2WVEA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
131
Chain Sequence
SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWNPNDESKIAVLVVIYDHHQRELNQRMIDIFHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 31
structure length 131
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wveA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wveA02
2WVDA 2F1FA 1BDTA 3FMTA 2NZCA 3FT7A 4ME7E 4D8JA 3QOQA 3BKTA 3VW4A 2CAJA 1IRQA 1B28A 3LGHA 2K1OA 1BDVA 2WVBA 2BJ1A 2KELA 2JXIA 2BJ8A 1B01A 2BNZA 2GPEA 2JXGA 1QTGA 2WVFA 3PHTA 2BJ7A 3GXQA 2RBFA 2Y3YA 4HV0A 2FGCA 1ARRA 1X93A 2PC6A 2WVCA 1Q5YA 2BA3A 2HZAA 3H87C 1NLAA 2HZVA 1BAZA 3VEAA 1P94A 1ARQA 2CA9A 4FXEA 2CAXA 2AY0A 2K9IA 2BJ9A 3QSIA 1Q5VA 3BKFA 2H1OE 1MYKA 2K6LA 1PARA 2K5JA 2BNWA 2BJ3A 3VEBA 2K29A 1MYLA 1MNTA 1EA4A 2JXHA 2CADA 2BSQE 1U9PA 2WVEA 3OD2A 2CPGA 3BKUA
chains in the Genus database with same CATH superfamily
2J8AA 3EVMA 3DXBA 1GT8A 2CPFA 3EE3A 1U1QA 3D3BJ 2GHVC 2HNZB 1OY9A 2ZC3A 3QLHA 3CC2S 3BM7A 4DR3J 3V4MA 2OTLS 4ZIWA 1T05A 2AYEA 1E6VA 2VOOA 4NXNF 1HI0P 4IH5A 2XS5A 2EEYA 2JSXA 4WWSA 1NXIA 2OJ3A 4IQXA 1SCJB 4B9SA 1FJ7A 4U96A 3VTIA 7FDRA 2ZH8A 2E5IA 2OSQA 3V81B 1DZ5A 4J9NA 3T6BA 3HVTB 1KOHA 4JI4F 3OW2R 3UD3P 2HIQA 3JSRA 1UEVA 5JVGQ 1SH2A 2AEFA 5T14A 3PW0A 2CQGA 1FJCA 1X60A 2BE9B 1RLDA 1UEKA 3V6DA 5C5JA 4TYAA 4MT1A 3SV3A 2ALZA 4DV6J 4DUYJ 1BGXT 1IUJA 3W60A 4GVLA 1SPBP 3VALA 3Q8RB 5HN0A 3JTOA 4LFCJ 1WKKA 1FVSA 3G86A 3LP1A 2F5GA 3K58A 3K5OA 2KYZA 3AQPA 4GKKF 2LEPA 4QWAA 1FX4A 2CNKB 4AD6A 4FNIA 2ZJQQ 3OR2A 4ZOSA 1FRLA 3BGRA 1W2BR 4ZVQB 2BZ2A 3IAM9 1RAIB 3NCQA 2Y3YA 1TP7A 4P10A 2GQ2A 4EEYA 2MY7A 4DR2F 1VI7A 2KTQA 4JYAF 4EZ9A 3BJYA 4HR2A 5B0EA 4URGA 4X4PA 3KK1A 2UV8G 2W8KA 1QSLA 4OHWA 3T41A 3KHHA 4GC7A 1SC1B 5A0YA 2DIVA 1VCTA 4ILRA 4QQBA 2FJEB 1N52B 3ISND 4RNOA 3ET6A 1U4BA 1C1BA 4YB1P 2E5JA 3DMJA 1UJ4A 3HULA 3M8WA 1T9TA 3V4IA 1YZ7A 3J7YI 1FJGJ 4WKRA 4GKJJ 4Y2CA 2OIHA 1HFEL 3PW4A 3OD2A 4QIVA 3G71S 4X4QA 3B4DA 2FUG9 4FVCA 3MPVA 4PG8A 1NK8A 3PIPQ 4ZPVR 1WEXA 3OXGA 3AY0A 4DPOA 2OMOA 2FJXA 1X0PA 1BXNA 2CVIA 2LYVA 2DTJA 2DXEA 1CQMA 1BD6A 1AXQA 1GX5A 3CDWA 1FTCA 4EBDA 1I6JA 1H7WA 2LU1A 1KBRA 2OPRB 3OFFA 3HPOA 1VHFA 3KLIA 2RJZA 4ZIVA 1KONA 4ALZA 1YJ7A 5F8MA 1CPZA 4ENOA 2MKIA 2XMJA 3PFEA 3M8PB 4KGMA 5G0RB 1Q79A 2UVUA 2ZHOA 3AOBA 1KHVA 1QDUB 3M2UA 1T03A 1RA7A 3C14B 1PJ7A 1X4HA 2JZ5A 1Y0HA 3TJ8A 4H4MB 1HW9A 2BJ3A 1ULRA 3NLCA 1SKRA 1C0TB 2QV6A 4HI1A 2K3KA 1DURA 4OI3A 3OL9A 1TKDA 2PMHA 4F36A 3PJXA 2ZWOA 2NS1B 2KM8C 4IYQA 2VPZB 3GYNA 1IBKF 2HVIA 2C2KB 1M5HA 1LW2A 3F56A 2OSRA 2ZFHA 1FI4A 1K9MT 4URSA 4DOZA 3BKTA 1AW0A 4DG1A 4EI2A 3UNGC 4DV5J 4G1QA 2GPEA 2PN6A 1UMJA 4N7TA 1RP5A 3J81U 5D0GA 1Y7PA 1IBMF 4MYTA 4P9SA 1LOUA 4MJKA 5K20B 2AZ1A 2EWHA 2W9CB 5DGAA 4N47A 4F4WA 1T3NA 1FFGB 1N5SA 2UXCJ 4A46A 3AA8A 4OLPA 2CJQA 4ED8A 1BWEA 5KFSA 1HI1A 1X4CA 4CLPA 2PGCA 4WP3A 1KNZA 4DL4A 1D9DA 5KT4A 2BJ9A 3BR8A 5F41A 3SCLE 1JMTA 1S0MA 1JKHA 3S01A 3PX0A 1UZDA 1RJJA 1JNRB 3TUZC 3R2DJ 1RTIB 2VU5A 1K1QA 2GAGC 3OUYA 4NCGB 3C2PA 2D1CA 1GH8A 1WI8A 2XYPB 2DVIA 3BBCA 3PJ9A 2F65A 2D3UA 3HJFA 4DFMA 2ZITA 3TANA 1WC4A 3UCUP 5IM0A 3BEGB 1KTVA 5IWAJ 3GP9A 3QFHA 1RU2A 4PYAA 2FZGB 2CZVC 1SL1A 1NO8A 3M9MB 3GIRA 3TYTA 2RF2B 3A8KA 1RHJB 3M4XA 3CMAS 1UW4A 3G6YA 3ENQA 3W3SA 2AEJA 3TZZA 3LW5C 3DRRA 2VIHA 2AYGA 1REVB 4LR7A 3CCTA 4QWEA 5KAKA 4DQIA 2CZ4A 1HHSA 4OX9J 5KFCA 1R6VA 2CQ3A 2RU3A 2CPDA 3IM9A 5KFXA 1KWMA 1VISA 3D54A 2DIUA 3GE9A 1CLFA 2HVEA 3HF5A 3M05A 2DHGA 1R0AA 3NBPB 5KT6A 2VG5B 1B3TA 4BHQA 1FERA 2R7VA 4I64A 3WBZA 4X65F 3JSYA 4ILMA 4B3TJ 4QCLA 2ZBIA 2RHQB 4L3NA 2HK3A 2VFVA 3DDKA 3F73A 4DV2F 1Y10A 2GMJA 1S9GA 4LF9J 1SC3B 1X4AA 4ZVSB 3TQEA 2BV3A 1SIZA 2DNQA 1ACMB 3LPYA 2PA3A 3M8YA 1OHNA 3FQKA 2BW7A 5L1KA 1HYSA 2FGCA 4QWBA 4Y65A 3F44A 2R2RA 2LQ9A 4CO1A 3SEOA 3FEZA 5KFEA 3DKDA 4QYZK 4PPDA 2H5EA 3EM1A 1SUQB 1NK0A 2R8GA 3O8WA 1B70B 3OVBA 5K8OA 3RAQA 4JV1A 2W2QP 4MFBB 2CQCA 2QN6B 5CYQB 2H1OE 2BNWA 4L75A 4IOAQ 1WC3A 1MSWD 1S0NA 1RHKB 2YX1A 3R7NB 5LSOA 2MKKA 1D09B 3DLGA 5KFRA 2W9BA 4RU2A 4HH1A 4F02A 1F9EB 4WE1B 1TL1A 3R1HA 1VQSA 3N6NA 4TY8B 2KG1A 4ZPCA 3SCKE 5LJ5Y 3AJ1A 1GMVA 2NREA 1W25A 2DRAA 3HVWA 4OYZA 1ZOTA 2RDJA 2B4VA 1KVKA 1FNOA 2KFNA 3RBEA 1VQYA 4Y0FA 4LF2A 5D78A 2RRNA 3THTA 4X4NA 1FRKA 1SKWA 2L41A 1N5VA 4LF8F 1RWUA 1TFYA 2VBZA 2C2DA 5F8HA 2D9PA 2HQGA 3MPUB 3BPSP 3QMQA 4KQZA 3A4TA 3SSRA 1FCAA 4JV0A 2XMMA 1OY8A 5HQLA 2VKRA 2NPIA 2B6AA 2R2TA 4JI6F 4X4TA 2YNHA 2SXLA 4DFKA 1XR6A 4DBQA 1AFIA 1T9UA 3CGIA 4P2FA 4ZVOB 2W9AA 4YDXA 4WXWA 4FBUA 5C42B 3ZTPA 4C97A 1HQEA 5AXMA 3AD7C 1XMQJ 3GFXA 1HBNB 1JLCB 4ED7A 3BO2A 1PCAA 1CEZA 4HDHA 1KQKA 2WRMA 4OQJA 2FVPA 1T0TV 3TA0A 1RHRB 3CC4S 1NJWA 4DX8H 1SVDA 1VRUA 4FZVA 4XPCA 2QE5A 3D0GE 4USJC 4EUVA 3MUTP 3NNCA 2KRRA 2GVDB 2E44A 2Y0BB 1N32J 1H38A 4ANCA 2HPUA 1NDCA 2FGOA 3OR1B 4X66F 2LU2A 2BKNA 4WFAQ 3GV5B 2E29A 1GXUA 2WCXA 2LA4A 3LP0A 4OZNA 3J80Y 1G6BA 3M32B 2JXHA 5IFMA 2CYYA 3SQGB 1VQNS 1WF2A 2QIFA 3QATA 4O4GA 2CXEA 2GQQA 1BC6A 4A8WA 3BYPA 5DLGA 4FN5A 5CABA 4B9NA 4DV4F 1U0HA 3D6HB 4YY3J 4Q8EA 3SDEB 4OYPA 1S6QA 8AT1B 4JI7J 5C25A 2B4PA 2DGWA 3RW6A 4PG7A 3D66A 4CI0B 4U8VA 3TNVA 4QIEA 1E6YB 1RHUB 1YZ6A 4N41A 5E3RA 5D0HA 3KG1A 2E7WA 2YNIB 4ES3A 3HSGA 2BA3A 3QT6A 2HGLA 2FB0A 2KO1A 2EG1A 2OUGA 4B3SF 3I9ZA 2GGPA 1A0OB 4ZMMA 4ED1A 2ALYB 1L3UA 3A8JA 1R43A 1LQ9A 1IR1A 2UXDJ 2MB0B 2A6MA 1X5PA 4ZK7M 1VRTB 2HSEB 3VGUA 1BHNA 3CCQS 3UD5A 4H4OA 3DLEA 4E98A 2WSCC 4KR0B 3A1YG 3OT9A 3DHWC 3NS6A 2ZOFA 2Y8YA 4I67A 3D7SB 4CTAB 3MTKA 2Y8WA 2PSZA 1ZA2B 1HI8A 3NXZA 2PT0A 1CG2A 3UVJA 4P7VA 3UI3A 1WG4A 1S97A 1EETA 1JLGB 4H54A 2KL8A 4M1KA 2QL9B 3IGVA 3EVOA 4TYBA 3RR7A 2H48B 2XI2A 1NK5A 4UOHA 5KTQA 5EN1A 1S5ZA 4ZCLA 5J1PA 1JLEA 2RHSB 1TMJA 1CULA 3SCIE 1P1LA 2FJAB 2AJ4A 2M2BA 2KVQE 1U8SA 4IO1A 4JI8J 1T9XA 2IYGA 2V0NA 2X1BA 1OS5A 2HW3A 3ZNJ1 1EX8A 3QSYB 4OYWA 2CG4A 4C98A 2BANB 2VODA 3SSQA 2GHPA 2W24A 2MGZB 1SV5B 1VHIA 4MKYA 3QJJA 5LMNF 1P8GA 1UVJA 5F9LA 3KK3B 4DV0F 3AFGA 2D3OR 4HTJA 1FK9B 2YKNB 4DPXA 2FD2A 4B08A 3UQSA 4D3HA 4ECQA 3MM9B 1LEOA 1N6QA 4P75A 2UP1A 1IBLF 4E0DA 1UZHA 3CC7S 2B9YA 2ZOGA 3IGNA 2YWKA 4OLOA 4WXOA 3H2VE 3LJPA 1H0HB 2WK4A 4UQTA 1IR0A 3M6XA 3BO4A 1RA6A 1AFJA 5ADZA 2BQRA 3MECB 5E5NA 4IH6A 2BABA 3CCLS 2CIMA 2AX1A 2V2VA 1F9HA 2ZE2B 1RAGB 4LT6A 3VV2B 1TUWA 4QPXA 3CULA 2HQCA 1RHQB 4X62J 3U1NA 5B7WA 2NCKL 3TR5A 4I1TA 2E9RX 3K5PA 4DN0A 1QE1B 1N88A 4AXJA 3KDOA 3DGPA 2UUCJ 1FXRA 4CQ1A 4P72A 4YEAA 1KDNA 1MWYA 3QGGA 1PJ5A 3DOKA 3H4DA 2J7WA 3OV7A 4ZPAA 1PYTA 1YG0A 3KJFB 1CS4B 1RUSA 4DQPA 2R8HA 3PRBA 1JLFB 3MMCB 2CQDA 4NMXA 2FZKB 3FFIB 2WHOA 3IWLA 1P9YA 4Q43A 1O8BA 2ZH4A 1WDTA 3H7HB 4YR0A 1MU2A 2CPEA 2Z2LA 4FYXB 5H9EK 2K2PA 4NLPA 5KT7A 3JAMU 2B8QA 4TVAB 3QSIA 5EWFA 1C4AA 4IR9A 1U2CA 5J2MA 2Y0SD 2LQJA 2GIFA 4LF4F 1FXLA 2AW0A 1KQGB 4RJVA 1DTQB 4DCJB 3I87A 4J5OA 2CQ4A 1QD1A 2R8KA 1Z4UA 2YVSA 2CPZA 5L1JA 3EVWA 1RT1A 1JLAB 2W4DA 2VDIA 2CWKA 1JB0C 1VBKA 2OKQA 1DTTA 1YRUA 3BGLA 1S9FA 2Z2ZA 4I0WA 4PG4A 5CZVA 2P9GA 2V4JA 2OPPA 4Z7YA 2Z58B 2BNZA 1J5OA 1RI7A 3CCUS 4NASA 4DR7F 2Y1RI 2RDDA 4PWUA 2MKSA 2C2EA 5G4DA 2EC2A 2BUNA 3QT7A 1SH0A 4Z2XA 4X64F 1K47A 2R4FA 4L6V3 4DF8A 4LRFA 3VEAA 2YY3A 1TKTB 1NCLA 2R7TA 3CJ3A 3MPDA 3LA0A 2PFFB 3PR5B 3M2VB 2EBEA 2V4RA 3DLHA 1RDRA 4HACA 4CO3A 1NDKA 4B3RJ 2V63A 3FBCA 1FO1A 2MZ1A 3HP6A 4M5IA 3DLKB 3QAUA 2XQCA 4F3OA 2WW8A 4M5LA 4X4UA 1TL7B 1U7LA 4QIGA 2YX4A 2WBRA 1S1UA 4WK1A 3ZTQA 2YWFA 4F0MA 3A8EA 2ILYA 2LA6A 2XSJA 1WHYA 3R7BB 2MLZA 1WELA 4OL8A 3T1HJ 2B4OA 3TUIC 5BR8F 5CA5A 2AF6A 3KLVA 1IKVB 1VQOS 4O23A 2R8JA 1NJYA 4K8RA 1PJ6A 3M9NB 2OFHX 4R0EA 3MFIA 4N56A 2JH3A 2QMXA 2BJ7A 1VIXA 1VK3A 2ZZMA 8RUCA 5HJXA 4GC6A 1VMBA 4K4SA 4U6PA 5C2GA 2HYIB 2RT3A 2NXJA 4N77A 1Y5NB 5HANA 4Y2AA 2CPHA 2I8EA 2VC1A 2JEJA 5ETVA 2GIRA 4HYKA 2DR7A 4WZQA 4J9QA 1JXVA 1KLMA 1EJ7L 1S4FA 2EFPA 4PCQA 1R8BA 1M5KC 1Y3KA 1SI9A 2MKHA 2DHAA 4ATNA 2FY1A 2C28A 2JLFA 4WF9Q 1ICEB 1FHTA 1HNZF 4J9UE 1O0PA 4EBEA 5GMKa 1NJIT 2Q43A 3D0IE 2GIQA 2EW9A 4RNFA 4DR6F 4DMZA 1RAFB 2CQ1A 4M5KA 2LQBA 3HSDA 2RU9A 3AHPA 3HFVA 3HSZA 2VG7A 3FCVA 2RD5C 4EFAC 3KDNA 2C3MA 2VD3A 4NXMF 3T5JA 2HGMA 3CD0A 2OTJS 2BJ8A 2DHXA 1RZMA 2Z2MA 2R2UA 2AKWB 3POTB 4C8KA 1K8AT 1TK0A 5F8NA 5E3CA 2E1AA 3VVUA 4LF5F 3FZBA 4Q0BA 1VQKS 1YIJS 2E9TA 1N36F 3GJSB 3MEKA 4KT0C 3NRBA 2MKYA 3GZ7A 3TA2A 1SC4B 1WKLA 1RYRA 1WOPA 3I4PA 2MQOA 3SYZA 4KHPF 2PI5A 3QLHB 4C11A 3LOUA 2H9ZA 5HK4A 1U24A 3MEGA 2O3DA 1JX4A 4R5PB 1T05B 1BWVA 3PM9A 3D67A 4QOTA 3MFHA 2WSFC 4RBUA 4ECVA 4ZVEA 3P5TL 4XAKA 1SJFA 1VQ6S 1S4EA 2H4YB 3I0RA 3CPWR 1U1KA 2KT5A 3M30A 4C3KA 3TJ9A 3IMQJ 4MJWA 3E3XA 9RUBA 2G1HA 3TRGA 1NZAA 4UUWA 5L39A 2CPYA 4DV7J 1OIAA 1P9QC 2V6AA 3V6DB 3P6YC 3HK2A 2AT1B 1NK9A 5L8RC 4TXSA 4IUFA 1HNXF 2HZVA 4NZ6A 4LVOP 4LRAA 4DXLA 1A6LA 4DUZJ 2CFXA 3PR4A 3W2WA 4FPRA 3ITHA 3GFYA 3OR2B 2YH0A 2LLZA 3D68A 4E2FB 3D1HA 2ADLA 4FBTA 2MTLA 1T95A 4A8KA 2DO0A 3ETMA 1RT6A 1JJ4A 3KLHA 1VJWA 5LJ3Y 2V34A 2BSQE 1TELA 5EX3A 3KK1B 2LXUA 3LAMA 1K0TA 1HQUA 5A0YB 1FDBA 2XY7A 2OI2A 4TKTA 3ET6B 5L1LA 4F0HA 1C1BB 1U1MA 3THVA 3DMJB 3D5MA 1U26A 2M88A 2CVEA 4FF2A 3GQCA 1MMLA 2AQ4A 1YRTA 9ATCB 1KOOA 2YKQA 1R8HA 5A8WB 2W4PA 2RRAA 1NU4A 5KFOA 2C2MB 1QUVA 2C1EB 1WTBA 1HBUA 2LP4A 1RSCA 3OSNA 3LP2A 2MPUA 3W5YA 3TVKA 4MIAA 4M8LA 1X31C 3CJ8A 1C0UA 4K2JA 2KI2A 2X51A 1R8PA 1T7PA 3MEDA 1DJ0A 5A2QY 2JWNA 3ZZTA 2E5HA 1LFPA 1V3RA 3OTOJ 1RTDA 3TAMA 2AIRB 1OJ4A 2DNZA 1IM6A 5EWGA 2ERRA 4OX6A 4OZ5A 1HWJA 5FD1A 3E01A 2M52A 1S0VA 2YKMA 3JQKA 3PXGa 2IM0A 4U7UK 2KOEA 5CYMA 4LRBA 4Q45A 2DGXA 2DXDA 3NKYA 1M5OC 3K5MA 4C2MA 2IYIA 3N79A 2DNHA 2R7SA 4RW4A 1T03B 5I3UA 2W4CA 4CIOA 1MN7A 2XM3A 3QOQA 2FLPA 1B99A 3LGNA 1Z2ZA 2PEHA 3R8YA 1Q16A 5B0DA 5DDRC 4ECRA 3O1LA 1H6KX 1LW2B 3D6TB 1KD1T 4XO0A 2ROGA 3TQ1A 3THPA 3RB6A 4LF6F 1HBOB 4KKOB 3JYTB 2J0WA 4JI4J 1IQTA 4G1QB 2GAHC 3HHLB 3PEHA 2V68A 2XY6A 3C6UA 3WHIA 2DNKA 3IR6B 1TV6A 2CPIA 1WF1A 2L9DA 5D0EA 4KGXB 2YNFA 2BVZA 2FVSA 3UO0A 3TWZA 3C19A 1T11A 4OZLA 1DQ9A 1NJXA 2ZWPA 3OXFA 1TL5A 1R3NA 2VC0A 1XIQA 3NWGA 5I42A 1PSDA 