1U9PA

Permuted single-chain arc
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
101
structure length
96
Chain Sequence
MPQFNLRWPGGGPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGGGGREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Consolidating critical binding determinants by noncyclic rearrangement of protein secondary structure
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords pArc
total genus 36
structure length 96
sequence length 101
ec nomenclature
pdb deposition date 2004-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1u9pA00
2AY0A 2CPGA 1IRQA 2K29A 2K9IA 3VW4A 2HZVA 1EA4A 3LGHA 3OD2A 2BJ8A 2BJ9A 1BDVA 2RBFA 1ARQA 2JXGA 2GPEA 2K6LA 1B28A 2H1OE 1NLAA 2BNWA 1MYKA 3GXQA 2KELA 3H87C 1X93A 3QOQA 2BJ1A 2BJ3A 1MYLA 2CAXA 2CAJA 1Q5VA 2JXIA 3VEBA 2WVDA 2BNZA 1P94A 1BAZA 2HZAA 2WVBA 2WVEA 4HV0A 1MNTA 3VEAA 4D8JA 2CADA 1B01A 1PARA 2CA9A 2BA3A 1U9PA 2JXHA 2K5JA 1ARRA 2K1OA 2WVCA 2BSQE 3FT7A 4ME7E 3FMTA 1QTGA 4FXEA 2WVFA 1BDTA 2BJ7A
chains in the Genus database with same CATH superfamily
2CPGA 3NO7A 1IRQA 2K29A 1OHNA 2AN7A 1ARQA 1EA4A 2B43A 2GPEA 1B28A 3IR7A 1X93A 2BJ3A 2JXIA 2JBVA 3VEBA 2WVEA 2H1OE 2Q2KA 1PARA 1SIWA 2BA3A 2K5JA 3G5OA 4NRTA 4LRVA 4O4RA 1QTGA 4QPXA 2K9IA 2BJ9A 2BJ8A 3BSNA 2UUWA 2BNWA 3GXQA 2KELA 1SH3A 4MJWA 4NRUA 1P94A 3UR0A 1Q16A 2CADA 2BSQE 2CA9A 2UUTA 2KOEA 2CKWA 3QIDA 2HZVA 3OD2A 1BDVA 2RBFA 2JXGA 2K6LA 4AAIA 3H5XA 3QOQA 2CAJA 1Q5VA 3BSOA 2WVDA 4D8JA 2WVBA 3SFUA 1MNTA 2CAXA 3VW4A 3LJPA 2JXHA 3UPFA 2KKEA 3FT7A 3FMTA 4FXEA 2WVFA 3NAIA 2BJ7A 1OG7A 2AY0A 1SH0A 2WK4A 1SH2A 3LGHA 2ADLA 3SFGA 3NNEA 2H3AA 1NLAA 4LQ9A 3H5YA 1MYKA 3H87C 2BJ1A 1MYLA 4LQ3A 3NAHA 2A2BA 2BNZA 3UQSA 1BAZA 2HZAA 4HV0A 1B01A 3VEAA 1U9PA 2WVCA 1ARRA 2K1OA 4ME7E 1BDTA
chains in the Genus database with same CATH topology
2AY0A 2CPGA 1IRQA 2K29A 2K9IA 3VW4A 2HZVA 1EA4A 3LGHA 3OD2A 2BJ8A 2BJ9A 1BDVA 2RBFA 1ARQA 2JXGA 2GPEA 2K6LA 1B28A 2H1OE 1NLAA 2BNWA 1MYKA 3GXQA 2KELA 3H87C 1X93A 3QOQA 2BJ1A 2BJ3A 1MYLA 2CAXA 2CAJA 1Q5VA 2JXIA 3VEBA 2WVDA 2BNZA 1P94A 1BAZA 2HZAA 2WVBA 2WVEA 4HV0A 1MNTA 3VEAA 4D8JA 2CADA 1B01A 1PARA 2CA9A 2BA3A 1U9PA 2JXHA 2K5JA 1ARRA 2K1OA 2WVCA 2BSQE 3FT7A 4ME7E 3FMTA 1QTGA 4FXEA 2WVFA 1BDTA 2BJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AY0 A;  2CPG A;  1IRQ A;  2K29 A;  2K9I A;  3VW4 A;  2HZV A;  1EA4 A;  3LGH A;  3OD2 