4PKD B;  4QU7 A;  2HAI A;  4P2M A;  1ZM4 A;  4CZC A;  2FGO A;  2AYG A;  3HP6 A;  1F9F A;  3JSB A;  4ZPD A;  1UWA A;  4B3S F;  2POK A;  3OR1 A;  4QIG A;  4QW9 A;  2KFN A;  1IBK F;  4AQY F;  2Z57 B;  3QGP A;  3RAQ A;  3VVT A;  3BPS P;  5B0B A;  2Q66 A;  1X5S A;  4UUW A;  4EBE A;  3HLU A;  4Z7C A;  1C0U B;  1XNR J;  1Q82 T;  1M5O C;  4LQ3 A;  5HVH A;  5RUB A;  1KS2 A;  1N5V A;  2D41 A;  4YOE A;  1HQE B;  1LK5 A;  3QLH A;  4USI A;  1FKP A;  1LWE A;  2GJF A;  4DLG A;  1YIT S;  4ZIT A;  3BN4 A;  2J76 E;  2B4V A;  4ILM A;  4KY3 A;  1U45 A;  3M8Z A;  2E9Z A;  1B0P A;  3W5Z A;  5F8H A;  5ITH A;  3DLG B;  4YN3 B;  2IJF A;  2ZJP Q;  2KXN B;  3K5P A;  2MJN A;  2MLZ A;  3HVA A;  1RT5 A;  1YI2 S;  2BEF A;  3TAN A;  1PYO B;  3JQK A;  2AEM A;  3LTO A;  1MG7 A;  2YNF B;  4YR3 A;  1UA1 A;  2Q2K A;  4ZP8 A;  3CUN A;  1GNK A;  2LQ9 A;  1PSD A;  3E8O A;  1BDT A;  3HD1 A;  2R7W A;  5B08 A;  2YKN B;  4DPW A;  3DDI A;  4IH5 A;  2R9L A;  1N54 B;  3SZ2 A;  1T0T V;  1N5S A;  4NI2 B;  4YHH J;  2F63 A;  4WFB Q;  2JXG A;  1IWA A;  2BSQ E;  4EBD A;  1P94 A;  1N0U A;  1GTH A;  3LF0 A;  4A4J A;  2VDI A;  5MAO A;  3UVJ B;  2F5G A;  3JSR A;  1T7P A;  3VCD A;  5C42 A;  4DI6 A;  3CGI A;  2DBB A;  2ZDO A;  4QR2 A;  4HDH A;  2W7P A;  3CCJ S;  3ETM A;  5J2N A;  2RML A;  4F04 B;  4NL5 A;  2IBO A;  3AHP A;  1BQM A;  5CAB A;  3MMA A;  1URR A;  2OLW A;  1C0T A;  3GFH A;  5HK4 A;  4WE1 A;  4EEY A;  3H40 A;  3SQG A;  3KWM A;  1VQK S;  1RT2 B;  2WK4 A;  4X4U A;  3JAM Y;  2IM2 A;  3N6L A;  1XMB A;  4ZPC A;  3C19 A;  1XNR F;  3MPD A;  1CEZ A;  1RU2 A;  4DFM A;  1SC4 B;  2CZV C;  2ZUG A;  3MEC B;  3FT7 A;  1DTT A;  5KTQ A;  3BYP A;  1IR2 A;  2DIV A;  2KTQ A;  4YP3 A;  5G0R B;  2BKO A;  1WOP A;  4AND A;  1WHW A;  2ZHO A;  3FSI A;  1RWU A;  3CT9 A;  4OFZ A;  4NLT A;  4CLF A;  2CJK A;  4JI7 J;  4Q8E A;  2YWF A;  4DUZ J;  3AJD A;  1LW2 A;  2XS7 A;  4DV1 J;  2VFT A;  3THP A;  3IAM 9;  5GAH I;  2GCF A;  2FJE B;  2DH7 A;  4NLR A;  2VB6 A;  1IBM J;  3CCE S;  1RJJ A;  4QW8 A;  5K8N A;  3UDE A;  2ZIT A;  1JNR B;  5F8J A;  1AT1 B;  5L8R C;  2J9E A;  4H4K C;  1UPM B;  2AF6 A;  