1EHWA 4ZJLA 5GAEI 4BCAA 4BBYA 4GKKJ 3T9NA 1LWCA 5HBMB 1EQMA 2QL5B 2YH1A 2LQ5A 5GADU 4ECSA 1QAYA 2J5AA 5KFZA 4USHA 3SMZA 3NS5A 4DL3A 1NEEA 1UPMB 2W25A 1Z2LA 1FWKA 3PCOB 4JYAJ 2ZZTA 3IR7A 1RTZA 2P6SA 4F3MA 1TL3B 4PXDA 1EB0A 2MZSA 2KN4A 2KVIA 5IM0B 4WIIA 4PAAA 3UE2A 3GYGA 4MK8A 4JI3F 2PO4A 1F0XA 3I5BA 2CG8A 1U6BA 4DU8A 3ZO7A 3PJWA 1EA4A 1WOOA 3PYEA 5J2QB 2VPWB 3DRRB 5KFFA 4DX6A 4B3MF 3R5JB 1MLAA 3B82A 4RUHA 5IT9Y 1TUGB 5IOLA 4UQGA 1ZM3A 2ZBRA 3EJMA 4JP8A 4DL5A 4U7CA 4EO8A 1FRHA 2ACYA 3MWBA 4J9PA 3NCRA 2ATCB 2XC9A 2HVZA 1GAOA 5JJBA 3BSAA 1F3VA 1UAWA 4OZ1A 2ZUAA 4I4BA 3KYLA 4DR5F 2LMIA 2XZDB 4YDDB 3QRQA 3KUEA 4WU2A 4YHHF 4FXVA 1YSJA 3P4UB 4ZVPB 4MIWA 1HHTP 2G2ZA 4PKDB 4DLEA 5K14B 2CNLB 1SQEA 3BR9A 2EFOA 1HYSB 5D8HB 1SJRA 2ZNZA 4F7VA 2B3TB 3GJTB 1ITPA 1T8EA 3KG0A 3CDUA 3RRKA 1YITS 2ZH3A 3P45B 1BQMB 3D1OA 2Y1IA 2B7CB 1FD8A 2WBMA 3HMJG 1YK9A 3BSCA 4ED3A 1QAXA 4PRFA 2HK2A 2J7KA 2MZTA 2GS8A 3H2LA 3OTDA 2KT2A 4HTIA 1Q82T 3DLGB 1HBMA 3WDOA 2CJYB 2UXBF 1IBMJ 2FDNA 4N76A 5BYRA 5LSRA 2MQLA 2IM3A 1TL1B 4NYOA 4N5SA 3BGUA 4LRVA 3A3NB 1U45A 2HHTA 3Q8VA 3LALA 1YWXA 1FKOB 4M95A 5CCLA 2Z0GA 3MHYA 3KJVA 1U1OA 1WACA 3QJLA 4RNMA 4RW8A 1RT7A 3FJ2A 1RWXB 2I5JB 3LWMA 4RUBA 1G3OA 1MWZA 5DJBA 2VL1A 1M1GA 3OL8A 3KHLA 2K29A 3I9V9 1NSPA 5DLFA 1KP6A 2HAIA 1OWXA 2O66A 3M6VA 1C1CA 2IMOA 1FDAA 4CO4A 2HZCA 1EP4A 1SH3A 2DH9A 4NEYA 1YBTA 5ETOA 4MK7A 3TAPA 4QJVA 4CLZA 5ETTA 4DSEA 2BOAA 2E1PA 3W66A 1KLNA 5F8GA 2X1GA 4K59A 1TZ0A 3T5HA 2KELA 2BR0A 4K4YA 2GV1A 3UPFA 3HJVA 4PPZA 4DPTA 4PWDA 4JI2J 2YNHB 3BZQA 1KS2A 4HI2A 2YNGA 3BQ2A 1VYAA 2VG6A 1T02A 4CLUA 5HSPA 4K2XA 4NLWA 2O1PA 4CH0S 4OYMA 5JMNA 4LREA 4ID5B 5LM7E 3JXOA 2ZH5A 4JI0J 2RVJA 1KSPA 4KO0A 3QT5A 3BGFA 2GO9A 3Q23A 3HHKA 5L9XA 1OO0B 4DN9A 1VFJA 2XLKA 1CJKB 1WNEA 5HMWA 1IKYA 5U47A 3CDBA 2NXCA 1GXLA 1KEKA 3CMES 1VDHA 2B51A 3G96A 4PQAA 5H9FJ 4V19X 1UFWA 2P9EA 3DRYA 3N28A 2CKWA 3UN2A 4DL6A 1CJTA 2X3GA 3O6QA 4NEZA 4M5JA 1RT2A 3OHBA 1UTAA 3AJDA 3LP0B 3IO1A 4KGKA 2N82B 3CJQA 1S1WA 4C8OA 4RLEA 2CRLA 4B17A 2DNPA 2R8IA 4P2MA 3NGTA 1AZSB 1ZYQA 4O4GB 1LW0A 1VGYA 4ZN1A 2MEWA 1HNWF 3P96A 2DPIA 1XNRF 4DL0C 2HRYA 1P27B 1U0HB 3FRYA 2HQ3A 4I2QA 1VLYA 4ZP9A 1WJ9A 3BKFA 4K4TA 3DRSB 3KJQB 4KV8A 2OPSA 3AT1B 3RG6A 3GG1A 5C25B 2OHDA 2GHWA 4XK8C 4LFBJ 1S12A 5EWEA 2ZVIA 4L73A 3SFGA 4RPFA 1WD6A 3LF0A 3HKZD 2ZH6A 2MZRA 4ZJQA 4JI5J 2GGPB 2LEAA 2R7OA 1J27A 2IIHA 2COLA 4A8OA 4KH1B 3K5LA 4OV6A 1NKBA 1HWKA 4EK2A 2DHSA 5A6PA 1IQZA 4H4OB 5DM7Q 3DLEB 2F63A 5LXYA 4KB7A 2IHR1 3L3CA 2KXNB 3FDSA 7AT1B 3TA1A 3G6VA 3V81A 3GLJA 4UY8T 2C42A 2PC6A 3DOLB 5KG6A 3W1YC 3UVJB 1BE4A 2IVMA 1V3ZA 3M2RA 1PBAA 3T6JA 4NCBA 2W2PP 1N54B 5L9NA 1F5BA 1MMDA 3IN5A 2DBBA 1I5OB 1JLEB 4JI6J 1CULB 4USTA 5DZ6A 3GTYX 2E7XA 2LXFA 2MJNA 3DXSX 1RYSA 1PG5B 4IDKA 3IRXA 3BGOP 4EBCA 3ONQA 3QO9B 3L09A 3HT0A 4KBIA 1HMVB 3MDFA 4IFVB 4OX8A 4NZ0A 5ETRA 3H40A 2JC0A 2YTCA 3HHLC 2IBOA 3DOMB 3MUVP 4M5GA 1SJQA 3EUNA 2NYHA 4X84A 5D4OA 3C6TB 2FZCB 3AAWB 1D9AA 2EKNA 2G13A 3IM8A 3KK2A 5B0FA 2RDIA 5IWAF 3B78A 3BV8A 4KSEB 1FKPB 3Q8SB 4ECXA 2B7BB 3IAS9 3JSMA 2MYFA 1IM4A 2K1RA 3RBZA 1OPIA 2DGSA 4BC7A 5J2PA 4X66J 2PE8A 3KLFB 3TI0A 4K7QA 2QEXS 3PO5A 1PYSB 2AV5A 4YR2A 1JLBB 1PIEA 3OVSA 3R5BA 4W90B 3GPAA 5B09A 2XYGB 4HT7A 5KG4A 2XCPA 1FT8A 4MMOA 5HI7A 2XCAA 1UW9A 4B3TF 1ZM4A 2BEFA 2JDJA 3J81j 4DV4J 5F9NA 4DS4A 4RBTA 4WKYA 3AODA 1Y3JA 3GXQA 4FF3A 3H5YA 2AJ0A 1D8YA 3M8PA 3E2EA 4I2PB 1ARRA 3ZZOA 1NHVA 5G0RA 1CJVB 1I3OB 3W63A 5B08A 4K0KF 3C14A 4KGZB 3IWNC 2XYHB 1WC6A 4TLRA 2I6WA 3QFWA 3VGVA 3HHDA 4CLSA 3QQCD 2ZEJA 3N9UC 4ES1A 1S1TB 3QWPA 4KRWA 3CJ0A 3E51A 2V8VA 1UEUA 3H20A 2VV5A 2CZ9A 1IVZA 5T7LA 5K8PA 1Q7LB 1UPPA 1WHVA 2R2SA 1MU2B 2UUBF 1KN6A 3J7A1 3MAHA 2KB2A 2Z4PA 4U95A 2R7WA 5KG5A 1GXTA 1U47A 4OHYA 4GMKA 3TZYA 1X5OA 5T41A 1X9MA 3C15B 1R7IA 2MLXA 3WZ0A 4Y3CA 1MMNA 2K06A 2YWWA 5B0CA 1NB7A 2F8EX 2BDPA 3CCVS 2RIJA 4RW9B 1RT1B 1UFKA 3X1LB 4R8UB 2ZUGA 4HVZA 1Q53A 2J6TA 2OGUA 2V4JB 1RTIA 1APSA 2P2CB 2NSCA 4NCGA 5KG0A 1VRQC 2MQQA 1T3OA 3N6LA 1J5OB 1SKSA 1H74A 2XZTB 2K6LA 2QA4G 1RWOB 4RW6A 3GJQB 3K17A 2BYCA 3G6ES 5LSLA 2P5VA 1REGX 4CLWA 2KRBA 2H54B 3O3LA 3NNEA 4J9SA 3NY0A 3ZC4A 1TVRB 3N01A 4CWBA 3MD1A 1L3VA 1WOSA 4HACB 4FF1A 1N34J 1GTEA 1I94F 4PUOA 2HHHF 1NHKL 1TTHB 1REVA 2IDEA 2RQCA 1Q78A 2XLJA 1C4CA 2WONB 1R8CA 1NPKA 4ELVA 3UCZP 1JXLA 2XSJB 3Q86A 3UDVA 1IJFB 2FHKA 3IBWA 3NEKA 1SL2A 2HS0A 5FLXY 4JUZA 3NBPA 1RB0A 1Y5IB 2VG5A 4Y28C 3PFOA 5A8KA 3CD7A 1S76D 3ETOA 4WFNQ 5CH7B 2WW4A 1FE4A 2A2CA 1RISA 3KWMA 5F0WA 2WOMB 2M7SA 5I4MA 4HT5A 2IC3A 5E7OB 5D4LA 4NLQA 2B4UA 5ETQA 1ZA1B 1UVMA 4O44A 4FP9A 2BRKA 1S99A 2IFXA 2QSWA 3NMRA 4OX7A 2BM0A 2VBYA 4DSIA 2CNOB 5HROB 3CJTA 1N33F 5HLFA 1U49A 3UWTA 4AFFA 4F4YA 3RRGA 3DDNA 3N4WA 4I56A 3EGZA 4DL2A 4C6AA 1AUDA 2AZ3A 3HX9A 3PHTA 2OH2A 1Y00A 2VBWA 2L9WA 4IG3B 2ASJA 2MY8A 1MW7A 2I9SA 4K4WA 1G7CB 2DNRA 3CJRA 2QA4S 3FGVA 3MEEA 5M2UA 1X4DA 2DY1A 3JSBA 3O5TB 2VG7B 2EFGA 1W2IA 1Q8BA 5JUMA 4ZVTB 4CDIA 3J7YU 2XMVA 3B54A 4KHRA 2F3JA 2DY9A 2B9EA 3CF5Q 1Q0NA 2DYAA 1JLQA 5AE1A 4WE1A 5GADI 2Z56B 1V6HA 2EKYA 4Q44A 1PYOB 4MKBA 2JVOA 2J0SD 1RWKB 4CYUA 1GMUA 2XS7A 3VZIA 3H5UA 3W7BA 3NGDA 1X4GA 3H5SA 1DY3A 2L9NA 2U1AA 2MHNA 5B0AA 2ZHBA 2RB7A 4Z37A 4C11B 3TVZA 1WUUA 3VW4A 1KVIA 3A12A 3IWXA 2HS4A 4O4RA 4LR8A 4C7QA 5L38A 3RBXA 4DR7J 1WDDA 3LH2S 4CO2A 2RS2A 4C8MA 4ZKAA 5D3GB 4M5NA 3OJUA 1B4SA 1GK8A 2XG8A 3I0RB 3NS7B 3CCES 1RAAB 2CJXB 1H2TZ 1EKRA 2CQ0A 2BACA 1CJUA 2EC0A 4OI4A 1QAJA 3NGKA 1F2GA 5HMYA 1ZAXA 3MM6B 3W5XA 2BE2B 2HBRB 4I6YA 2NXNA 2B56A 2AEMA 4V19J 2VH7A 4YB5A 1H7XA 2W01A 5J1EB 4KJIA 1JJ2R 3LWLA 4RW7A 2MMYA 2ASYA 1GMWA 1GMWD 3Q8UA 2M8DB 1RT4A 3R2CJ 4NLRA 2CJKA 4B9MA 4PXCA 1V3SA 3I82A 2DEJA 2V4QA 3ITHB 2AYMA 3OL7A 1ZTWA 1U1RA 2HAFA 2MSTA 2QLWA 1BDVA 1HD1A 3ZFVA 2M9KA 2AGPA 4OI1A 2JXGA 4DL7A 1RT6B 2GVDA 5IQ6A 4WIQA 1TKXA 4AE5A 2F8HA 1FNXH 5KFPA 1B7FA 2QLJB 3SSSA 1U6FA 2VB6A 1RWNB 5DG7A 1OYDA 4ZPWR 3HVRA 1DQ8A 2KZMA 4F2SA 1S6UA 1VC6A 2BRLA 2G0IA 2BXJA 2KZZA 3M32A 1WG1A 4M5HA 2FJWA 4EGLA 2A2DA 2M3DA 1DLOB 3MCOA 3SQGA 2IVFB 2HRTA 4O3NA 2FJBB 3R1LA 4QR1A 1KC8T 4Q5VA 2XO7A 1HBUB 4KE5A 2XHWA 4QWDA 1RK8A 2H4WB 5B0GA 3LP2B 2L48A 4NI2B 4WYWA 4DR6J 1C0UB 4MKVA 3SDEA 3VAJA 3D2WA 3MEDB 3DYAB 2C3UA 4NLUA 3IRWP 1N4LA 2CUYA 2DH7A 1E6YA 2Q1LA 2VBXA 1RTDB 3TAMB 3W9JA 4EO6A 3PYGA 3AOCA 4QZVB 4LFAJ 3ZZZA 1QTMA 4A8FA 3MM5B 3T1YF 3D1QA 2VQFF 4R0JA 3M7VA 4ZVFA 3E01B 1R27B 4B3OB 1X93A 4LF5J 3VCDA 3PZPA 2FLLA 5HP1A 4LBIA 3RZAA 1YHQS 1N36J 1KVJA 2DGUA 1CSJA 2H5JB 1ARQA 4IO9Q 2APOA 1T9YA 2HWHA 3RBDA 4KHPJ 2DJWA 2RRBA 4JOUA 4ECYA 1L3KA 3VZHA 4HLBA 3MM8A 1X9WA 2G0JA 2VICA 3H8YA 3R5AA 3QWUA 3ADAC 5BJRA 3BO3A 2C2RA 3MAAA 2QX0A 1Q16B 2ZVSA 5KT2A 3LAKA 4MH8A 1VQ7S 3MR5A 3EGNA 1UVLA 3DDIA 4GO5X 1SKUB 3QT8A 3JTNA 5AT1B 4QYRA 2YQ1A 2CDQA 4OHVA 1KTQA 4BLGA 2XY5A 3FC9A 3KXDA 2I2YA 2XMAA 1YJRA 1AYEA 3EWGA 2HEKA 3SBMA 3W8PA 1LV5A 5KFVA 2V9KA 4U8YA 5CZXA 3KLEA 2ZJPQ 3HSJA 2YNFB 4ZN3A 1NKEA 2QA1A 3DRPB 3MM7A 5HATA 3BH6B 2FIUA 5I42B 2KH9A 3TJAA 3WQPA 2BANA 1RAOA 4Y2MA 1WG5A 3K7RA 3TAQA 5K9FA 2MZQA 3FMWA 1SV5A 1NMEB 3A13A 3D28A 1Y9OA 4RR5A 5THWA 5C7PA 3BPDA 4ZP7A 4F26A 2AU0A 4NX9A 4NLTA 2CQIA 1SL0A 4DQSA 1FK9A 3V6JA 2YWHA 1R31A 2KYXA 3CD5A 4ZS6A 1WTFA 3MM9A 4B3RF 3GONA 3IR7B 1YVFA 2R9LA 4KYZA 3I4HX 1J5EF 4WU3A 4WFXA 4QPTA 1X0FA 3KLGA 2VFSA 5CD4A 4NCAA 4UT4A 1S6OA 3MOJB 2WVBA 2UV8A 1XEZA 1B0TA 4GVBA 5IZHA 1N5TA 3DHXA 5D77A 4HEA9 3M8SA 4ERDA 1OQ3A 1EZZB 3V5RA 1HL6A 1FA0A 4KGVB 5ITHA 4ANDA 2P8IA 2XLIA 4CT9A 4HHHA 3PYDA 1Q7YT 3P3DA 3MECA 2ZE2A 1RTJB 1F1BB 3U7JA 2YKOA 4ZVUB 5IQQA 3GV7B 4W98A 3RB3A 4OJ3A 3NG8A 1NK7A 1XNQF 4I68A 4DX7A 1QE1A 2V8PA 4LSNA 1H98A 3ILIA 1SB6A 5D0RA 4P6QA 3R5DA 3TUPA 3PYFA 1LWXA 3T1AA 2ROPA 5GAGU 2IDLA 1RCXB 1ZAWA 3VHQA 2VPXB 3RB4A 4L72B 2VDHA 5ETSA 3CD6S 3GIKA 4IG0B 5DG9A 4WTOB 3G8TA 4PZVA 3FFIA 3OLAA 2DGOA 3G4SS 1SQGA 2XB2D 1GTHA 1A9NB 4HV0A 2ABYA 2V2QA 2EI5A 4OYXA 3IG1B 4ZP8A 1ZPWX 2Z57B 1VQLS 3QIPB 3W61A 3IC1A 2YPZA 3G8SA 4RWXA 5AXKA 3QGPA 3L95X 3KTQA 1DTQA 2NPFA 4N8NA 4LF6J 5CXTA 4F04B 1RCOB 3X3UA 1HBMB 1JLAA 1Q4RA 4IFYB 4QU6A 3IA0A 2MQNA 1IKXB 5JVHQ 1F60B 4QYZJ 3HZGA 2V94A 2M4MA 2VFUA 4GRSA 5KG2A 1P6TA 4F8RA 2HQFA 4JV5F 1VQPS 1BQNA 2UUAF 4FNHA 2MQ8A 3KJVB 2DNLA 3ZZRA 4X4OA 2VHGA 2OELA 3CJKB 1RT7B 4FYVB 3IS9A 1BUXA 3CJSA 3OXLA 1TAQA 2PA8D 4YR3A 3UFCX 1F3FA 2N7CA 5DETA 1PBUA 4A8QA 1NDLA 1C1CB 2NUUG 4P2SA 1TKTA 4DEZA 4DV3F 2BX6A 3AJ2A 2AJ2A 4KPCA 1URRA 2XMTA 5KFKA 2ZKUA 2W7AA 3S1TA 2DNOA 1TL7A 4HH0A 4JI3J 4J9OA 1B64A 1U0SA 4WFYA 3SV4A 3AD9C 2IM1A 3FBBA 3A3PB 2IY5B 2GJFA 1X4FA 4DUZF 3ICLA 2YNGB 3EGVA 4ZPDA 1RT3B 1H72C 2FVCA 2ACMA 3KNAA 2DR8A 3FMBA 2ILZA 4B3MJ 1YTYA 2FLOA 3KHGA 1EIYB 3NNHA 2QG9B 1NSKL 3H59A 2JLEA 3PEJA 3IR5B 2XGQA 2ZM6F 5I3QA 4ECUA 4V1Ak 4CRJA 3RUBL 4P71A 3SXLA 2MQMA 1QTNB 2OP5A 1RLCL 3BB5A 2X1AA 2ASLA 2OAUA 1CJTB 4LIWA 3CUNA 3DGVA 1Y11A 3CEDA 1EAYC 2XI3A 4DR5J 1RT2B 3DI6B 3J80U 1GNKA 4ZHRB 1WF0A 4CH1A 2IMWP 1BQXA 5D15A 4YHHJ 5KG1A 4M5MA 4YP3A 2DHHA 3VAIA 3IBCB 3K0JA 4B02A 4H4KC 5DQGA 4FF4A 1RTHB 4QR0A 4UY85 1M5SA 2MKJA 4WPAA 1YGYA 1D0EA 5KT5A 1IBCB 2RQKA 3QPIA 2F9DA 2XGPA 5J1NA 4OIXA 1TK8A 8ATCB 3FT7A 3FRZA 2ZH7A 2YQ3A 3I96A 5C24A 4FS1A 1XN9A 4I2QB 5L46A 2GA7A 2YQ0A 1LWFA 4LR9A 5F0UA 1S79A 4P52A 3HVAA 1OG7A 2IA0A 1NSAA 4AQYF 3Q24A 1YBUA 3UN5A 5EHHA 3UDLA 3T3FA 3US5A 2UXBJ 5D4PA 3Q83A 4OI6A 3OFGA 1XMOF 2NYIA 3K89A 4ZDNA 2PMWA 4PYDA 3A8IA 4I7FA 4DV1F 3KHRA 4IOCQ 4R5PA 3Q0AA 3MMBB 2HURA 2QL7B 3K59A 3EDRB 4MYUA 4DSFA 1S48A 1UP1A 2CQ2A 3HCXA 3C66A 2HHPA 3CMQA 4UW2A 1SIWA 3VEBA 2RH3A 5DQIA 1FKAF 1JJHA 4ECTA 3MXHP 4CCHA 3R9LA 1B7YB 3GSDA 3PKYA 2HBYB 4DUTA 4RO0A 3MURP 2M8HA 2XSFA 3G82A 1KR4A 3M2RB 3WX8A 2O5DA 2QLXA 3LGMA 2CWXA 2EVZA 1P1TA 2FY8A 5KFQA 2OEKA 3TP2A 3Q8QB 2BQUA 3DU5A 4LSLB 3KUGA 1LNQA 3I32A 2C2ZB 3ILJA 3OSPA 1O6XA 2NR0A 2FTRA 1RBLA 2XEXA 1S59A 1Q1KA 3HM9A 4J9LA 5HQ8A 3D4JA 4IDKB 3IRXB 3J81Y 4OJHA 1XMBA 3MCNA 2VKZG 1YJWS 4S0MA 3WX4A 3A3OB 3GG0A 2HFZA 3CCSS 4NE9C 6FDRA 1KKHA 5EUHA 2NLWA 1S9EA 1ZAVA 3MF5A 