A;  2BJ8 A;  2BJ9 A;  1BDV A;  2RBF A;  1ARQ A;  2JXG A;  2GPE A;  2K6L A;  1B28 A;  2H1O E;  1NLA A;  2BNW A;  1MYK A;  3GXQ A;  2KEL A;  3H87 C;  1X93 A;  3QOQ A;  2BJ1 A;  2BJ3 A;  1MYL A;  2CAX A;  2CAJ A;  1Q5V A;  2JXI A;  3VEB A;  2WVD A;  2BNZ A;  1P94 A;  1BAZ A;  2HZA A;  2WVB A;  2WVE A;  4HV0 A;  1MNT A;  3VEA A;  4D8J A;  2CAD A;  1B01 A;  1PAR A;  2CA9 A;  2BA3 A;  1U9P A;  2JXH A;  2K5J A;  1ARR A;  2K1O A;  2WVC A;  2BSQ E;  3FT7 A;  4ME7 E;  3FMT A;  1QTG A;  4FXE A;  2WVF A;  1BDT A;  2BJ7 A; 
#chains in the Genus database with same CATH topology
 2CPG A;  3NO7 A;  1IRQ A;  2K29 A;  1OHN A;  2AN7 A;  1ARQ A;  1EA4 A;  2B43 A;  2GPE A;  1B28 A;  3IR7 A;  1X93 A;  2BJ3 A;  2JXI A;  2JBV A;  3VEB A;  2WVE A;  2H1O E;  2Q2K A;  1PAR A;  1SIW A;  2BA3 A;  2K5J A;  3G5O A;  4NRT A;  4LRV A;  4O4R A;  1QTG A;  4QPX A;  2K9I A;  2BJ9 A;  2BJ8 A;  3BSN A;  2UUW A;  2BNW A;  3GXQ A;  2KEL A;  1SH3 A;  4MJW A;  4NRU A;  1P94 A;  3UR0 A;  1Q16 A;  2CAD A;  2BSQ E;  2CA9 A;  2UUT A;  2KOE A;  2CKW A;  3QID A;  2HZV A;  3OD2 A;  1BDV A;  2RBF A;  2JXG A;  2K6L A;  4AAI A;  3H5X A;  3QOQ A;  2CAJ A;  1Q5V A;  3BSO A;  2WVD A;  4D8J A;  2WVB A;  3SFU A;  1MNT A;  2CAX A;  3VW4 A;  3LJP A;  2JXH A;  3UPF A;  2KKE A;  3FT7 A;  3FMT A;  4FXE A;  2WVF A;  3NAI A;  2BJ7 A;  1OG7 A;  2AY0 A;  1SH0 A;  2WK4 A;  1SH2 A;  3LGH A;  2ADL A;  3SFG A;  3NNE A;  2H3A A;  1NLA A;  4LQ9 A;  3H5Y A;  1MYK A;  3H87 C;  2BJ1 A;  1MYL A;  4LQ3 A;  3NAH A;  2A2B A;  2BNZ A;  3UQS A;  1BAZ A;  2HZA A;  4HV0 A;  1B01 A;  3VEA A;  1U9P A;  2WVC A;  1ARR A;  2K1O A;  4ME7 E;  1BDT A; 
#chains in the Genus database with same CATH homology
 2AY0 A;  2CPG A;  1IRQ A;  2K29 A;  2K9I A;  3VW4 A;  2HZV A;  1EA4 A;  3LGH A;  3OD2 A;  2BJ8 A;  2BJ9 A;  1BDV A;  2RBF A;  1ARQ A;  2JXG A;  2GPE A;  2K6L A;  1B28 A;  2H1O E;  1NLA A;  2BNW A;  1MYK A;  3GXQ A;  2KEL A;  3H87 C;  1X93 A;  3QOQ A;  2BJ1 A;  2BJ3 A;  1MYL A;  2CAX A;  2CAJ A;  1Q5V A;  2JXI A;  3VEB A;  2WVD A;  2BNZ A;  1P94 A;  1BAZ A;  2HZA A;  2WVB A;  2WVE A;  4HV0 A;  1MNT A;  3VEA A;  4D8J A;  2CAD A;  1B01 A;  1PAR A;  2CA9 A;  2BA3 A;  1U9P A;  2JXH A;  2K5J A;  1ARR A;  2K1O A;  2WVC A;  2BSQ E;  3FT7 A;  4ME7 E;  3FMT A;  1QTG A;  4FXE A;  2WVF A;  1BDT A;  2BJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...