3SFG A;  3OFF A;  4RW7 B;  3M2R B;  3BGR B;  2LMI A;  2CJ9 A;  2C2M B;  4DPU A;  5A8W A;  4ECX A;  4G1P A;  2BJ1 A;  2RDD A;  4ERD A;  3HF5 A;  3ISN D;  4CO3 A;  4N77 A;  4ALZ A;  4YHH F;  1WAC A;  1HD0 A;  3KHL A;  1HBU B;  3RRH A;  4F3M A;  3KHH A;  2YKO A;  2DCL A;  4JUZ A;  3EVW A;  5ETR A;  4YR2 A;  2YNI A;  3JSM B;  2GV1 A;  1YJN S;  4I67 A;  2FHM A;  5KT5 A;  2C28 A;  1XMO J;  3MTK A;  4OJH A;  1VQ6 S;  4ECZ A;  4EYH B;  2CPI A;  2HEK A;  2OEL A;  3CCR S;  3NNE A;  3DHX A;  1R6Y A;  1WTB A;  4OHV A;  1XN9 A;  1ACM B;  3HJF A;  4CO5 A;  2E5L J;  4R5P A;  2KVQ E;  3MMB A;  1IM4 A;  5CD4 H;  3VV2 B;  3GWC A;  4DSL A;  2JVO A;  2DHX A;  2FLO A;  3ITH A;  4O4G B;  1RTZ A;  4B9V A;  2KYZ A;  2HK3 A;  4DUZ F;  1HI1 A;  2MZS A;  1UEU A;  2BKN A;  4DV1 F;  2RVJ A;  1WI8 A;  3CJ3 A;  2BW2 A;  2BXJ A;  1IBM F;  4DN9 A;  3J7Z T;  3NCR A;  4DL5 A;  2HQD A;  1WI6 A;  3CJ0 A;  3NWG A;  4J9O A;  3MM8 A;  1Y5N B;  2DH8 A;  2OPP A;  3JS9 A;  1HYS A;  3FEZ A;  1FJC A;  2ZBP A;  5KFY A;  2NXE A;  1TKT B;  4KE5 A;  3R1L A;  2P8I A;  5A2Q U;  2HLU A;  3OVA A;  4WZQ A;  2M5Y A;  1WKL A;  2MLX A;  5D8H B;  5GAE I;  2V6A A;  3UQS A;  2AZ3 A;  1TR0 A;  1U1P A;  1IQT A;  2IVM A;  4KT0 C;  2BA3 A;  3HVT B;  5CYM A;  4O3O A;  4RLE A;  2QMU B; 
#chains in the Genus database with same CATH homology
 2WVB A;  3VEA A;  2BNW A;  1Q5Y A;  2BJ8 A;  2CPG A;  1MNT A;  2HZV A;  2F1F A;  2BNZ A;  2K1O A;  2BJ1 A;  2BJ9 A;  3H87 C;  1Q5V A;  1U9P A;  2WVE A;  2RBF A;  3VW4 A;  1IRQ A;  4FXE A;  2BJ7 A;  1EA4 A;  1ARR A;  2CA9 A;  1BDT A;  2K29 A;  1PAR A;  2WVF A;  3FT7 A;  2K6L A;  1BDV A;  2Y3Y A;  2WVD A;  3LGH A;  2KEL A;  4D8J A;  2CAX A;  2JXG A;  1BAZ A;  2BSQ E;  4ME7 E;  2WVC A;  1QTG A;  1P94 A;  2NZC A;  2PC6 A;  3VEB A;  2CAD A;  2HZA A;  3QSI A;  2K9I A;  2K5J A;  1NLA A;  1ARQ A;  3OD2 A;  3PHT A;  2JXH A;  3BKF A;  3QOQ A;  2JXI A;  2FGC A;  3BKT A;  3BKU A;  3GXQ A;  2H1O E;  1X93 A;  1B28 A;  2CAJ A;  3FMT A;  1B01 A;  2AY0 A;  4HV0 A;  2BA3 A;  1MYK A;  1MYL A;  2BJ3 A;  2GPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...