4B9VA 3NOCA 1X5SA 3EZ5A 5E3AA 1PO6A 3EGWB 2XO6A 2EK6A 2CJBA 4C0OC 5IV4A 3FBFA 2DCLA 3W62A 2FC8A 2HMIB 3KK2B 5HVFA 1YLXA 4Z7CA 4C0HA 1K0VA 4TY9A 3ENVA 4ELTA 4YB6A 3JSMB 1UVKA 3J7ZT 2HRUA 5KFLA 3V6KA 2K1RB 3I5AA 1YDLA 4Q2LA 4F25A 2J0QD 5J2PB 4FVMA 5A8WA 4DS5A 2HVHA 3KMQA 2K3IA 2LKZA 4WFBQ 1NK4A 4UF4A 3ILOA 3RAMA 1FX2A 3PVXA 1XQIA 2ROEA 2QC3A 5KFGA 4KC5A 3HLUA 4DPWA 2FVRA 2FC9A 1HNWJ 5EDWA 4XIUA 4DZDA 1LK5A 2QSFA 4BDPA 1SBRA 2DD8S 1XNRJ 4EU0A 3W5ZA 5AJ3F 2XMKA 3MR6A 3HO1A 5E3QA 1RU1A 3CO9A 3QBCA 4C3MA 3QGIA 1X4EA 5L1IA 3RW7A 3OTBA 2PIIA 1CC7A 4M5DB 1RKJA 5J2NA 1U2RA 3GILA 1YKWA 1N0UA 2E5LF 3C46A 2AWZA 2N3OA 1VJQA 2HLTA 3OPKA 1FJEB 5F3ZA 4DI6A 2W8LA 5KFTA 4DZ6A 2DISA 5DDPC 2BJEA 1MG7A 2UU9F 4KFBB 4WTYA 2E1CA 2PI4A 2BA9A 4DJBA 3EXCX 4TU9A 4KH0B 3H5XA 5HAOA 5T7LB 1NSQA 2PDAA 5LXRA 1S6PA 3T5LA 2ADBA 2KU7A 1HBOA 2FHMA 4KKOA 3JYTA 2CPXA 5KFHA 2WVCA 1DAXA 3VGTA 1Q5YA 2QO3A 1GX6A 3C16A 3BBFA 4ZITA 3FSYA 4DFPA 2FVQA 1I51B 3HHLA 3HHLD 3R6LB 2RSQA 3N6MA 1LXNA 1BY9A 1N5YB 4EZ6A 4I69A 1D9FA 3IXQA 3RRHA 3I56S 1HKAA 2DO4A 3O2IA 5HVGA 4UOGA 1VBXA 2F9JA 5MAOA 5A8RA 1YJUA 1RABB 5H9EJ 4YB7A 1QM9A 3M8RA 3G6XA 3BKUA 4U67Q 3OL6A 2ADCA 1S1VA 4WJBA 1EKSA 4NMLA 3M1VA 5HBMA 4X4VA 2K8GA 1WI6A 2Q6BA 1WC5A 5D6GA 4RW6B 2KJVA 1DFDA 3K5NA 3GIIA 1UJ5A 2Z30B 1AB8A 2J0XA 1TL3A 3MZIA 3L4BC 3FEYB 2W2NP 4LRCA 4U9RA 4DFJA 2K7KA 4BS2A 2VOPA 3H87C 1U09A 2G0CA 1E6VB 4IRKA 4JI2F 1XK8A 2CQBA 5KFIA 1NUEA 2BMBA 2KXHA 4MKAA 5J2QA 2V50A 3DLLQ 4PUOB 2D74B 5DDOC 2FJDB 2QTWA 3Q8PB 1FEHA 4ED2A 1K73T 4W4MA 3NNAA 4JI0F 5DGBA 3G87A 3HDSA 4RX6A 1L3TA 4DSJA 3WC2A 2EG2A 2XNRA 5BYSA 2VQEF 4AL6A 3VAGA 4F67A 3MCSA 2YKAA 3Q2SC 3F41A 3BDPA 3FMTA 5A8KB 3G5OA 5H1SV 5F8LA 2G4BA 4C8NA 4BC9A 4AL5A 4F4KA 4WP8A 2V2KA 3MCMA 3GMGA 4AAIA 1OSDA 2IC3B 1S57A 3LP1B 3NP5A 4OZJA 4ICLA 2Y1JA 4O44B 3PV8A 1GEHA 4NPOA 4Q7AA 1G2EA 3DN9A 5FDLA 1U6ZA 2Z2YB 2V69A 1Y5LB 3PW5A 1YJTA 3B8HA 3BGRB 3FSIA 4K0KJ 4NLXA 2HNYA 3VQSA 2K7JA 4F4ZA 1URNA 5K14A 4F50A 2BJDA 2HLUA 3HT3A 5HLFB 4PG6A 2FQQB 4NLVA 3TZXA 5HMXA 2HNDA 3RYLA 1UKUA 1MYKA 3DM2A 2XS2A 3ULHA 1N5QA 3VAMA 1CVJA 2VJVA 1JWWA 2PD1A 4FYDA 3OHAA 1J2VA 1BQMA 4HHUA 4RL1A 4W92B 2ZH9A 3MEEB 1NRKA 4EYIB 3V4IB 2FHJA 2FHJD 1EQ0A 1KQFB 2UUBJ 4LFBF 1LK7A 1DBDA 2XMWA 3AQOA 2IJFA 2WTFA 3D6MB 2H3AA 3GV8B 2AP6A 3RAXA 3HHNB 4AXIA 1JLQB 3H90A 3K8VA 2LQ8A 4JI5F 1CQNA 4ZVHA 2QYCA 4CYUB 1FKOA 3RTVA 1ZM2A 1OMSA 4DSKA 2DT9A 2DH8A 2I5JA 3KLIB 3L9ZA 1R89A 1S1XA 1VOMA 2VFTA 3SQOP 2QYGA 1NKCA 1TAUA 1FFWB 4JI1F 3VVTA 1Q5VA 3LUYA 2LDYA 1RT5A 2MQPA 1SQFA 4C8LA 5CQGA 1HIYA 2C2NA 2JRSA 3VAKA 3BYRA 1QSSA 2UVRA 3M2UB 1F9FA 1NNDA 3CXCR 2N3LA 1S49A 1ZZFA 3PACA 3M8QA 1KFSA 2DCUB 4CLLA 1WKJA 2AHOB 3FBEA 1M1HA 2ZD1A 3QAEA 2NSBA 5KG3A 1CJUB 1SJ1A 3HD2A 1X5TA 4TLQA 5KFAA 2C2OB 2FJVA 1VQ9S 4NXNJ 2VFRA 3MR7A 4ETZA 3R5GA 5ETNA 2UVWA 1LWEA 5FJ4A 3TVYA 1I94J 2HHHJ 3QJPA 1U1LA 3U02A 3ZZYA 3PY8A 4PQUA 4ID5A 2AMCB 4OFZA 1FRMA 2J9DE 4EWTA 1RACB 4RW7B 1RQ0A 5KFDA 4C4WA 1YQHA 2GO8A 1IWAA 1OQ6A 4DG1B 2J7UA 1MN9A 1CJKA 1RT4B 2QMUB 5GAGI 2XWXA 3H98A 4OZ2A 3MPWA 2VUGA 2DRBA 1W7WA 1NH8A 4LJMA 1FESA 1YJNS 1RAEB 4HHJA 4TNOA 4XDDA 4OHXA 2V8DA 2WZ1A 3K57A 2D9OA 2R7RA 1UWAA 1IJEB 1KHWA 4OMFG 1HR0F 3GFHA 2DPJA 1TKXB 1FRJA 4LQ9A 2IBKA 2Q79A 2LCWA 4A47A 2RUSA 4IOBA 2GVZA 1JKHB 5GAEU 2WVDA 3PHEA 1F2HA 4LF7F 4KTQA 3OUYB 2A0FB 4HDGA 4NL5A 1JJCB 4J91A 3GCXP 4DR4F 2CQPA 1AZSA 4J90A 3BSOA 3BS9A 5FIIA 1NH7A 4AUKA 4DR2J 3CCMS 5CAAA 3UD4P 4LMZA 4DR1F 1N33J 1QTGA 1DQAA 1L5UA 2OFGX 3QZ8A 1R8AA 4J9KA 4M94A 2CQHA 2ZBQA 3I0SA 4NYZA 1IKWA 2VF3A 2BW2A 2F4VF 2JVRA 2AGOA 2VASA 5A2QU 3DRSA 3CVKA 5IT0A 4PXBA 2CAXA 1H73A 2AY0A 5F3TA 1X9SA 2HGNA 4YFUA 4USMA 1DHMA 3JS9A 1ZETA 2GW8A 4J9RA 1PAUB 1IN0A 4L74A 4FKXA 1FRXA 3AXKA 3GB0A 4NWBA 2HBQB 4CLTA 1NZ8A 3RR8A 5HP1B 1R0AB 2V8HA 4B9TA 4TU7A 4MAKA 3FVYA 1XTZA 3NAHA 3O44A 3FUYA 1T94A 2HQIA 1HPZA 2NZCA 5IC4B 1NHUA 3CE8A 3ZNUA 1IR2A 4J7CA 1NAQA 4K4XA 3MM8B 3V6HA 3HI9A 2AJQA 2JL9A 2HVDA 4AT1B 4HL9A 3B4MA 1S9GB 5LMUF 3CCRS 3MAAB 4NLYA 1W26A 3M6WA 3DOLA 4N8OA 1FXDA 3VQTA 2GJIA 2D41A 4ZP6A 1NJZA 2JJ4D 3W2VA 2Y9HA 3QRPA 4NRTA 1PKUA 4K5SA 4ED4A 3OFEA 4DQRA 2CPJA 3K2YA 3AD8C 1XR7A 3AB2B 2XBPA 4ID8A 4NLSA 3JQMA 3TO8A 1MROA 2DB1A 4ZA1A 3AH6A 3P8BB 4Y6IA 2C3YA 3OTCA 3N0VA 3BSNA 4RKUC 2AD9A 3TZWA 1VQ4S 3KLEB 4LF1A 3JAMY 1IBKJ 3W9HA 3OLBA 4QR2A 1NBEB 1VIOA 2DR5A 2XMUA 3M6UA 3QO9A 3MM7B 1HMVA 4IFVA 1HARA 1VQ8S 3I31A 3U27A 3DOMA 4P2XA 4DDFA 2VA3A 1RGVA 2W9BB 3C6TA 3LANA 4G1PA 1GQEA 2KJWA 3PX6A 2JNJA 3BF4A 1JNZB 5ETPA 4IH7A 4DR3F 3T5KA 1RAJA 1FKPA 5BYQA 5D4NA 2J9DA 1XR5A 1G4CA 3R97A 1F5AA 2B5JA 4G1IA 4AL7A 1SJ4P 2CJ9A 4PEOA 2QRRA 2RUGA 1N34F 2ZNYA 2AGQA 4OJ1A 2DK2A 1TFWA 2GCFA 2ZBCA 2HHVA 3KLFA 2NQPA 3DLJA 3KLGB 3ZTSA 1F6TA 2LVWA 2PMZD 3H0PA 1JLBA 3KFWX 1NPPA 2OEJA 4GVBB 4G6VB 5E41A 1V5VA 3QIDA 3CNQP 5C2CA 5CD4H 5AXLA 2M5YA 2A18A 2HFNA 5F8JA 2CADA 3BQ0A 5IT9U 4DV6F 4DUYF 1X8DA 2CPGA 3OBIA 2B6AB 2G1DA 4OZ0A 2MSSA 3PIOQ 1VR6A 5HL7Q 1XBWA 2Q66A 4DCOB 1JQGA 4LFCF 1HNVA 5DRKA 4ED6A 2OPQA 3UW1A 2WAQD 4DPYA 4I2PA 2BJ1A 1ZH5A 5E33A 1CJVA 4LSNB 3SIPB 4CO5A 1DRZA 4YQWA 1HQEB 3J7AN 2MHEA 2JEFA 4UTGA 3T1YJ 2MZJA 2VQFJ 3W65A 3OJSA 2HWIA 4ZLLA 2QA2A 2FPHX 2RKIA 3AXMA 1NLAA 1S1TA 5DG8A 1VRUB 3H25A 3PG9A 1K1SA 4OJGA 1TKZA 1S10A 3NGSA 4X65J 1CC8A 1BMQB 2EFQA 3HFZB 3GFZA 4WZMA 4DV2J 4ZPTR 3M8ZA 1U02A 2KXFA 1FJGF 1HWUA 3LQVA 1TUVA 4GKJF 2W7PA 2GZOA 3TX0A 2A6OA 1JK9B 1KRPA 2GQCA 4DQQA 1HNIA 3ZZPA 5SZTA 3C15A 5HMZA 3MAQA 1UWBA 2QT7A 1RBAA 3MMAA 3NOGA 4CM2A 4RW9A 3ILLA 4E8UA 5GMDA 1D8ZA 3ZXWA 3S8SA 4QW9A 3ISNC 4R8UA 3DRXA 1UVNA 4BWMA 2OMLA 1UFLA 2IAJA 3JQJA 1RWWB 3OTEA 1BQNB 1S6QB 2I0XA 3H4BA 3TW0A 4OYOA 4NLGA 5CYJA 3IS9B 2H65B 1NDPA 1AROP 3BH7B 4A8MP 4YMEA 2HNZA 4ZCIA 2JOQA 2B8PA 1TVRA 5JXSA 1MYLA 1UA0A 1RHMB 5LOQA 4DWIA 2DRDA 1WHWA 2IVYA 3FCHA 3GJRB 3P5BP 1VQMS 2KFYA 1NPRA 2F8MA 3OVAA 4OYBA 3HFKA 1QVGR 1J5EJ 2J9EA 4QU7A 2DEIA 4IR1A 4QWCA 2N4CA 4DPUA 2WONA 3HVTA 1UL3A 3TEGA 4DV5F 1SXLA 5GAHU 3I6PA 3GR1A 1XJWB 2I1RA 2JX2A 2VONA 4LF8J 1EETB 1YRXA 3ZZUA 2A10A 3FCWA 2UXCF 2IJRA 2O67A 4QBUA 2GJ2A 1GFWB 5EGYA 4LIRA 2WOMA 4XTTA 4F0KA 4CO0A 2G2YA 3S6EA 1VBZA 3NCPA 2VZ9A 5DM6Q 2YWEA 3VAFA 2M0GB 5A6WA 3Q89A 2E1MC 2G9OA 1XNQJ 4CLKA 2GC8A 4ZVGA 3GIJA 3CJ2A 1U1PA 4ZLNA 4O3QA 4FYYB 5HROA 4K4VA 2VPYB 5IT4A 1FVQA 2QZ8A 3LTOA 4JB8B 5MLCV 1ZBTA 4IG3A 2G2OA 3GIMA 4F2RA 3AA9A 3CT9A 4FXDA 1AUSL 3C8YA 1VQ5S 3MR2A 1N6QB 4CP5A 3CCZA 2R3VA 2EK1A 2AX0A 4F4AA 4WYLA 4FXWA 2LFVA 2H1YA 2DGVA 2AN7A 4LFAF 4OX9F 5C24B 5AE3A 4A8SA 1LWFB 1S7HA 2O01C 3G9CA 2FLNA 1QY7A 1PARA 3W9IA 3I5CA 1HD0A 1WC0A 2ZDPA 4ECZA 3OQ2A 2OPRA 1LFWA 1UCNA 4YN3B 2QLBB 2GX8A 4JV5J 4I7FB 3PNIA 2UUAJ 1U1NA 4LF9F 4ME7E 2H5IB 4K50A 3TEHB 3EPIA 4O3PA 4TU8A 2D3ZA 1FEEA 2DNMA 5D3GA 3NGRA 1SIWB 4TN2A 3DGPB 5DO2A 3CDEA 1C2PA 1WHXA 4H4MA 4DSLA 4B3SJ 4PG5A 3DOKB 4CLYA 1C0TA 5SUHA 3KOAA 3J7Z5 1VBYA 3EMTA 1ZPVA 3RJMB 3G82B 4DV3J 2DNNA 1LXJA 1HA1A 1S7IA 3MM6A 2LDIA 2ZC4A 2BE2A 3EZUA 1AA1B 4OI0A 2WSEC 1ROFA 4AYBD 2QFJA 2YXLA 5J1EA 5HQMA 3GCWP 3H2UB 3PRVA 2J76E 4ZLPA 5M2PA 1M5PC 1M90T 2RILA 2ZDOA 4J37A 5K5MA 5J2MB 3GYXB 4PABA 2RQMA 3I55S 2V9WA 2W9CA 2V5HG 4ER8A 2DITA 1WORA 3EPGA 3C3LA 1PC5A 2HIYA 3CCJS 1LKZA 3CW2C 2OLWA 1VS3A 1U2FA 2GNKA 4H4KA 1S9EB 2NXEA 2RQ4A 4URQU 1FTRA 1DTTB 2ZM6J 1RWVB 1FWLA 5ETMA 3BDEA 3PW7A 4LVNP 3KUHA 4I6WA 3MOZA 1QAIA 2OPPB 2YX7A 3TARA 1O51A 4CZCA 1UA1A 4DU7A 1DLOA 3UDCA 2QMWA 1G1XA 4TQRA 2LEBA 2CA9A 4MTPA 2IJNA 3DCAA 1SJ3P 5LMNJ 4OYAA 4P73A 2JBVA 5KFYA 4DV0J 2HHQA 1ELOA 4D3GA 1TMMA 2IA6A 2E66A 1TQLA 5KOWA 4ETXA 2VA2A 4NI2A 4J9VA 2RF2A 2UUTA 3RGIA 3DYAA 1RADB 4G65A 4UZCA 5GVQA 1Q8KA 2QLFB 1U8WA 3FNNA 5DZ7A 1IBLJ 1V9OA 2J6UA 5RUBA 5KOXA 3S7RA 4WBFA 1S1UB 1KFDA 2W7OA 4ZCKA 1XMQF 3MM5A 2OO4A 3TUJC 2ZH2A 1VLOA 4NA3A 1B28A 3LGHA 2M70A 4B3OA 1PGZA 3N5BA 3FZ2A 3ZZ0A 2J9CA 4AQYJ 2EXUA 2YKPA 2BKOA 5J2NB 4EMDA 3BQ1A 2P6TA 4LSZB 3NO7A 3F0NA 4I6AA 6AT1B 3QRRA 2R7UA 3ELHA 3Q22A 2D7SA 1P94A 2N7YA 1XMOJ 4UUXA 4DV1J 1N32F 2Q3PA 4LBHA 1QJHA 1NB2A 3QZ7A 1FF2A 1U25A 2UUWA 4KIAA 2ASDA 3MI7X 1YJ9S 3UR3C 2QJ3A 3SZ2A 1KLMB 3CJ4A 1S6PB 4ANEA 4RWWA 1H3DA 4CNZA 4PXEA 3C16B 4O0IA 2B43A 2DKOB 1QLNA 2OD4A 4C8ZA 2RS8A 4R25A 1F5CA 2C3OA 2EFNA 3L7PA 1YJVA 3R3TA 1SUQA 1VC5A 3CCWA 4YY3F 2HKEA 4MFBA 1HLWA 5CYQA 2HQDA 4JI7F 5IXUA 3DRPA 5I3PA 3BREA 5A8RB 4LUBA 5KFJA 2IRYA 4X4SA 4USKA 5ETKA 1RBOB 4JBCA 2J8SA 4NZ7A 2JFKA 1S1VB 5HO4A 4C8YA 1PAEX 5AE2A 3M1VB 4LF4J 2ZBPA 2QGFB 4TQSA 4ZJOA 4X2BA 4TY8A 4Q0BB 3TOQA 1HW8A 2UXDF 2K5JA 3WC0A 1M0SA 5E3PA 2OD6A 3D3CJ 4QIFA 2N4DA 4ZCMA 2A2BA 2BM1A 1B0PA 4O3OA 5KFBA 3MEGB 1ZS6A 3T9ZA 1B0VA 3KJNB 4FDFA 3FQLA 3M9OB 4DCPB 4C3LA 1FD2A 2JEIA 4X64J 3TX8A 1U48A 2ZJRQ 2AJ1A 1XWLA 3M30B 1B01A 4Y2KA 5FLXU 3D6FB 3GR0A 2LECA 3V2UC 5K8NA 1RTJA 2LXIA 4JI8F 5KFUA 2CJAA 4JV2A 4NA2A 5E2QA 1S72S 4A8XA 5IS2A 1XC9A 5AXNA 2D3O1 3VGSA 4NOHA 1UJ6A 2JC1A 2H51B 3G8QA 5H9FK 1FFSB 2GFFA 5C42A 2KT3A 4KPYA 5LL6d 4M63A 3NAIA 3R27A 5AJ3J 1HBNA 1IWGA 1JLCA 3KG4A 1R6YA 4ICLB 4X4RA 5BR8J 1HHQA 3Q2TC 3R6GB 2DNGA 3HZEA 3W2WB 1A7GE 2B0GA 2BE7D 5FDLB 4ITSA 2V67A 1V5IB 4ZVRB 4NLOA 1Q95G 2HNYB 4CLFA 2FYXA 2E5LJ 4IG0A 3KLHB 1YBAA 4B9UA 3MR3A 1NM2A 4P74A 1D1UA 5EX0A 4YOEA 4UZBA 4K4ZA 2HNDB 4KAIA 5KFNA 2EBGA 1HQUB 3DM2B 4USIA 3IG1A 5BXIA 3OR1A 2UU9J 4IRCA 3QIPA 4OYIA 4UOCA 3W64A 2EPIA 3T19A 3EXYA 4YS2A 2W1BA 2ZKTA 2R7QA 4F4XA 4OI2A 4MK9A 1RAHB 4IRDA 2RMLA 2Q2KA 2MLYA 1OPZA 3EX7B 2HZAA 3UDEA 1CBKA 3BN4A 1RWPB 3DNCA 4OV1A 3AB4B 2W2OP 2YPYA 4IFYA 4IKAA 2KKEA 1IKXA 3CSKA 4ES2A 1HNZJ 2DXFA 1WEZA 1TL4A 2RE1A 4UOFA 4LRDA 2NZ4A 1OYEA 6FD1A 3CO0P 4O3SA 1T9VA 4C0BA 5F8IA 1H2VZ 1N56A 4X62F 3UR0A 2R7XA 1OY6A 2BQ3A 1WSRA 2HG4A 3CJKA 4CH7A 1S1XB 4Y34A 2XULA 4NXMJ 1NLKL 1UETA 2YNIA 1QSYA 4CT8A 1R0BG 2UUCF 3MMJA 3QGHA 1RXOB 4WCEQ 1M1KT 4KY3A 4NYPA 5KG7A 1NK6A 1BLUA 2YKMB 1RT5B 3EYZA 5CYMB 1PC4A 4PR6A 5B0BA 4RBVA 2HFVA 3BN7A 4RW4B 3FKBA 5I3UB 2L3MA 1N8RT 2V2ZA 3MGJA 1VRTA 3RB0A 2HHXA 3IFEA 5IV3A 3KMSA 3M8QB 4L3KA 3Q8YA 4ZPBA 4RZRA 1JXEA 2ZD1B 3PRDA 2HHWA 3UCGA 2MJUA 2H3EB 3EZOA 4QW8A 1Q81T 1WEYA 4CTAA 2XTJP 4FXEA 2CDRB 1LWEB 1RT3A 3CIMA 3JTPA 4LBPA 1KQSR 1JLGA 4DF4A 4PQUB 4CNYA 3NWRA 2L08A 1YX2A 2J6SA 2QFIA 2AJFE 5KT3A 2HFSA 4OZ3A 2E5GA 4XPEA 4ED5A 3C6UB 5A76A 2JHEA 2VQEJ 1TV6B 1I1GA 5K8MA 3SFUA 3CB4A 3D9BA 1N48A 3QNWB 2YBVA 4O0NA 4D8JA 2DNYA 3D0HE 2VJUA 3ZTRA 2A1BA 1MWQA 1HNXJ 1FDNA 3DLBA 2CNNB 2POKA 4F3QA 4L76A 3DFEA 1X4BA 2GVZB 1TU0B 4RNNA 2MGZA 1TR0A 3DI6A 2HFOA 1LWCB 4ZHRA 2ZHAA 3KK3A 3HD1A 3H42A 3ZTOA 2YKNA 1D3WA 4XDCA 3MUMP 1RTHA 5CCMA 5HJYA 2GMHA 2K9IA 1QUPA 3MTJA 1FWPA 4YUDA 3WIUA 2OEMA 3I0SB 4C48A 1FNMA 3EDQB 1IKWB 4C9DA 1HWLA 1Y4ZB 3FSXA 4EYHB 2DR6A 1UVIA 4B9LA 2PEBA 3T1HF 2D69A 1FE0A 4A8YA 3P49B 3VF0B 3SCJE 4Q8FA 1R0CB 4WP9A 2XNQA 3KKFA 3KNGA 3PDNA 3CDAA 2CAJA 1IRQA 2JLGA 2HHUA 2IPOB 3IBFB 4RNHA 2KKHA 1Z1ZA 1FRIA 1S0OA 2UZAA 4FYWB 1WSVA 3RU0A 4G3IA 3UNYA 2B9WA 4KHMA 4PWWA 3MMBA 2BKPA 3R5CA 3VAHA 2RNEA 1SC6A 1MNEA 1HPZB 2MXYA 2KM8B 2WB1D 5ETLA 4Q2MA 3PW2A 2WB4A 4QIWD 1PILA 3GWCA 4JI1J 3R7SB 3MPYA 4ILLA 1VK8A 3FEXB 5GAHI 1T9WA 1AT1B 4CM0A 1CS4A 2HHSA 3W2VB 1FDDA 3E8OA 3L7UA 3LO3A 5DDQC 1K44A 5GMEA 1JLFA 3MMCA 2UVVA 3CTRA 4A48A 2HBZB 3CWJA 3W8GA 1RWMB 1MROB 1N0VC 2GMLA 3BBBA 1OSCA 4LSLA 5CHCB 5KFWA 3PTWA 4RU9A 3NMAA 2DR9A 2DGQA 2JXIA 5HVHA 3PKMA 1H2UX 4FS2A 2F40A 2EFVA 4IQMA 3LPEA 4OHZA 1Q86T 2I38A 1Q8IA 4Y2IA 2C3PA 3G2XA 1QVFR 3GU0A 1HWIA 3VWSA 2XWYA 2NXUA 4U7UD 1RKIA 1WWHA 5KFMA 3WIVA 4RUCA 3CIZA 2E1RA 4RUAA 2HMIA 3U1MA 4USWA 4K5RA 2B5JB 2JEGA 1HR0J 3JB9k 4WK3A 4RW8B 4ZLJA 4USUA 2KHDA 1U9PA 2ATLA 5M2RA 1YI2S 2E7VA 3DU6A 2KG0A 2F7VA 4NLDA 1HQ2A 4LF7J 4P7TA 2BOPA 2ZZNA 3SI8A 3DC2A 2ZH1A 1M5VC 2X7IA 4J9MA 3ISZA 3HKWA 5E0OA 2X3DA 4DR4J 3UN3A 1S77D 1EP4B 2KFZA 4FPIA 3MD3A 5IC6B 3M2VA 3PO4A 2KHCA 2K1OA 3EICA 4DR1J 4NRUA 4DV7F 4BWJA 2WVFA 1TK5A 2P9CA 3DLKA 1XERA 2F4FA 4HKQA 1ZZNA 4DX5A 2Q6CA 2PFDA 1Q8LA 1ZTTA 3QYYA 3NGUA 4PWDB 2F4VJ 2X1FA 4GO7X 1HNVB 3PX4A 2MKCA 2HS3A 2VG6B 2OPQB 1JIHA 4USVA 1RE1B 3NL0A 4LQ3A 2E9ZA 3K8WA 4FKYA 2JFDA 3HHEA 4M5DA 3CJ5A 4KO0B 1IKVA 2IRXA 3IP0A 2Z8QA 2YWGA 2V8GA 3HXMA 1IKYB 3OFHA 2B9XA 2A3JA 2WVEA 2RKIB 3B6BA 1DARA 2F1FA 1BDTA 5DQHA 2XHCA 3L7OA 3N5FA 4KFBA 4NA1A 4WFZA 1TKZB 4ECWA 2W2MP 2FHOB 2RAQA 1ZM9A 1O5JA 1EARA 3FK4A 3U1LA 2HWTA 1IXKA 2IM2A 4ED0A 3AOAA 5LMUJ 4ELUA 2AYBA 2RBFA 5LT5A 1S1WB 1HNIB 4A4JA 4Y00A 4K4UA 2BBEA 4O3RA 2HFUA 1N5YA 7FD1A 3VR1A 1BAZA 4DHVA 1L3SA 1WC1A 1X7VA 1UWBB 3MMAB 1LW0B 2Y1LB 2C22A 2NUHA 2MDAA 2DGTA 2U2FA 2KDOA 5DS7A 3OTOF 2IRUA 2XZWA 2IAJB 1MNTA 4DLGA 2R42A 3POTA 3GSIA 1VC0A 2ZOMA 3ENWA 3ENAA 4KV8B 2OPSB 4MIBA
chains in the Genus database with same CATH topology
2WVDA 2F1FA 1BDTA 3FMTA 2NZCA 3FT7A 4ME7E 4D8JA 3QOQA 3BKTA 3VW4A 2CAJA 1IRQA 1B28A 3LGHA 2K1OA 1BDVA 2WVBA 2BJ1A 2KELA 2JXIA 2BJ8A 1B01A 2BNZA 2GPEA 2JXGA 1QTGA 2WVFA 3PHTA 2BJ7A 3GXQA 2RBFA 2Y3YA 4HV0A 2FGCA 1ARRA 1X93A 2PC6A 2WVCA 1Q5YA 2BA3A 2HZAA 3H87C 1NLAA 2HZVA 1BAZA 3VEAA 1P94A 1ARQA 2CA9A 4FXEA 2CAXA 2AY0A 2K9IA 2BJ9A 3QSIA 1Q5VA 3BKFA 2H1OE 1MYKA 2K6LA 1PARA 2K5JA 2BNWA 2BJ3A 3VEBA 2K29A 1MYLA 1MNTA 1EA4A 2JXHA 2CADA 2BSQE 1U9PA 2WVEA 3OD2A 2CPGA 3BKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVD A;  2F1F A;  1BDT A;  3FMT A;  2NZC A;  3FT7 A;  4ME7 E;  4D8J A;  3QOQ A;  3BKT A;  3VW4 A;  2CAJ A;  1IRQ A;  1B28 A;  3LGH A;  2K1O A;  1BDV A;  2WVB A;  2BJ1 A;  2KEL A;  2JXI A;  2BJ8 A;  1B01 A;  2BNZ A;  2GPE A;  2JXG A;  1QTG A;  2WVF A;  3PHT A;  2BJ7 A;  3GXQ A;  2RBF A;  2Y3Y A;  4HV0 A;  2FGC A;  1ARR A;  1X93 A;  2PC6 A;  2WVC A;  1Q5Y A;  2BA3 A;  2HZA A;  3H87 C;  1NLA A;  2HZV A;  1BAZ A;  3VEA A;  1P94 A;  1ARQ A;  2CA9 A;  4FXE A;  2CAX A;  2AY0 A;  2K9I A;  2BJ9 A;  3QSI A;  1Q5V A;  3BKF A;  2H1O E;  1MYK A;  2K6L A;  1PAR A;  2K5J A;  2BNW A;  2BJ3 A;  3VEB A;  2K29 A;  1MYL A;  1MNT A;  1EA4 A;  2JXH A;  2CAD A;  2BSQ E;  1U9P A;  2WVE A;  3OD2 A;  2CPG A;  3BKU A; 
#chains in the Genus database with same CATH topology
 2J8A A;  3EVM A;  3DXB A;  1GT8 A;  2CPF A;  3EE3 A;  1U1Q A;  3D3B J;  2GHV C;  2HNZ B;  1OY9 A;  2ZC3 A;  3QLH A;  3CC2 S;  3BM7 A;  4DR3 J;  3V4M A;  2OTL S;  4ZIW A;  1T05 A;  2AYE A;  1E6V A;  2VOO A;  4NXN F;  1HI0 P;  4IH5 A;  2XS5 A;  2EEY A;  2JSX A;  4WWS A;  1NXI A;  2OJ3 A;  4IQX A;  1SCJ B;  4B9S A;  1FJ7 A;  4U96 A;  3VTI A;  7FDR A;  2ZH8 A;  2E5I A;  2OSQ A;  3V81 B;  1DZ5 A;  4J9N A;  3T6B A;  3HVT B;  1KOH A;  4JI4 F;  3OW2 R;  3UD3 P;  2HIQ A;  3JSR A;  1UEV A;  5JVG Q;  1SH2 A;  2AEF A;  5T14 A;  3PW0 A;  2CQG A;  1FJC A;  1X60 A;  2BE9 B;  1RLD A;  1UEK A;  3V6D A;  5C5J A;  4TYA A;  4MT1 A;  3SV3 A;  2ALZ A;  4DV6 J;  4DUY J;  1BGX T;  1IUJ A;  3W60 A;  4GVL A;  1SPB P;  3VAL A;  3Q8R B;  5HN0 A;  3JTO A;  4LFC J;  1WKK A;  1FVS A;  3G86 A;  3LP1 A;  2F5G A;  3K58 A;  3K5O A;  2KYZ A;  3AQP A;  4GKK F;  2LEP A;  4QWA A;  1FX4 A;  2CNK B;  4AD6 A;  4FNI A;  2ZJQ Q;  3OR2 A;  4ZOS A;  1FRL A;  3BGR A;  1W2B R;  4ZVQ B;  2BZ2 A;  3IAM 9;  1RAI B;  3NCQ A;  2Y3Y A;  1TP7 A;  4P10 A;  2GQ2 A;  4EEY A;  2MY7 A;  4DR2 F;  1VI7 A;  2KTQ A;  4JYA F;  4EZ9 A;  3BJY A;  4HR2 A;  5B0E A;  4URG A;  4X4P A;  3KK1 A;  2UV8 G;  2W8K A;  1QSL A;  4OHW A;  3T41 A;  3KHH A;  4GC7 A;  1SC1 B;  5A0Y A;  2DIV A;  1VCT A;  4ILR A;  4QQB A;  2FJE B;  1N52 B;  3ISN D;  4RNO A;  3ET6 A;  1U4B A;  1C1B A;  4YB1 P;  2E5J A;  3DMJ A;  1UJ4 A;  3HUL A;  3M8W A;  1T9T A;  3V4I A;  1YZ7 A;  3J7Y I;  1FJG J;  4WKR A;  4GKJ J;  4Y2C A;  2OIH A;  1HFE L;  3PW4 A;  3OD2 A;  4QIV A;  3G71 S;  4X4Q A;  3B4D A;  2FUG 9;  4FVC A;  3MPV A;  4PG8 A;  1NK8 A;  3PIP Q;  4ZPV R;  1WEX A;  3OXG A;  3AY0 A;  4DPO A;  2OMO A;  2FJX A;  1X0P A;  1BXN A;  2CVI A;  2LYV A;  2DTJ A;  2DXE A;  1CQM A;  1BD6 A;  1AXQ A;  1GX5 A;  3CDW A;  1FTC A;  4EBD A;  1I6J A;  1H7W A;  2LU1 A;  1KBR A;  2OPR B;  3OFF A;  3HPO A;  1VHF A;  3KLI A;  2RJZ A;  4ZIV A;  1KON A;  4ALZ A;  1YJ7 A;  5F8M A;  1CPZ A;  4ENO A;  2MKI A;  2XMJ A;  3PFE A;  3M8P B;  4KGM A;  5G0R B;  1Q79 A;  2UVU A;  2ZHO A;  3AOB A;  1KHV A;  1QDU B;  3M2U A;  1T03 A;  1RA7 A;  3C14 B;  1PJ7 A;  1X4H A;  2JZ5 A;  1Y0H A;  3TJ8 A;  4H4M B;  1HW9 A;  2BJ3 A;  1ULR A;  3NLC A;  1SKR A;  1C0T B;  2QV6 A;  4HI1 A;  2K3K A;  1DUR A;  4OI3 A;  3OL9 A;  1TKD A;  2PMH A;  4F36 A;  3PJX A;  2ZWO A;  2NS1 B;  2KM8 C;  4IYQ A;  2VPZ B;  3GYN A;  1IBK F;  2HVI A;  2C2K B;  1M5H A;  1LW2 A;  3F56 A;  2OSR A;  2ZFH A;  1FI4 A;  1K9M T;  4URS A;  4DOZ A;  3BKT A;  1AW0 A;  4DG1 A;  4EI2 A;  3UNG C;  4DV5 J;  4G1Q A;  2GPE A;  2PN6 A;  1UMJ A;  4N7T A;  1RP5 A;  3J81 U;  5D0G A;  1Y7P A;  1IBM F;  4MYT A;  4P9S A;  1LOU A;  4MJK A;  5K20 B;  2AZ1 A;  2EWH A;  2W9C B;  5DGA A;  4N47 A;  4F4W A;  1T3N A;  1FFG B;  1N5S A;  2UXC J;  4A46 A;  3AA8 A;  4OLP A;  2CJQ A;  4ED8 A;  1BWE A;  5KFS A;  1HI1 A;  1X4C A;  4CLP A;  2PGC A;  4WP3 A;  1KNZ A;  4DL4 A;  1D9D A;  5KT4 A;  2BJ9 A;  3BR8 A;  5F41 A;  3SCL E;  1JMT A;  1S0M A;  1JKH A;  3S01 A;  3PX0 A;  1UZD A;  1RJJ A;  1JNR B;  3TUZ C;  3R2D J;  1RTI B;  2VU5 A;  1K1Q A;  2GAG C;  3OUY A;  4NCG B;  3C2P A;  2D1C A;  1GH8 A;  1WI8 A;  2XYP B;  2DVI A;  3BBC A;  3PJ9 A;  2F65 A;  2D3U A;  3HJF A;  4DFM A;  2ZIT A;  3TAN A;  1WC4 A;  3UCU P;  5IM0 A;  3BEG B;  1KTV A;  5IWA J;  3GP9 A;  3QFH A;  1RU2 A;  4PYA A;  2FZG B;  2CZV C;  1SL1 A;  1NO8 A;  3M9M B;  3GIR A;  3TYT A;  2RF2 B;  3A8K A;  1RHJ B;  3M4X A;  3CMA S;  1UW4 A;  3G6Y A;  3ENQ A;  3W3S A;  2AEJ A;  3TZZ A;  3LW5 C;  3DRR A;  2VIH A;  2AYG A;  1REV B;  4LR7 A;  3CCT A;  4QWE A;  5KAK A;  4DQI A;  2CZ4 A;  1HHS A;  4OX9 J;  5KFC A;  1R6V A;  2CQ3 A;  2RU3 A;  2CPD A;  3IM9 A;  5KFX A;  1KWM A;  1VIS A;  3D54 A;  2DIU A;  3GE9 A;  1CLF A;  2HVE A;  3HF5 A;  3M05 A;  2DHG A;  1R0A A;  3NBP B;  5KT6 A;  2VG5 B;  1B3T A;  4BHQ A;  1FER A;  2R7V A;  4I64 A;  3WBZ A;  4X65 F;  3JSY A;  4ILM A;  4B3T J;  4QCL A;  2ZBI A;  2RHQ B;  4L3N A;  2HK3 A;  2VFV A;  3DDK A;  3F73 A;  4DV2 F;  1Y10 A;  2GMJ A;  1S9G A;  4LF9 J;  1SC3 B;  1X4A A;  4ZVS B;  3TQE A;  2BV3 A;  1SIZ A;  2DNQ A;  1ACM B;  3LPY A;  2PA3 A;  3M8Y A;  1OHN A;  3FQK A;  2BW7 A;  5L1K A;  1HYS A;  2FGC A;  4QWB A;  4Y65 A;  3F44 A;  2R2R A;  2LQ9 A;  4CO1 A;  3SEO A;  3FEZ A;  5KFE A;  3DKD A;  4QYZ K;  4PPD A;  2H5E A;  3EM1 A;  1SUQ B;  1NK0 A;  2R8G A;  3O8W A;  1B70 B;  3OVB A;  5K8O A;  3RAQ A;  4JV1 A;  2W2Q P;  4MFB B;  2CQC A;  2QN6 B;  5CYQ B;  2H1O E;  2BNW A;  4L75 A;  4IOA Q;  1WC3 A;  1MSW D;  1S0N A;  1RHK B;  2YX1 A;  3R7N B;  5LSO A;  2MKK A;  1D09 B;  3DLG A;  5KFR A;  2W9B A;  4RU2 A;  4HH1 A;  4F02 A;  1F9E B;  4WE1 B;  1TL1 A;  3R1H A;  1VQS A;  3N6N A;  4TY8 B;  2KG1 A;  4ZPC A;  3SCK E;  5LJ5 Y;  3AJ1 A;  1GMV A;  2NRE A;  1W25 A;  2DRA A;  3HVW A;  4OYZ A;  1ZOT A;  2RDJ A;  2B4V A;  1KVK A;  1FNO A;  2KFN A;  3RBE A;  1VQY A;  4Y0F A;  4LF2 A;  5D78 A;  2RRN A;  3THT A;  4X4N A;  1FRK A;  1SKW A;  2L41 A;  1N5V A;  4LF8 F;  1RWU A;  1TFY A;  2VBZ A;  2C2D A;  5F8H A;  2D9P A;  2HQG A;  3MPU B;  3BPS P;  3QMQ A;  4KQZ A;  3A4T A;  3SSR A;  1FCA A;  4JV0 A;  2XMM A;  1OY8 A;  5HQL A;  2VKR A;  2NPI A;  2B6A A;  2R2T A;  4JI6 F;  4X4T A;  2YNH A;  2SXL A;  4DFK A;  1XR6 A;  4DBQ A;  1AFI A;  1T9U A;  3CGI A;  4P2F A;  4ZVO B;  2W9A A;  4YDX A;  4WXW A;  4FBU A;  5C42 B;  3ZTP A;  4C97 A;  1HQE A;  5AXM A;  3AD7 C;  1XMQ J;  3GFX A;  1HBN B;  1JLC B;  4ED7 A;  3BO2 A;  1PCA A;  1CEZ A;  4HDH A;  1KQK A;  2WRM A;  4OQJ A;  2FVP A;  1T0T V;  3TA0 A;  1RHR B;  3CC4 S;  1NJW A;  4DX8 H;  1SVD A;  1VRU A;  4FZV A;  4XPC A;  2QE5 A;  3D0G E;  4USJ C;  4EUV A;  3MUT P;  3NNC A;  2KRR A;  2GVD B;  2E44 A;  2Y0B B;  1N32 J;  1H38 A;  4ANC A;  2HPU A;  1NDC A;  2FGO A;  3OR1 B;  4X66 F;  2LU2 A;  2BKN A;  4WFA Q;  3GV5 B;  2E29 A;  1GXU A;  2WCX A;  2LA4 A;  3LP0 A;  4OZN A;  3J80 Y;  1G6B A;  3M32 B;  2JXH A;  5IFM A;  2CYY A;  3SQG B;  1VQN S;  1WF2 A;  2QIF A;  3QAT A;  4O4G A;  2CXE A;  2GQQ A;  1BC6 A;  4A8W A;  3BYP A;  5DLG A;  4FN5 A;  5CAB A;  4B9N A;  4DV4 F;  1U0H A;  3D6H B;  4YY3 J;  4Q8E A;  3SDE B;  4OYP A;  1S6Q A;  8AT1 B;  4JI7 J;  5C25 A;  2B4P A;  2DGW A;  3RW6 A;  4PG7 A;  3D66 A;  4CI0 B;  4U8V A;  3TNV A;  4QIE A;  1E6Y B;  1RHU B;  1YZ6 A;  4N41 A;  5E3R A;  5D0H A;  3KG1 A;  2E7W A;  2YNI B;  4ES3 A;  3HSG A;  2BA3 A;  3QT6 A;  2HGL A;  2FB0 A;  2KO1 A;  2EG1 A;  2OUG A;  4B3S F;  3I9Z A;  2GGP A;  1A0O B;  4ZMM A;  4ED1 A;  2ALY B;  1L3U A;  3A8J A;  1R43 A;  1LQ9 A;  1IR1 A;  2UXD J;  2MB0 B;  2A6M A;  1X5P A;  4ZK7 M;  1VRT B;  2HSE B;  3VGU A;  1BHN A;  3CCQ S;  3UD5 A;  4H4O A;  3DLE A;  4E98 A;  2WSC C;  4KR0 B;  3A1Y G;  3OT9 A;  3DHW C;  3NS6 A;  2ZOF A;  2Y8Y A;  4I67 A;  3D7S B;  4CTA B;  3MTK A;  2Y8W A;  2PSZ A;  1ZA2 B;  1HI8 A;  3NXZ A;  2PT0 A;  1CG2 A;  3UVJ A;  4P7V A;  3UI3 A;  1WG4 A;  1S97 A;  1EET A;  1JLG B;  4H54 A;  2KL8 A;  4M1K A;  2QL9 B;  3IGV A;  3EVO A;  4TYB A;  3RR7 A;  2H48 B;  2XI2 A;  1NK5 A;  4UOH A;  5KTQ A;  5EN1 A;  1S5Z A;  4ZCL A;  5J1P A;  1JLE A;  2RHS B;  1TMJ A;  1CUL A;  3SCI E;  1P1L A;  2FJA B;  2AJ4 A;  2M2B A;  2KVQ E;  1U8S A;  4IO1 A;  4JI8 J;  1T9X A;  2IYG A;  2V0N A;  2X1B A;  1OS5 A;  2HW3 A;  3ZNJ 1;  1EX8 A;  3QSY B;  4OYW A;  2CG4 A;  4C98 A;  2BAN B;  2VOD A;  3SSQ A;  2GHP A;  2W24 A;  2MGZ B;  1SV5 B;  1VHI A;  4MKY A;  3QJJ A;  5LMN F;  1P8G A;  1UVJ A;  5F9L A;  3KK3 B;  4DV0 F;  3AFG A;  2D3O R;  4HTJ A;  1FK9 B;  2YKN B;  4DPX A;  2FD2 A;  4B08 A;  3UQS A;  4D3H A;  4ECQ A;  3MM9 B;  1LEO A;  1N6Q A;  4P75 A;  2UP1 A;  1IBL F;  4E0D A;  1UZH A;  3CC7 S;  2B9Y A;  2ZOG A;  3IGN A;  2YWK A;  4OLO A;  4WXO A;  3H2V E;  3LJP A;  1H0H B;  2WK4 A;  4UQT A;  1IR0 A;  3M6X A;  3BO4 A;  1RA6 A;  1AFJ A;  5ADZ A;  2BQR A;  3MEC B;  5E5N A;  4IH6 A;  2BAB A;  3CCL S;  2CIM A;  2AX1 A;  2V2V A;  1F9H A;  2ZE2 B;  1RAG B;  4LT6 A;  3VV2 B;  1TUW A;  4QPX A;  3CUL A;  2HQC A;  1RHQ B;  4X62 J;  3U1N A;  5B7W A;  2NCK L;  3TR5 A;  4I1T A;  2E9R X;  3K5P A;  4DN0 A;  1QE1 B;  1N88 A;  4AXJ A;  3KDO A;  3DGP A;  2UUC J;  1FXR A;  4CQ1 A;  4P72 A;  4YEA A;  1KDN A;  1MWY A;  3QGG A;  1PJ5 A;  3DOK A;  3H4D A;  2J7W A;  3OV7 A;  4ZPA A;  1PYT A;  1YG0 A;  3KJF B;  1CS4 B;  1RUS A;  4DQP A;  2R8H A;  3PRB A;  1JLF B;  3MMC B;  2CQD A;  4NMX A;  2FZK B;  3FFI B;  2WHO A;  3IWL A;  1P9Y A;  4Q43 A;  1O8B A;  2ZH4 A;  1WDT A;  3H7H B;  4YR0 A;  1MU2 A;  2CPE A;  2Z2L A;  4FYX B;  5H9E K;  2K2P A;  4NLP A;  5KT7 A;  3JAM U;  2B8Q A;  4TVA B;  3QSI A;  5EWF A;  1C4A A;  4IR9 A;  1U2C A;  5J2M A;  2Y0S D;  2LQJ A;  2GIF A;  4LF4 F;  1FXL A;  2AW0 A;  1KQG B;  4RJV A;  1DTQ B;  4DCJ B;  3I87 A;  4J5O A;  2CQ4 A;  1QD1 A;  2R8K A;  1Z4U A;  2YVS A;  2CPZ A;  5L1J A;  3EVW A;  1RT1 A;  1JLA B;  2W4D A;  2VDI A;  2CWK A;  1JB0 C;  1VBK A;  2OKQ A;  1DTT A;  1YRU A;  3BGL A;  1S9F A;  2Z2Z A;  4I0W A;  4PG4 A;  5CZV A;  2P9G A;  2V4J A;  2OPP A;  4Z7Y A;  2Z58 B;  2BNZ A;  1J5O A;  1RI7 A;  3CCU S;  4NAS A;  4DR7 F;  2Y1R I;  2RDD A;  4PWU A;  2MKS A;  2C2E A;  5G4D A;  2EC2 A;  2BUN A;  3QT7 A;  1SH0 A;  4Z2X A;  4X64 F;  1K47 A;  2R4F A;  4L6V 3;  4DF8 A;  4LRF A;  3VEA A;  2YY3 A;  1TKT B;  1NCL A;  2R7T A;  3CJ3 A;  3MPD A;  3LA0 A;  2PFF B;  3PR5 B;  3M2V B;  2EBE A;  2V4R A;  3DLH A;  1RDR A;  4HAC A;  4CO3 A;  1NDK A;  4B3R J;  2V63 A;  3FBC A;  1FO1 A;  2MZ1 A;  3HP6 A;  4M5I A;  3DLK B;  3QAU A;  2XQC A;  4F3O A;  2WW8 A;  4M5L A;  4X4U A;  1TL7 B;  1U7L A;  4QIG A;  2YX4 A;  2WBR A;  1S1U A;  4WK1 A;  3ZTQ A;  2YWF A;  4F0M A;  3A8E A;  2ILY A;  2LA6 A;  2XSJ A;  1WHY A;  3R7B B;  2MLZ A;  1WEL A;  4OL8 A;  3T1H J;  2B4O A;  3TUI C;  5BR8 F;  5CA5 A;  2AF6 A;  3KLV A;  1IKV B;  1VQO S;  4O23 A;  2R8J A;  1NJY A;  4K8R A;  1PJ6 A;  3M9N B;  2OFH X;  4R0E A;  3MFI A;  4N56 A;  2JH3 A;  2QMX A;  2BJ7 A;  1VIX A;  1VK3 A;  2ZZM A;  8RUC A;  5HJX A;  4GC6 A;  1VMB A;  4K4S A;  4U6P A;  5C2G A;  2HYI B;  2RT3 A;  2NXJ A;  4N77 A;  1Y5N B;  5HAN A;  4Y2A A;  2CPH A;  2I8E A;  2VC1 A;  2JEJ A;  5ETV A;  2GIR A;  4HYK A;  2DR7 A;  4WZQ A;  4J9Q A;  1JXV A;  1KLM A;  1EJ7 L;  1S4F A;  2EFP A;  4PCQ A;  1R8B A;  1M5K C;  1Y3K A;  1SI9 A;  2MKH A;  2DHA A;  4ATN A;  2FY1 A;  2C28 A;  2JLF A;  4WF9 Q;  1ICE B;  1FHT A;  1HNZ F;  4J9U E;  1O0P A;  4EBE A;  5GMK a;  1NJI T;  2Q43 A;  3D0I E;  2GIQ A;  2EW9 A;  4RNF A;  4DR6 F;  4DMZ A;  1RAF B;  2CQ1 A;  4M5K A;  2LQB A;  3HSD A;  2RU9 A;  3AHP A;  3HFV A;  3HSZ A;  2VG7 A;  3FCV A;  2RD5 C;  4EFA C;  3KDN A;  2C3M A;  2VD3 A;  4NXM F;  3T5J A;  2HGM A;  3CD0 A;  2OTJ S;  2BJ8 A;  2DHX A;  1RZM A;  2Z2M A;  2R2U A;  2AKW B;  3POT B;  4C8K A;  1K8A T;  1TK0 A;  5F8N A;  5E3C A;  2E1A A;  3VVU A;  4LF5 F;  3FZB A;  4Q0B A;  1VQK S;  1YIJ S;  2E9T A;  1N36 F;  3GJS B;  3MEK A;  4KT0 C;  3NRB A;  2MKY A;  3GZ7 A;  3TA2 A;  1SC4 B;  1WKL A;  1RYR A;  1WOP A;  3I4P A;  2MQO A;  3SYZ A;  4KHP F;  2PI5 A;  3QLH B;  4C11 A;  3LOU A;  2H9Z A;  5HK4 A;  1U24 A;  3MEG A;  2O3D A;  1JX4 A;  4R5P B;  1T05 B;  1BWV A;  3PM9 A;  3D67 A;  4QOT A;  3MFH A;  2WSF C;  4RBU A;  4ECV A;  4ZVE A;  3P5T L;  4XAK A;  1SJF A;  1VQ6 S;  1S4E A;  2H4Y B;  3I0R A;  3CPW R;  1U1K A;  2KT5 A;  3M30 A;  4C3K A;  3TJ9 A;  3IMQ J;  4MJW A;  3E3X A;  9RUB A;  2G1H A;  3TRG A;  1NZA A;  4UUW A;  5L39 A;  2CPY A;  4DV7 J;  1OIA A;  1P9Q C;  2V6A A;  3V6D B;  3P6Y C;  3HK2 A;  2AT1 B;  1NK9 A;  5L8R C;  4TXS A;  4IUF A;  1HNX F;  2HZV A;  4NZ6 A;  4LVO P;  4LRA A;  4DXL A;  1A6L A;  4DUZ J;  2CFX A;  3PR4 A;  3W2W A;  4FPR A;  3ITH A;  3GFY A;  3OR2 B;  2YH0 A;  2LLZ A;  3D68 A;  4E2F B;  3D1H A;  2ADL A;  4FBT A;  2MTL A;  1T95 A;  4A8K A;  2DO0 A;  3ETM A;  1RT6 A;  1JJ4 A;  3KLH A;  1VJW A;  5LJ3 Y;  2V34 A;  2BSQ E;  1TEL A;  5EX3 A;  3KK1 B;  2LXU A;  3LAM A;  1K0T A;  1HQU A;  5A0Y B;  1FDB A;  2XY7 A;  2OI2 A;  4TKT A;  3ET6 B;  5L1L A;  4F0H A;  1C1B B;  1U1M A;  3THV A;  3DMJ B;  3D5M A;  1U26 A;  2M88 A;  2CVE A;  4FF2 A;  3GQC A;  1MML A;  2AQ4 A;  1YRT A;  9ATC B;  1KOO A;  2YKQ A;  1R8H A;  5A8W B;  2W4P A;  2RRA A;  1NU4 A;  5KFO A;  2C2M B;  1QUV A;  2C1E B;  1WTB A;  1HBU A;  2LP4 A;  1RSC A;  3OSN A;  3LP2 A;  2MPU A;  3W5Y A;  3TVK A;  4MIA A;  4M8L A;  1X31 C;  3CJ8 A;  1C0U A;  4K2J A;  2KI2 A;  2X51 A;  1R8P A;  1T7P A;  3MED A;  1DJ0 A;  5A2Q Y;  2JWN A;  3ZZT A;  2E5H A;  1LFP A;  1V3R A;  3OTO J;  1RTD A;  3TAM A;  2AIR B;  1OJ4 A;  2DNZ A;  1IM6 A;  5EWG A;  2ERR A;  4OX6 A;  4OZ5 A;  1HWJ A;  5FD1 A;  3E01 A;  2M52 A;  1S0V A;  2YKM A;  3JQK A;  3PXG a;  2IM0 A;  4U7U K;  2KOE A;  5CYM A;  4LRB A;  4Q45 A;  2DGX A;  2DXD A;  3NKY A;  1M5O C;  3K5M A;  4C2M A;  2IYI A;  3N79 A;  2DNH A;  2R7S A;  4RW4 A;  1T03 B;  5I3U A;  2W4C A;  4CIO A;  1MN7 A;  2XM3 A;  3QOQ A;  2FLP A;  1B99 A;  3LGN A;  1Z2Z A;  2PEH A;  3R8Y A;  1Q16 A;  5B0D A;  5DDR C;  4ECR A;  3O1L A;  1H6K X;  1LW2 B;  3D6T B;  1KD1 T;  4XO0 A;  2ROG A;  3TQ1 A;  3THP A;  3RB6 A;  4LF6 F;  1HBO B;  4KKO B;  3JYT B;  2J0W A;  4JI4 J;  1IQT A;  4G1Q B;  2GAH C;  3HHL B;  3PEH A;  2V68 A;  2XY6 A;  3C6U A;  3WHI A;  2DNK A;  3IR6 B;  1TV6 A;  2CPI A;  1WF1 A;  2L9D A;  5D0E A;  4KGX B;  2YNF A;  2BVZ A;  2FVS A;  3UO0 A;  3TWZ A;  3C19 A;  1T11 A;  4OZL A;  1DQ9 A;  1NJX A;  2ZWP A;  3OXF A;  1TL5 A;  1R3N A;  2VC0 A;  1XIQ A;  3NWG A;  5I42 A;  1PSD A;  1EHW A;  4ZJL A;  5GAE I;  4BCA A;  4BBY A;  4GKK J;  3T9N A;  1LWC A;  5HBM B;  1EQM A;  2QL5 B;  2YH1 A;  2LQ5 A;  5GAD U;  4ECS A;  1QAY A;  2J5A A;  5KFZ A;  4USH A;  3SMZ A;  3NS5 A;  4DL3 A;  1NEE A;  1UPM B;  2W25 A;  1Z2L A;  1FWK A;  3PCO B;  4JYA J;  2ZZT A;  3IR7 A;  1RTZ A;  2P6S A;  4F3M A;  1TL3 B;  4PXD A;  1EB0 A;  2MZS A;  2KN4 A;  2KVI A;  5IM0 B;  4WII A;  4PAA A;  3UE2 A;  3GYG A;  4MK8 A;  4JI3 F;  2PO4 A;  1F0X A;  3I5B A;  2CG8 A;  1U6B A;  4DU8 A;  3ZO7 A;  3PJW A;  1EA4 A;  1WOO A;  3PYE A;  5J2Q B;  2VPW B;  3DRR B;  5KFF A;  4DX6 A;  4B3M F;  3R5J B;  1MLA A;  3B82 A;  4RUH A;  5IT9 Y;  1TUG B;  5IOL A;  4UQG A;  1ZM3 A;  2ZBR A;  3EJM A;  4JP8 A;  4DL5 A;  4U7C A;  4EO8 A;  1FRH A;  2ACY A;  3MWB A;  4J9P A;  3NCR A;  2ATC B;  2XC9 A;  2HVZ A;  1GAO A;  5JJB A;  3BSA A;  1F3V A;  1UAW A;  4OZ1 A;  2ZUA A;  4I4B A;  3KYL A;  4DR5 F;  2LMI A;  2XZD B;  4YDD B;  3QRQ A;  3KUE A;  4WU2 A;  4YHH F;  4FXV A;  1YSJ A;  3P4U B;  4ZVP B;  4MIW A;  1HHT P;  2G2Z A;  4PKD B;  4DLE A;  5K14 B;  2CNL B;  1SQE A;  3BR9 A;  2EFO A;  1HYS B;  5D8H B;  1SJR A;  2ZNZ A;  4F7V A;  2B3T B;  3GJT B;  1ITP A;  1T8E A;  3KG0 A;  3CDU A;  3RRK A;  1YIT S;  2ZH3 A;  3P45 B;  1BQM B;  3D1O A;  2Y1I A;  2B7C B;  1FD8 A;  2WBM A;  3HMJ G;  1YK9 A;  3BSC A;  4ED3 A;  1QAX A;  4PRF A;  2HK2 A;  2J7K A;  2MZT A;  2GS8 A;  3H2L A;  3OTD A;  2KT2 A;  4HTI A;  1Q82 T;  3DLG B;  1HBM A;  3WDO A;  2CJY B;  2UXB F;  1IBM J;  2FDN A;  4N76 A;  5BYR A;  5LSR A;  2MQL A;  2IM3 A;  1TL1 B;  4NYO A;  4N5S A;  3BGU A;  4LRV A;  3A3N B;  1U45 A;  2HHT A;  3Q8V A;  3LAL A;  1YWX A;  1FKO B;  4M95 A;  5CCL A;  2Z0G A;  3MHY A;  3KJV A;  1U1O A;  1WAC A;  3QJL A;  4RNM A;  4RW8 A;  1RT7 A;  3FJ2 A;  1RWX B;  2I5J B;  3LWM A;  4RUB A;  1G3O A;  1MWZ A;  5DJB A;  2VL1 A;  1M1G A;  3OL8 A;  3KHL A;  2K29 A;  3I9V 9;  1NSP A;  5DLF A;  1KP6 A;  2HAI A;  1OWX A;  2O66 A;  3M6V A;  1C1C A;  2IMO A;  1FDA A;  4CO4 A;  2HZC A;  1EP4 A;  1SH3 A;  2DH9 A;  4NEY A;  1YBT A;  5ETO A;  4MK7 A;  3TAP A;  4QJV A;  4CLZ A;  5ETT A;  4DSE A;  2BOA A;  2E1P A;  3W66 A;  1KLN A;  5F8G A;  2X1G A;  4K59 A;  1TZ0 A;  3T5H A;  2KEL A;  2BR0 A;  4K4Y A;  2GV1 A;  3UPF A;  3HJV A;  4PPZ A;  4DPT A;  4PWD A;  4JI2 J;  2YNH B;  3BZQ A;  1KS2 A;  4HI2 A;  2YNG A;  3BQ2 A;  1VYA A;  2VG6 A;  1T02 A;  4CLU A;  5HSP A;  4K2X A;  4NLW A;  2O1P A;  4CH0 S;  4OYM A;  5JMN A;  4LRE A;  4ID5 B;  5LM7 E;  3JXO A;  2ZH5 A;  4JI0 J;  2RVJ A;  1KSP A;  4KO0 A;  3QT5 A;  3BGF A;  2GO9 A;  3Q23 A;  3HHK A;  5L9X A;  1OO0 B;  4DN9 A;  1VFJ A;  2XLK A;  1CJK B;  1WNE A;  5HMW A;  1IKY A;  5U47 A;  3CDB A;  2NXC A;  1GXL A;  1KEK A;  3CME S;  1VDH A;  2B51 A;  3G96 A;  4PQA A;  5H9F J;  4V19 X;  1UFW A;  2P9E A;  3DRY A;  3N28 A;  2CKW A;  3UN2 A;  4DL6 A;  1CJT A;  2X3G A;  3O6Q A;  4NEZ A;  4M5J A;  1RT2 A;  3OHB A;  1UTA A;  3AJD A;  3LP0 B;  3IO1 A;  4KGK A;  2N82 B;  3CJQ A;  1S1W A;  4C8O A;  4RLE A;  2CRL A;  4B17 A;  2DNP A;  2R8I A;  4P2M A;  3NGT A;  1AZS B;  1ZYQ A;  4O4G B;  1LW0 A;  1VGY A;  4ZN1 A;  2MEW A;  1HNW F;  3P96 A;  2DPI A;  1XNR F;  4DL0 C;  2HRY A;  1P27 B;  1U0H B;  3FRY A;  2HQ3 A;  4I2Q A;  1VLY A;  4ZP9 A;  1WJ9 A;  3BKF A;  4K4T A;  3DRS B;  3KJQ B;  4KV8 A;  2OPS A;  3AT1 B;  3RG6 A;  3GG1 A;  5C25 B;  2OHD A;  2GHW A;  4XK8 C;  4LFB J;  1S12 A;  5EWE A;  2ZVI A;  4L73 A;  3SFG A;  4RPF A;  1WD6 A;  3LF0 A;  3HKZ D;  2ZH6 A;  2MZR A;  4ZJQ A;  4JI5 J;  2GGP B;  2LEA A;  2R7O A;  1J27 A;  2IIH A;  2COL A;  4A8O A;  4KH1 B;  3K5L A;  4OV6 A;  1NKB A;  1HWK A;  4EK2 A;  2DHS A;  5A6P A;  1IQZ A;  4H4O B;  5DM7 Q;  3DLE B;  2F63 A;  5LXY A;  4KB7 A;  2IHR 1;  3L3C A;  2KXN B;  3FDS A;  7AT1 B;  3TA1 A;  3G6V A;  3V81 A;  3GLJ A;  4UY8 T;  2C42 A;  2PC6 A;  3DOL B;  5KG6 A;  3W1Y C;  3UVJ B;  1BE4 A;  2IVM A;  1V3Z A;  3M2R A;  1PBA A;  3T6J A;  4NCB A;  2W2P P;  1N54 B;  5L9N A;  1F5B A;  1MMD A;  3IN5 A;  2DBB A;  1I5O B;  1JLE B;  4JI6 J;  1CUL B;  4UST A;  5DZ6 A;  3GTY X;  2E7X A;  2LXF A;  2MJN A;  3DXS X;  1RYS A;  1PG5 B;  4IDK A;  3IRX A;  3BGO P;  4EBC A;  3ONQ A;  3QO9 B;  3L09 A;  3HT0 A;  4KBI A;  1HMV B;  3MDF A;  4IFV B;  4OX8 A;  4NZ0 A;  5ETR A;  3H40 A;  2JC0 A;  2YTC A;  3HHL C;  2IBO A;  3DOM B;  3MUV P;  4M5G A;  1SJQ A;  3EUN A;  2NYH A;  4X84 A;  5D4O A;  3C6T B;  2FZC B;  3AAW B;  1D9A A;  2EKN A;  2G13 A;  3IM8 A;  3KK2 A;  5B0F A;  2RDI A;  5IWA F;  3B78 A;  3BV8 A;  4KSE B;  1FKP B;  3Q8S B;  4ECX A;  2B7B B;  3IAS 9;  3JSM A;  2MYF A;  1IM4 A;  2K1R A;  3RBZ A;  1OPI A;  2DGS A;  4BC7 A;  5J2P A;  4X66 J;  2PE8 A;  3KLF B;  3TI0 A;  4K7Q A;  2QEX S;  3PO5 A;  1PYS B;  2AV5 A;  4YR2 A;  1JLB B;  1PIE A;  3OVS A;  3R5B A;  4W90 B;  3GPA A;  5B09 A;  2XYG B;  4HT7 A;  5KG4 A;  2XCP A;  1FT8 A;  4MMO A;  5HI7 A;  2XCA A;  1UW9 A;  4B3T F;  1ZM4 A;  2BEF A;  2JDJ A;  3J81 j;  4DV4 J;  5F9N A;  4DS4 A;  4RBT A;  4WKY A;  3AOD A;  1Y3J A;  3GXQ A;  4FF3 A;  3H5Y A;  2AJ0 A;  1D8Y A;  3M8P A;  3E2E A;  4I2P B;  1ARR A;  3ZZO A;  1NHV A;  5G0R A;  1CJV B;  1I3O B;  3W63 A;  5B08 A;  4K0K F;  3C14 A;  4KGZ B;  3IWN C;  2XYH B;  1WC6 A;  4TLR A;  2I6W A;  3QFW A;  3VGV A;  3HHD A;  4CLS A;  3QQC D;  2ZEJ A;  3N9U C;  4ES1 A;  1S1T B;  3QWP A;  4KRW A;  3CJ0 A;  3E51 A;  2V8V A;  1UEU A;  3H20 A;  2VV5 A;  2CZ9 A;  1IVZ A;  5T7L A;  5K8P A;  1Q7L B;  1UPP A;  1WHV A;  2R2S A;  1MU2 B;  2UUB F;  1KN6 A;  3J7A 1;  3MAH A;  2KB2 A;  2Z4P A;  4U95 A;  2R7W A;  5KG5 A;  1GXT A;  1U47 A;  4OHY A;  4GMK A;  3TZY A;  1X5O A;  5T41 A;  1X9M A;  3C15 B;  1R7I A;  2MLX A;  3WZ0 A;  4Y3C A;  1MMN A;  2K06 A;  2YWW A;  5B0C A;  1NB7 A;  2F8E X;  2BDP A;  3CCV S;  2RIJ A;  4RW9 B;  1RT1 B;  1UFK A;  3X1L B;  4R8U B;  2ZUG A;  4HVZ A;  1Q53 A;  2J6T A;  2OGU A;  2V4J B;  1RTI A;  1APS A;  2P2C B;  2NSC A;  4NCG A;  5KG0 A;  1VRQ C;  2MQQ A;  1T3O A;  3N6L A;  1J5O B;  1SKS A;  1H74 A;  2XZT B;  2K6L A;  2QA4 G;  1RWO B;  4RW6 A;  3GJQ B;  3K17 A;  2BYC A;  3G6E S;  5LSL A;  2P5V A;  1REG X;  4CLW A;  2KRB A;  2H54 B;  3O3L A;  3NNE A;  4J9S A;  3NY0 A;  3ZC4 A;  1TVR B;  3N01 A;  4CWB A;  3MD1 A;  1L3V A;  1WOS A;  4HAC B;  4FF1 A;  1N34 J;  1GTE A;  1I94 F;  4PUO A;  2HHH F;  1NHK L;  1TTH B;  1REV A;  2IDE A;  2RQC A;  1Q78 A;  2XLJ A;  1C4C A;  2WON B;  1R8C A;  1NPK A;  4ELV A;  3UCZ P;  1JXL A;  2XSJ B;  3Q86 A;  3UDV A;  1IJF B;  2FHK A;  3IBW A;  3NEK A;  1SL2 A;  2HS0 A;  5FLX Y;  4JUZ A;  3NBP A;  1RB0 A;  1Y5I B;  2VG5 A;  4Y28 C;  3PFO A;  5A8K A;  3CD7 A;  1S76 D;  3ETO A;  4WFN Q;  5CH7 B;  2WW4 A;  1FE4 A;  2A2C A;  1RIS A;  3KWM A;  5F0W A;  2WOM B;  2M7S A;  5I4M A;  4HT5 A;  2IC3 A;  5E7O B;  5D4L A;  4NLQ A;  2B4U A;  5ETQ A;  1ZA1 B;  1UVM A;  4O44 A;  4FP9 A;  2BRK A;  1S99 A;  2IFX A;  2QSW A;  3NMR A;  4OX7 A;  2BM0 A;  2VBY A;  4DSI A;  2CNO B;  5HRO B;  3CJT A;  1N33 F;  5HLF A;  1U49 A;  3UWT A;  4AFF A;  4F4Y A;  3RRG A;  3DDN A;  3N4W A;  4I56 A;  3EGZ A;  4DL2 A;  4C6A A;  1AUD A;  2AZ3 A;  3HX9 A;  3PHT A;  2OH2 A;  1Y00 A;  2VBW A;  2L9W A;  4IG3 B;  2ASJ A;  2MY8 A;  1MW7 A;  2I9S A;  4K4W A;  1G7C B;  2DNR A;  3CJR A;  2QA4 S;  3FGV A;  3MEE A;  5M2U A;  1X4D A;  2DY1 A;  3JSB A;  3O5T B;  2VG7 B;  2EFG A;  1W2I A;  1Q8B A;  5JUM A;  4ZVT B;  4CDI A;  3J7Y U;  2XMV A;  3B54 A;  4KHR A;  2F3J A;  2DY9 A;  2B9E A;  3CF5 Q;  1Q0N A;  2DYA A;  1JLQ A;  5AE1 A;  4WE1 A;  5GAD I;  2Z56 B;  1V6H A;  2EKY A;  4Q44 A;  1PYO B;  4MKB A;  2JVO A;  2J0S D;  1RWK B;  4CYU A;  1GMU A;  2XS7 A;  3VZI A;  3H5U A;  3W7B A;  3NGD A;  1X4G A;  3H5S A;  1DY3 A;  2L9N A;  2U1A A;  2MHN A;  5B0A A;  2ZHB A;  2RB7 A;  4Z37 A;  4C11 B;  3TVZ A;  1WUU A;  3VW4 A;  1KVI A;  3A12 A;  3IWX A;  2HS4 A;  4O4R A;  4LR8 A;  4C7Q A;  5L38 A;  3RBX A;  4DR7 J;  1WDD A;  3LH2 S;  4CO2 A;  2RS2 A;  4C8M A;  4ZKA A;  5D3G B;  4M5N A;  3OJU A;  1B4S A;  1GK8 A;  2XG8 A;  3I0R B;  3NS7 B;  3CCE S;  1RAA B;  2CJX B;  1H2T Z;  1EKR A;  2CQ0 A;  2BAC A;  1CJU A;  2EC0 A;  4OI4 A;  1QAJ A;  3NGK A;  1F2G A;  5HMY A;  1ZAX A;  3MM6 B;  3W5X A;  2BE2 B;  2HBR B;  4I6Y A;  2NXN A;  2B56 A;  2AEM A;  4V19 J;  2VH7 A;  4YB5 A;  1H7X A;  2W01 A;  5J1E B;  4KJI A;  1JJ2 R;  3LWL A;  4RW7 A;  2MMY A;  2ASY A;  1GMW A;  1GMW D;  3Q8U A;  2M8D B;  1RT4 A;  3R2C J;  4NLR A;  2CJK A;  4B9M A;  4PXC A;  1V3S A;  3I82 A;  2DEJ A;  2V4Q A;  3ITH B;  2AYM A;  3OL7 A;  1ZTW A;  1U1R A;  2HAF A;  2MST A;  2QLW A;  1BDV A;  1HD1 A;  3ZFV A;  2M9K A;  2AGP A;  4OI1 A;  2JXG A;  4DL7 A;  1RT6 B;  2GVD A;  5IQ6 A;  4WIQ A;  1TKX A;  4AE5 A;  2F8H A;  1FNX H;  5KFP A;  1B7F A;  2QLJ B;  3SSS A;  1U6F A;  2VB6 A;  1RWN B;  5DG7 A;  1OYD A;  4ZPW R;  3HVR A;  1DQ8 A;  2KZM A;  4F2S A;  1S6U A;  1VC6 A;  2BRL A;  2G0I A;  2BXJ A;  2KZZ A;  3M32 A;  1WG1 A;  4M5H A;  2FJW A;  4EGL A;  2A2D A;  2M3D A;  1DLO B;  3MCO A;  3SQG A;  2IVF B;  2HRT A;  4O3N A;  2FJB B;  3R1L A;  4QR1 A;  1KC8 T;  4Q5V A;  2XO7 A;  1HBU B;  4KE5 A;  2XHW A;  4QWD A;  1RK8 A;  2H4W B;  5B0G A;  3LP2 B;  2L48 A;  4NI2 B;  4WYW A;  4DR6 J;  1C0U B;  4MKV A;  3SDE A;  3VAJ A;  3D2W A;  3MED B;  3DYA B;  2C3U A;  4NLU A;  3IRW P;  1N4L A;  2CUY A;  2DH7 A;  1E6Y A;  2Q1L A;  2VBX A;  1RTD B;  3TAM B;  3W9J A;  4EO6 A;  3PYG A;  3AOC A;  4QZV B;  4LFA J;  3ZZZ A;  1QTM A;  4A8F A;  3MM5 B;  3T1Y F;  3D1Q A;  2VQF F;  4R0J A;  3M7V A;  4ZVF A;  3E01 B;  1R27 B;  4B3O B;  1X93 A;  4LF5 J;  3VCD A;  3PZP A;  2FLL A;  5HP1 A;  4LBI A;  3RZA A;  1YHQ S;  1N36 J;  1KVJ A;  2DGU A;  1CSJ A;  2H5J B;  1ARQ A;  4IO9 Q;  2APO A;  1T9Y A;  2HWH A;  3RBD A;  4KHP J;  2DJW A;  2RRB A;  4JOU A;  4ECY A;  1L3K A;  3VZH A;  4HLB A;  3MM8 A;  1X9W A;  2G0J A;  2VIC A;  3H8Y A;  3R5A A;  3QWU A;  3ADA C;  5BJR A;  3BO3 A;  2C2R A;  3MAA A;  2QX0 A;  1Q16 B;  2ZVS A;  5KT2 A;  3LAK A;  4MH8 A;  1VQ7 S;  3MR5 A;  3EGN A;  1UVL A;  3DDI A;  4GO5 X;  1SKU B;  3QT8 A;  3JTN A;  5AT1 B;  4QYR A;  2YQ1 A;  2CDQ A;  4OHV A;  1KTQ A;  4BLG A;  2XY5 A;  3FC9 A;  3KXD A;  2I2Y A;  2XMA A;  1YJR A;  1AYE A;  3EWG A;  2HEK A;  3SBM A;  3W8P A;  1LV5 A;  5KFV A;  2V9K A;  4U8Y A;  5CZX A;  3KLE A;  2ZJP Q;  3HSJ A;  2YNF B;  4ZN3 A;  1NKE A;  2QA1 A;  3DRP B;  3MM7 A;  5HAT A;  3BH6 B;  2FIU A;  5I42 B;  2KH9 A;  3TJA A;  3WQP A;  2BAN A;  1RAO A;  4Y2M A;  1WG5 A;  3K7R A;  3TAQ A;  5K9F A;  2MZQ A;  3FMW A;  1SV5 A;  1NME B;  3A13 A;  3D28 A;  1Y9O A;  4RR5 A;  5THW A;  5C7P A;  3BPD A;  4ZP7 A;  4F26 A;  2AU0 A;  4NX9 A;  4NLT A;  2CQI A;  1SL0 A;  4DQS A;  1FK9 A;  3V6J A;  2YWH A;  1R31 A;  2KYX A;  3CD5 A;  4ZS6 A;  1WTF A;  3MM9 A;  4B3R F;  3GON A;  3IR7 B;  1YVF A;  2R9L A;  4KYZ A;  3I4H X;  1J5E F;  4WU3 A;  4WFX A;  4QPT A;  1X0F A;  3KLG A;  2VFS A;  5CD4 A;  4NCA A;  4UT4 A;  1S6O A;  3MOJ B;  2WVB A;  2UV8 A;  1XEZ A;  1B0T A;  4GVB A;  5IZH A;  1N5T A;  3DHX A;  5D77 A;  4HEA 9;  3M8S A;  4ERD A;  1OQ3 A;  1EZZ B;  3V5R A;  1HL6 A;  1FA0 A;  4KGV B;  5ITH A;  4AND A;  2P8I A;  2XLI A;  4CT9 A;  4HHH A;  3PYD A;  1Q7Y T;  3P3D A;  3MEC A;  2ZE2 A;  1RTJ B;  1F1B B;  3U7J A;  2YKO A;  4ZVU B;  5IQQ A;  3GV7 B;  4W98 A;  3RB3 A;  4OJ3 A;  3NG8 A;  1NK7 A;  1XNQ F;  4I68 A;  4DX7 A;  1QE1 A;  2V8P A;  4LSN A;  1H98 A;  3ILI A;  1SB6 A;  5D0R A;  4P6Q A;  3R5D A;  3TUP A;  3PYF A;  1LWX A;  3T1A A;  2ROP A;  5GAG U;  2IDL A;  1RCX B;  1ZAW A;  3VHQ A;  2VPX B;  3RB4 A;  4L72 B;  2VDH A;  5ETS A;  3CD6 S;  3GIK A;  4IG0 B;  5DG9 A;  4WTO B;  3G8T A;  4PZV A;  3FFI A;  3OLA A;  2DGO A;  3G4S S;  1SQG A;  2XB2 D;  1GTH A;  1A9N B;  4HV0 A;  2ABY A;  2V2Q A;  2EI5 A;  4OYX A;  3IG1 B;  4ZP8 A;  1ZPW X;  2Z57 B;  1VQL S;  3QIP B;  3W61 A;  3IC1 A;  2YPZ A;  3G8S A;  4RWX A;  5AXK A;  3QGP A;  3L95 X;  3KTQ A;  1DTQ A;  2NPF A;  4N8N A;  4LF6 J;  5CXT A;  4F04 B;  1RCO B;  3X3U A;  1HBM B;  1JLA A;  1Q4R A;  4IFY B;  4QU6 A;  3IA0 A;  2MQN A;  1IKX B;  5JVH Q;  1F60 B;  4QYZ J;  3HZG A;  2V94 A;  2M4M A;  2VFU A;  4GRS A;  5KG2 A;  1P6T A;  4F8R A;  2HQF A;  4JV5 F;  1VQP S;  1BQN A;  2UUA F;  4FNH A;  2MQ8 A;  3KJV B;  2DNL A;  3ZZR A;  4X4O A;  2VHG A;  2OEL A;  3CJK B;  1RT7 B;  4FYV B;  3IS9 A;  1BUX A;  3CJS A;  3OXL A;  1TAQ A;  2PA8 D;  4YR3 A;  3UFC X;  1F3F A;  2N7C A;  5DET A;  1PBU A;  4A8Q A;  1NDL A;  1C1C B;  2NUU G;  4P2S A;  1TKT A;  4DEZ A;  4DV3 F;  2BX6 A;  3AJ2 A;  2AJ2 A;  4KPC A;  1URR A;  2XMT A;  5KFK A;  2ZKU A;  2W7A A;  3S1T A;  2DNO A;  1TL7 A;  4HH0 A;  4JI3 J;  4J9O A;  1B64 A;  1U0S A;  4WFY A;  3SV4 A;  3AD9 C;  2IM1 A;  3FBB A;  3A3P B;  2IY5 B;  2GJF A;  1X4F A;  4DUZ F;  3ICL A;  2YNG B;  3EGV A;  4ZPD A;  1RT3 B;  1H72 C;  2FVC A;  2ACM A;  3KNA A;  2DR8 A;  3FMB A;  2ILZ A;  4B3M J;  1YTY A;  2FLO A;  3KHG A;  1EIY B;  3NNH A;  2QG9 B;  1NSK L;  3H59 A;  2JLE A;  3PEJ A;  3IR5 B;  2XGQ A;  2ZM6 F;  5I3Q A;  4ECU A;  4V1A k;  4CRJ A;  3RUB L;  4P71 A;  3SXL A;  2MQM A;  1QTN B;  2OP5 A;  1RLC L;  3BB5 A;  2X1A A;  2ASL A;  2OAU A;  1CJT B;  4LIW A;  3CUN A;  3DGV A;  1Y11 A;  3CED A;  1EAY C;  2XI3 A;  4DR5 J;  1RT2 B;  3DI6 B;  3J80 U;  1GNK A;  4ZHR B;  1WF0 A;  4CH1 A;  2IMW P;  1BQX A;  5D15 A;  4YHH J;  5KG1 A;  4M5M A;  4YP3 A;  2DHH A;  3VAI A;  3IBC B;  3K0J A;  4B02 A;  4H4K C;  5DQG A;  4FF4 A;  1RTH B;  4QR0 A;  4UY8 5;  1M5S A;  2MKJ A;  4WPA A;  1YGY A;  1D0E A;  5KT5 A;  1IBC B;  2RQK A;  3QPI A;  2F9D A;  2XGP A;  5J1N A;  4OIX A;  1TK8 A;  8ATC B;  3FT7 A;  3FRZ A;  2ZH7 A;  2YQ3 A;  3I96 A;  5C24 A;  4FS1 A;  1XN9 A;  4I2Q B;  5L46 A;  2GA7 A;  2YQ0 A;  1LWF A;  4LR9 A;  5F0U A;  1S79 A;  4P52 A;  3HVA A;  1OG7 A;  2IA0 A;  1NSA A;  4AQY F;  3Q24 A;  1YBU A;  3UN5 A;  5EHH A;  3UDL A;  3T3F A;  3US5 A;  2UXB J;  5D4P A;  3Q83 A;  4OI6 A;  3OFG A;  1XMO F;  2NYI A;  3K89 A;  4ZDN A;  2PMW A;  4PYD A;  3A8I A;  4I7F A;  4DV1 F;  3KHR A;  4IOC Q;  4R5P A;  3Q0A A;  3MMB B;  2HUR A;  2QL7 B;  3K59 A;  3EDR B;  4MYU A;  4DSF A;  1S48 A;  1UP1 A;  2CQ2 A;  3HCX A;  3C66 A;  2HHP A;  3CMQ A;  4UW2 A;  1SIW A;  3VEB A;  2RH3 A;  5DQI A;  1FKA F;  1JJH A;  4ECT A;  3MXH P;  4CCH A;  3R9L A;  1B7Y B;  3GSD A;  3PKY A;  2HBY B;  4DUT A;  4RO0 A;  3MUR P;  2M8H A;  2XSF A;  3G82 A;  1KR4 A;  3M2R B;  3WX8 A;  2O5D A;  2QLX A;  3LGM A;  2CWX A;  2EVZ A;  1P1T A;  2FY8 A;  5KFQ A;  2OEK A;  3TP2 A;  3Q8Q B;  2BQU A;  3DU5 A;  4LSL B;  3KUG A;  1LNQ A;  3I32 A;  2C2Z B;  3ILJ A;  3OSP A;  1O6X A;  2NR0 A;  2FTR A;  1RBL A;  2XEX A;  1S59 A;  1Q1K A;  3HM9 A;  4J9L A;  5HQ8 A;  3D4J A;  4IDK B;  3IRX B;  3J81 Y;  4OJH A;  1XMB A;  3MCN A;  2VKZ G;  1YJW S;  4S0M A;  3WX4 A;  3A3O B;  3GG0 A;  2HFZ A;  3CCS S;  4NE9 C;  6FDR A;  1KKH A;  5EUH A;  2NLW A;  1S9E A;  1ZAV A;  3MF5 A;  4B9V A;  3NOC A;  1X5S A;  3EZ5 A;  5E3A A;  1PO6 A;  3EGW B;  2XO6 A;  2EK6 A;  2CJB A;  4C0O C;  5IV4 A;  3FBF A;  2DCL A;  3W62 A;  2FC8 A;  2HMI B;  3KK2 B;  5HVF A;  1YLX A;  4Z7C A;  4C0H A;  1K0V A;  4TY9 A;  3ENV A;  4ELT A;  4YB6 A;  3JSM B;  1UVK A;  3J7Z T;  2HRU A;  5KFL A;  3V6K A;  2K1R B;  3I5A A;  1YDL A;  4Q2L A;  4F25 A;  2J0Q D;  5J2P B;  4FVM A;  5A8W A;  4DS5 A;  2HVH A;  3KMQ A;  2K3I A;  2LKZ A;  4WFB Q;  1NK4 A;  4UF4 A;  3ILO A;  3RAM A;  1FX2 A;  3PVX A;  1XQI A;  2ROE A;  2QC3 A;  5KFG A;  4KC5 A;  3HLU A;  4DPW A;  2FVR A;  2FC9 A;  1HNW J;  5EDW A;  4XIU A;  4DZD A;  1LK5 A;  2QSF A;  4BDP A;  1SBR A;  2DD8 S;  1XNR J;  4EU0 A;  3W5Z A;  5AJ3 F;  2XMK A;  3MR6 A;  3HO1 A;  5E3Q A;  1RU1 A;  3CO9 A;  3QBC A;  4C3M A;  3QGI A;  1X4E A;  5L1I A;  3RW7 A;  3OTB A;  2PII A;  1CC7 A;  4M5D B;  1RKJ A;  5J2N A;  1U2R A;  3GIL A;  1YKW A;  1N0U A;  2E5L F;  3C46 A;  2AWZ A;  2N3O A;  1VJQ A;  2HLT A;  3OPK A;  1FJE B;  5F3Z A;  4DI6 A;  2W8L A;  5KFT A;  4DZ6 A;  2DIS A;  5DDP C;  2BJE A;  1MG7 A;  2UU9 F;  4KFB B;  4WTY A;  2E1C A;  2PI4 A;  2BA9 A;  4DJB A;  3EXC X;  4TU9 A;  4KH0 B;  3H5X A;  5HAO A;  5T7L B;  1NSQ A;  2PDA A;  5LXR A;  1S6P A;  3T5L A;  2ADB A;  2KU7 A;  1HBO A;  2FHM A;  4KKO A;  3JYT A;  2CPX A;  5KFH A;  2WVC A;  1DAX A;  3VGT A;  1Q5Y A;  2QO3 A;  1GX6 A;  3C16 A;  3BBF A;  4ZIT A;  3FSY A;  4DFP A;  2FVQ A;  1I51 B;  3HHL A;  3HHL D;  3R6L B;  2RSQ A;  3N6M A;  1LXN A;  1BY9 A;  1N5Y B;  4EZ6 A;  4I69 A;  1D9F A;  3IXQ A;  3RRH A;  3I56 S;  1HKA A;  2DO4 A;  3O2I A;  5HVG A;  4UOG A;  1VBX A;  2F9J A;  5MAO A;  5A8R A;  1YJU A;  1RAB B;  5H9E J;  4YB7 A;  1QM9 A;  3M8R A;  3G6X A;  3BKU A;  4U67 Q;  3OL6 A;  2ADC A;  1S1V A;  4WJB A;  1EKS A;  4NML A;  3M1V A;  5HBM A;  4X4V A;  2K8G A;  1WI6 A;  2Q6B A;  1WC5 A;  5D6G A;  4RW6 B;  2KJV A;  1DFD A;  3K5N A;  3GII A;  1UJ5 A;  2Z30 B;  1AB8 A;  2J0X A;  1TL3 A;  3MZI A;  3L4B C;  3FEY B;  2W2N P;  4LRC A;  4U9R A;  4DFJ A;  2K7K A;  4BS2 A;  2VOP A;  3H87 C;  1U09 A;  2G0C A;  1E6V B;  4IRK A;  4JI2 F;  1XK8 A;  2CQB A;  5KFI A;  1NUE A;  2BMB A;  2KXH A;  4MKA A;  5J2Q A;  2V50 A;  3DLL Q;  4PUO B;  2D74 B;  5DDO C;  2FJD B;  2QTW A;  3Q8P B;  1FEH A;  4ED2 A;  1K73 T;  4W4M A;  3NNA A;  4JI0 F;  5DGB A;  3G87 A;  3HDS A;  4RX6 A;  1L3T A;  4DSJ A;  3WC2 A;  2EG2 A;  2XNR A;  5BYS A;  2VQE F;  4AL6 A;  3VAG A;  4F67 A;  3MCS A;  2YKA A;  3Q2S C;  3F41 A;  3BDP A;  3FMT A;  5A8K B;  3G5O A;  5H1S V;  5F8L A;  2G4B A;  4C8N A;  4BC9 A;  4AL5 A;  4F4K A;  4WP8 A;  2V2K A;  3MCM A;  3GMG A;  4AAI A;  1OSD A;  2IC3 B;  1S57 A;  3LP1 B;  3NP5 A;  4OZJ A;  4ICL A;  2Y1J A;  4O44 B;  3PV8 A;  1GEH A;  4NPO A;  4Q7A A;  1G2E A;  3DN9 A;  5FDL A;  1U6Z A;  2Z2Y B;  2V69 A;  1Y5L B;  3PW5 A;  1YJT A;  3B8H A;  3BGR B;  3FSI A;  4K0K J;  4NLX A;  2HNY A;  3VQS A;  2K7J A;  4F4Z A;  1URN A;  5K14 A;  4F50 A;  2BJD A;  2HLU A;  3HT3 A;  5HLF B;  4PG6 A;  2FQQ B;  4NLV A;  3TZX A;  5HMX A;  2HND A;  3RYL A;  1UKU A;  1MYK A;  3DM2 A;  2XS2 A;  3ULH A;  1N5Q A;  3VAM A;  1CVJ A;  2VJV A;  1JWW A;  2PD1 A;  4FYD A;  3OHA A;  1J2V A;  1BQM A;  4HHU A;  4RL1 A;  4W92 B;  2ZH9 A;  3MEE B;  1NRK A;  4EYI B;  3V4I B;  2FHJ A;  2FHJ D;  1EQ0 A;  1KQF B;  2UUB J;  4LFB F;  1LK7 A;  1DBD A;  2XMW A;  3AQO A;  2IJF A;  2WTF A;  3D6M B;  2H3A A;  3GV8 B;  2AP6 A;  3RAX A;  3HHN B;  4AXI A;  1JLQ B;  3H90 A;  3K8V A;  2LQ8 A;  4JI5 F;  1CQN A;  4ZVH A;  2QYC A;  4CYU B;  1FKO A;  3RTV A;  1ZM2 A;  1OMS A;  4DSK A;  2DT9 A;  2DH8 A;  2I5J A;  3KLI B;  3L9Z A;  1R89 A;  1S1X A;  1VOM A;  2VFT A;  3SQO P;  2QYG A;  1NKC A;  1TAU A;  1FFW B;  4JI1 F;  3VVT A;  1Q5V A;  3LUY A;  2LDY A;  1RT5 A;  2MQP A;  1SQF A;  4C8L A;  5CQG A;  1HIY A;  2C2N A;  2JRS A;  3VAK A;  3BYR A;  1QSS A;  2UVR A;  3M2U B;  1F9F A;  1NND A;  3CXC R;  2N3L A;  1S49 A;  1ZZF A;  3PAC A;  3M8Q A;  1KFS A;  2DCU B;  4CLL A;  1WKJ A;  2AHO B;  3FBE A;  1M1H A;  2ZD1 A;  3QAE A;  2NSB A;  5KG3 A;  1CJU B;  1SJ1 A;  3HD2 A;  1X5T A;  4TLQ A;  5KFA A;  2C2O B;  2FJV A;  1VQ9 S;  4NXN J;  2VFR A;  3MR7 A;  4ETZ A;  3R5G A;  5ETN A;  2UVW A;  1LWE A;  5FJ4 A;  3TVY A;  1I94 J;  2HHH J;  3QJP A;  1U1L A;  3U02 A;  3ZZY A;  3PY8 A;  4PQU A;  4ID5 A;  2AMC B;  4OFZ A;  1FRM A;  2J9D E;  4EWT A;  1RAC B;  4RW7 B;  1RQ0 A;  5KFD A;  4C4W A;  1YQH A;  2GO8 A;  1IWA A;  1OQ6 A;  4DG1 B;  2J7U A;  1MN9 A;  1CJK A;  1RT4 B;  2QMU B;  5GAG I;  2XWX A;  3H98 A;  4OZ2 A;  3MPW A;  2VUG A;  2DRB A;  1W7W A;  1NH8 A;  4LJM A;  1FES A;  1YJN S;  1RAE B;  4HHJ A;  4TNO A;  4XDD A;  4OHX A;  2V8D A;  2WZ1 A;  3K57 A;  2D9O A;  2R7R A;  1UWA A;  1IJE B;  1KHW A;  4OMF G;  1HR0 F;  3GFH A;  2DPJ A;  1TKX B;  1FRJ A;  4LQ9 A;  2IBK A;  2Q79 A;  2LCW A;  4A47 A;  2RUS A;  4IOB A;  2GVZ A;  1JKH B;  5GAE U;  2WVD A;  3PHE A;  1F2H A;  4LF7 F;  4KTQ A;  3OUY B;  2A0F B;  4HDG A;  4NL5 A;  1JJC B;  4J91 A;  3GCX P;  4DR4 F;  2CQP A;  1AZS A;  4J90 A;  3BSO A;  3BS9 A;  5FII A;  1NH7 A;  4AUK A;  4DR2 J;  3CCM S;  5CAA A;  3UD4 P;  4LMZ A;  4DR1 F;  1N33 J;  1QTG A;  1DQA A;  1L5U A;  2OFG X;  3QZ8 A;  1R8A A;  4J9K A;  4M94 A;  2CQH A;  2ZBQ A;  3I0S A;  4NYZ A;  1IKW A;  2VF3 A;  2BW2 A;  2F4V F;  2JVR A;  2AGO A;  2VAS A;  5A2Q U;  3DRS A;  3CVK A;  5IT0 A;  4PXB A;  2CAX A;  1H73 A;  2AY0 A;  5F3T A;  1X9S A;  2HGN A;  4YFU A;  4USM A;  1DHM A;  3JS9 A;  1ZET A;  2GW8 A;  4J9R A;  1PAU B;  1IN0 A;  4L74 A;  4FKX A;  1FRX A;  3AXK A;  3GB0 A;  4NWB A;  2HBQ B;  4CLT A;  1NZ8 A;  3RR8 A;  5HP1 B;  1R0A B;  2V8H A;  4B9T A;  4TU7 A;  4MAK A;  3FVY A;  1XTZ A;  3NAH A;  3O44 A;  3FUY A;  1T94 A;  2HQI A;  1HPZ A;  2NZC A;  5IC4 B;  1NHU A;  3CE8 A;  3ZNU A;  1IR2 A;  4J7C A;  1NAQ A;  4K4X A;  3MM8 B;  3V6H A;  3HI9 A;  2AJQ A;  2JL9 A;  2HVD A;  4AT1 B;  4HL9 A;  3B4M A;  1S9G B;  5LMU F;  3CCR S;  3MAA B;  4NLY A;  1W26 A;  3M6W A;  3DOL A;  4N8O A;  1FXD A;  3VQT A;  2GJI A;  2D41 A;  4ZP6 A;  1NJZ A;  2JJ4 D;  3W2V A;  2Y9H A;  3QRP A;  4NRT A;  1PKU A;  4K5S A;  4ED4 A;  3OFE A;  4DQR A;  2CPJ A;  3K2Y A;  3AD8 C;  1XR7 A;  3AB2 B;  2XBP A;  4ID8 A;  4NLS A;  3JQM A;  3TO8 A;  1MRO A;  2DB1 A;  4ZA1 A;  3AH6 A;  3P8B B;  4Y6I A;  2C3Y A;  3OTC A;  3N0V A;  3BSN A;  4RKU C;  2AD9 A;  3TZW A;  1VQ4 S;  3KLE B;  4LF1 A;  3JAM Y;  1IBK J;  3W9H A;  3OLB A;  4QR2 A;  1NBE B;  1VIO A;  2DR5 A;  2XMU A;  3M6U A;  3QO9 A;  3MM7 B;  1HMV A;  4IFV A;  1HAR A;  1VQ8 S;  3I31 A;  3U27 A;  3DOM A;  4P2X A;  4DDF A;  2VA3 A;  1RGV A;  2W9B B;  3C6T A;  3LAN A;  4G1P A;  1GQE A;  2KJW A;  3PX6 A;  2JNJ A;  3BF4 A;  1JNZ B;  5ETP A;  4IH7 A;  4DR3 F;  3T5K A;  1RAJ A;  1FKP A;  5BYQ A;  5D4N A;  2J9D A;  1XR5 A;  1G4C A;  3R97 A;  1F5A A;  2B5J A;  4G1I A;  4AL7 A;  1SJ4 P;  2CJ9 A;  4PEO A;  2QRR A;  2RUG A;  1N34 F;  2ZNY A;  2AGQ A;  4OJ1 A;  2DK2 A;  1TFW A;  2GCF A;  2ZBC A;  2HHV A;  3KLF A;  2NQP A;  3DLJ A;  3KLG B;  3ZTS A;  1F6T A;  2LVW A;  2PMZ D;  3H0P A;  1JLB A;  3KFW X;  1NPP A;  2OEJ A;  4GVB B;  4G6V B;  5E41 A;  1V5V A;  3QID A;  3CNQ P;  5C2C A;  5CD4 H;  5AXL A;  2M5Y A;  2A18 A;  2HFN A;  5F8J A;  2CAD A;  3BQ0 A;  5IT9 U;  4DV6 F;  4DUY F;  1X8D A;  2CPG A;  3OBI A;  2B6A B;  2G1D A;  4OZ0 A;  2MSS A;  3PIO Q;  1VR6 A;  5HL7 Q;  1XBW A;  2Q66 A;  4DCO B;  1JQG A;  4LFC F;  1HNV A;  5DRK A;  4ED6 A;  2OPQ A;  3UW1 A;  2WAQ D;  4DPY A;  4I2P A;  2BJ1 A;  1ZH5 A;  5E33 A;  1CJV A;  4LSN B;  3SIP B;  4CO5 A;  1DRZ A;  4YQW A;  1HQE B;  3J7A N;  2MHE A;  2JEF A;  4UTG A;  3T1Y J;  2MZJ A;  2VQF J;  3W65 A;  3OJS A;  2HWI A;  4ZLL A;  2QA2 A;  2FPH X;  2RKI A;  3AXM A;  1NLA A;  1S1T A;  5DG8 A;  1VRU B;  3H25 A;  3PG9 A;  1K1S A;  4OJG A;  1TKZ A;  1S10 A;  3NGS A;  4X65 J;  1CC8 A;  1BMQ B;  2EFQ A;  3HFZ B;  3GFZ A;  4WZM A;  4DV2 J;  4ZPT R;  3M8Z A;  1U02 A;  2KXF A;  1FJG F;  1HWU A;  3LQV A;  1TUV A;  4GKJ F;  2W7P A;  2GZO A;  3TX0 A;  2A6O A;  1JK9 B;  1KRP A;  2GQC A;  4DQQ A;  1HNI A;  3ZZP A;  5SZT A;  3C15 A;  5HMZ A;  3MAQ A;  1UWB A;  2QT7 A;  1RBA A;  3MMA A;  3NOG A;  4CM2 A;  4RW9 A;  3ILL A;  4E8U A;  5GMD A;  1D8Z A;  3ZXW A;  3S8S A;  4QW9 A;  3ISN C;  4R8U A;  3DRX A;  1UVN A;  4BWM A;  2OML A;  1UFL A;  2IAJ A;  3JQJ A;  1RWW B;  3OTE A;  1BQN B;  1S6Q B;  2I0X A;  3H4B A;  3TW0 A;  4OYO A;  4NLG A;  5CYJ A;  3IS9 B;  2H65 B;  1NDP A;  1ARO P;  3BH7 B;  4A8M P;  4YME A;  2HNZ A;  4ZCI A;  2JOQ A;  2B8P A;  1TVR A;  5JXS A;  1MYL A;  1UA0 A;  1RHM B;  5LOQ A;  4DWI A;  2DRD A;  1WHW A;  2IVY A;  3FCH A;  3GJR B;  3P5B P;  1VQM S;  2KFY A;  1NPR A;  2F8M A;  3OVA A;  4OYB A;  3HFK A;  1QVG R;  1J5E J;  2J9E A;  4QU7 A;  2DEI A;  4IR1 A;  4QWC A;  2N4C A;  4DPU A;  2WON A;  3HVT A;  1UL3 A;  3TEG A;  4DV5 F;  1SXL A;  5GAH U;  3I6P A;  3GR1 A;  1XJW B;  2I1R A;  2JX2 A;  2VON A;  4LF8 J;  1EET B;  1YRX A;  3ZZU A;  2A10 A;  3FCW A;  2UXC F;  2IJR A;  2O67 A;  4QBU A;  2GJ2 A;  1GFW B;  5EGY A;  4LIR A;  2WOM A;  4XTT A;  4F0K A;  4CO0 A;  2G2Y A;  3S6E A;  1VBZ A;  3NCP A;  2VZ9 A;  5DM6 Q;  2YWE A;  3VAF A;  2M0G B;  5A6W A;  3Q89 A;  2E1M C;  2G9O A;  1XNQ J;  4CLK A;  2GC8 A;  4ZVG A;  3GIJ A;  3CJ2 A;  1U1P A;  4ZLN A;  4O3Q A;  4FYY B;  5HRO A;  4K4V A;  2VPY B;  5IT4 A;  1FVQ A;  2QZ8 A;  3LTO A;  4JB8 B;  5MLC V;  1ZBT A;  4IG3 A;  2G2O A;  3GIM A;  4F2R A;  3AA9 A;  3CT9 A;  4FXD A;  1AUS L;  3C8Y A;  1VQ5 S;  3MR2 A;  1N6Q B;  4CP5 A;  3CCZ A;  2R3V A;  2EK1 A;  2AX0 A;  4F4A A;  4WYL A;  4FXW A;  2LFV A;  2H1Y A;  2DGV A;  2AN7 A;  4LFA F;  4OX9 F;  5C24 B;  5AE3 A;  4A8S A;  1LWF B;  1S7H A;  2O01 C;  3G9C A;  2FLN A;  1QY7 A;  1PAR A;  3W9I A;  3I5C A;  1HD0 A;  1WC0 A;  2ZDP A;  4ECZ A;  3OQ2 A;  2OPR A;  1LFW A;  1UCN A;  4YN3 B;  2QLB B;  2GX8 A;  4JV5 J;  4I7F B;  3PNI A;  2UUA J;  1U1N A;  4LF9 F;  4ME7 E;  2H5I B;  4K50 A;  3TEH B;  3EPI A;  4O3P A;  4TU8 A;  2D3Z A;  1FEE A;  2DNM A;  5D3G A;  3NGR A;  1SIW B;  4TN2 A;  3DGP B;  5DO2 A;  3CDE A;  1C2P A;  1WHX A;  4H4M A;  4DSL A;  4B3S J;  4PG5 A;  3DOK B;  4CLY A;  1C0T A;  5SUH A;  3KOA A;  3J7Z 5;  1VBY A;  3EMT A;  1ZPV A;  3RJM B;  3G82 B;  4DV3 J;  2DNN A;  1LXJ A;  1HA1 A;  1S7I A;  3MM6 A;  2LDI A;  2ZC4 A;  2BE2 A;  3EZU A;  1AA1 B;  4OI0 A;  2WSE C;  1ROF A;  4AYB D;  2QFJ A;  2YXL A;  5J1E A;  5HQM A;  3GCW P;  3H2U B;  3PRV A;  2J76 E;  4ZLP A;  5M2P A;  1M5P C;  1M90 T;  2RIL A;  2ZDO A;  4J37 A;  5K5M A;  5J2M B;  3GYX B;  4PAB A;  2RQM A;  3I55 S;  2V9W A;  2W9C A;  2V5H G;  4ER8 A;  2DIT A;  1WOR A;  3EPG A;  3C3L A;  1PC5 A;  2HIY A;  3CCJ S;  1LKZ A;  3CW2 C;  2OLW A;  1VS3 A;  1U2F A;  2GNK A;  4H4K A;  1S9E B;  2NXE A;  2RQ4 A;  4URQ U;  1FTR A;  1DTT B;  2ZM6 J;  1RWV B;  1FWL A;  5ETM A;  3BDE A;  3PW7 A;  4LVN P;  3KUH A;  4I6W A;  3MOZ A;  1QAI A;  2OPP B;  2YX7 A;  3TAR A;  1O51 A;  4CZC A;  1UA1 A;  4DU7 A;  1DLO A;  3UDC A;  2QMW A;  1G1X A;  4TQR A;  2LEB A;  2CA9 A;  4MTP A;  2IJN A;  3DCA A;  1SJ3 P;  5LMN J;  4OYA A;  4P73 A;  2JBV A;  5KFY A;  4DV0 J;  2HHQ A;  1ELO A;  4D3G A;  1TMM A;  2IA6 A;  2E66 A;  1TQL A;  5KOW A;  4ETX A;  2VA2 A;  4NI2 A;  4J9V A;  2RF2 A;  2UUT A;  3RGI A;  3DYA A;  1RAD B;  4G65 A;  4UZC A;  5GVQ A;  1Q8K A;  2QLF B;  1U8W A;  3FNN A;  5DZ7 A;  1IBL J;  1V9O A;  2J6U A;  5RUB A;  5KOX A;  3S7R A;  4WBF A;  1S1U B;  1KFD A;  2W7O A;  4ZCK A;  1XMQ F;  3MM5 A;  2OO4 A;  3TUJ C;  2ZH2 A;  1VLO A;  4NA3 A;  1B28 A;  3LGH A;  2M70 A;  4B3O A;  1PGZ A;  3N5B A;  3FZ2 A;  3ZZ0 A;  2J9C A;  4AQY J;  2EXU A;  2YKP A;  2BKO A;  5J2N B;  4EMD A;  3BQ1 A;  2P6T A;  4LSZ B;  3NO7 A;  3F0N A;  4I6A A;  6AT1 B;  3QRR A;  2R7U A;  3ELH A;  3Q22 A;  2D7S A;  1P94 A;  2N7Y A;  1XMO J;  4UUX A;  4DV1 J;  1N32 F;  2Q3P A;  4LBH A;  1QJH A;  1NB2 A;  3QZ7 A;  1FF2 A;  1U25 A;  2UUW A;  4KIA A;  2ASD A;  3MI7 X;  1YJ9 S;  3UR3 C;  2QJ3 A;  3SZ2 A;  1KLM B;  3CJ4 A;  1S6P B;  4ANE A;  4RWW A;  1H3D A;  4CNZ A;  4PXE A;  3C16 B;  4O0I A;  2B43 A;  2DKO B;  1QLN A;  2OD4 A;  4C8Z A;  2RS8 A;  4R25 A;  1F5C A;  2C3O A;  2EFN A;  3L7P A;  1YJV A;  3R3T A;  1SUQ A;  1VC5 A;  3CCW A;  4YY3 F;  2HKE A;  4MFB A;  1HLW A;  5CYQ A;  2HQD A;  4JI7 F;  5IXU A;  3DRP A;  5I3P A;  3BRE A;  5A8R B;  4LUB A;  5KFJ A;  2IRY A;  4X4S A;  4USK A;  5ETK A;  1RBO B;  4JBC A;  2J8S A;  4NZ7 A;  2JFK A;  1S1V B;  5HO4 A;  4C8Y A;  1PAE X;  5AE2 A;  3M1V B;  4LF4 J;  2ZBP A;  2QGF B;  4TQS A;  4ZJO A;  4X2B A;  4TY8 A;  4Q0B B;  3TOQ A;  1HW8 A;  2UXD F;  2K5J A;  3WC0 A;  1M0S A;  5E3P A;  2OD6 A;  3D3C J;  4QIF A;  2N4D A;  4ZCM A;  2A2B A;  2BM1 A;  1B0P A;  4O3O A;  5KFB A;  3MEG B;  1ZS6 A;  3T9Z A;  1B0V A;  3KJN B;  4FDF A;  3FQL A;  3M9O B;  4DCP B;  4C3L A;  1FD2 A;  2JEI A;  4X64 J;  3TX8 A;  1U48 A;  2ZJR Q;  2AJ1 A;  1XWL A;  3M30 B;  1B01 A;  4Y2K A;  5FLX U;  3D6F B;  3GR0 A;  2LEC A;  3V2U C;  5K8N A;  1RTJ A;  2LXI A;  4JI8 F;  5KFU A;  2CJA A;  4JV2 A;  4NA2 A;  5E2Q A;  1S72 S;  4A8X A;  5IS2 A;  1XC9 A;  5AXN A;  2D3O 1;  3VGS A;  4NOH A;  1UJ6 A;  2JC1 A;  2H51 B;  3G8Q A;  5H9F K;  1FFS B;  2GFF A;  5C42 A;  2KT3 A;  4KPY A;  5LL6 d;  4M63 A;  3NAI A;  3R27 A;  5AJ3 J;  1HBN A;  1IWG A;  1JLC A;  3KG4 A;  1R6Y A;  4ICL B;  4X4R A;  5BR8 J;  1HHQ A;  3Q2T C;  3R6G B;  2DNG A;  3HZE A;  3W2W B;  1A7G E;  2B0G A;  2BE7 D;  5FDL B;  4ITS A;  2V67 A;  1V5I B;  4ZVR B;  4NLO A;  1Q95 G;  2HNY B;  4CLF A;  2FYX A;  2E5L J;  4IG0 A;  3KLH B;  1YBA A;  4B9U A;  3MR3 A;  1NM2 A;  4P74 A;  1D1U A;  5EX0 A;  4YOE A;  4UZB A;  4K4Z A;  2HND B;  4KAI A;  5KFN A;  2EBG A;  1HQU B;  3DM2 B;  4USI A;  3IG1 A;  5BXI A;  3OR1 A;  2UU9 J;  4IRC A;  3QIP A;  4OYI A;  4UOC A;  3W64 A;  2EPI A;  3T19 A;  3EXY A;  4YS2 A;  2W1B A;  2ZKT A;  2R7Q A;  4F4X A;  4OI2 A;  4MK9 A;  1RAH B;  4IRD A;  2RML A;  2Q2K A;  2MLY A;  1OPZ A;  3EX7 B;  2HZA A;  3UDE A;  1CBK A;  3BN4 A;  1RWP B;  3DNC A;  4OV1 A;  3AB4 B;  2W2O P;  2YPY A;  4IFY A;  4IKA A;  2KKE A;  1IKX A;  3CSK A;  4ES2 A;  1HNZ J;  2DXF A;  1WEZ A;  1TL4 A;  2RE1 A;  4UOF A;  4LRD A;  2NZ4 A;  1OYE A;  6FD1 A;  3CO0 P;  4O3S A;  1T9V A;  4C0B A;  5F8I A;  1H2V Z;  1N56 A;  4X62 F;  3UR0 A;  2R7X A;  1OY6 A;  2BQ3 A;  1WSR A;  2HG4 A;  3CJK A;  4CH7 A;  1S1X B;  4Y34 A;  2XUL A;  4NXM J;  1NLK L;  1UET A;  2YNI A;  1QSY A;  4CT8 A;  1R0B G;  2UUC F;  3MMJ A;  3QGH A;  1RXO B;  4WCE Q;  1M1K T;  4KY3 A;  4NYP A;  5KG7 A;  1NK6 A;  1BLU A;  2YKM B;  1RT5 B;  3EYZ A;  5CYM B;  1PC4 A;  4PR6 A;  5B0B A;  4RBV A;  2HFV A;  3BN7 A;  4RW4 B;  3FKB A;  5I3U B;  2L3M A;  1N8R T;  2V2Z A;  3MGJ A;  1VRT A;  3RB0 A;  2HHX A;  3IFE A;  5IV3 A;  3KMS A;  3M8Q B;  4L3K A;  3Q8Y A;  4ZPB A;  4RZR A;  1JXE A;  2ZD1 B;  3PRD A;  2HHW A;  3UCG A;  2MJU A;  2H3E B;  3EZO A;  4QW8 A;  1Q81 T;  1WEY A;  4CTA A;  2XTJ P;  4FXE A;  2CDR B;  1LWE B;  1RT3 A;  3CIM A;  3JTP A;  4LBP A;  1KQS R;  1JLG A;  4DF4 A;  4PQU B;  4CNY A;  3NWR A;  2L08 A;  1YX2 A;  2J6S A;  2QFI A;  2AJF E;  5KT3 A;  2HFS A;  4OZ3 A;  2E5G A;  4XPE A;  4ED5 A;  3C6U B;  5A76 A;  2JHE A;  2VQE J;  1TV6 B;  1I1G A;  5K8M A;  3SFU A;  3CB4 A;  3D9B A;  1N48 A;  3QNW B;  2YBV A;  4O0N A;  4D8J A;  2DNY A;  3D0H E;  2VJU A;  3ZTR A;  2A1B A;  1MWQ A;  1HNX J;  1FDN A;  3DLB A;  2CNN B;  2POK A;  4F3Q A;  4L76 A;  3DFE A;  1X4B A;  2GVZ B;  1TU0 B;  4RNN A;  2MGZ A;  1TR0 A;  3DI6 A;  2HFO A;  1LWC B;  4ZHR A;  2ZHA A;  3KK3 A;  3HD1 A;  3H42 A;  3ZTO A;  2YKN A;  1D3W A;  4XDC A;  3MUM P;  1RTH A;  5CCM A;  5HJY A;  2GMH A;  2K9I A;  1QUP A;  3MTJ A;  1FWP A;  4YUD A;  3WIU A;  2OEM A;  3I0S B;  4C48 A;  1FNM A;  3EDQ B;  1IKW B;  4C9D A;  1HWL A;  1Y4Z B;  3FSX A;  4EYH B;  2DR6 A;  1UVI A;  4B9L A;  2PEB A;  3T1H F;  2D69 A;  1FE0 A;  4A8Y A;  3P49 B;  3VF0 B;  3SCJ E;  4Q8F A;  1R0C B;  4WP9 A;  2XNQ A;  3KKF A;  3KNG A;  3PDN A;  3CDA A;  2CAJ A;  1IRQ A;  2JLG A;  2HHU A;  2IPO B;  3IBF B;  4RNH A;  2KKH A;  1Z1Z A;  1FRI A;  1S0O A;  2UZA A;  4FYW B;  1WSV A;  3RU0 A;  4G3I A;  3UNY A;  2B9W A;  4KHM A;  4PWW A;  3MMB A;  2BKP A;  3R5C A;  3VAH A;  2RNE A;  1SC6 A;  1MNE A;  1HPZ B;  2MXY A;  2KM8 B;  2WB1 D;  5ETL A;  4Q2M A;  3PW2 A;  2WB4 A;  4QIW D;  1PIL A;  3GWC A;  4JI1 J;  3R7S B;  3MPY A;  4ILL A;  1VK8 A;  3FEX B;  5GAH I;  1T9W A;  1AT1 B;  4CM0 A;  1CS4 A;  2HHS A;  3W2V B;  1FDD A;  3E8O A;  3L7U A;  3LO3 A;  5DDQ C;  1K44 A;  5GME A;  1JLF A;  3MMC A;  2UVV A;  3CTR A;  4A48 A;  2HBZ B;  3CWJ A;  3W8G A;  1RWM B;  1MRO B;  1N0V C;  2GML A;  3BBB A;  1OSC A;  4LSL A;  5CHC B;  5KFW A;  3PTW A;  4RU9 A;  3NMA A;  2DR9 A;  2DGQ A;  2JXI A;  5HVH A;  3PKM A;  1H2U X;  4FS2 A;  2F40 A;  2EFV A;  4IQM A;  3LPE A;  4OHZ A;  1Q86 T;  2I38 A;  1Q8I A;  4Y2I A;  2C3P A;  3G2X A;  1QVF R;  3GU0 A;  1HWI A;  3VWS A;  2XWY A;  2NXU A;  4U7U D;  1RKI A;  1WWH A;  5KFM A;  3WIV A;  4RUC A;  3CIZ A;  2E1R A;  4RUA A;  2HMI A;  3U1M A;  4USW A;  4K5R A;  2B5J B;  2JEG A;  1HR0 J;  3JB9 k;  4WK3 A;  4RW8 B;  4ZLJ A;  4USU A;  2KHD A;  1U9P A;  2ATL A;  5M2R A;  1YI2 S;  2E7V A;  3DU6 A;  2KG0 A;  2F7V A;  4NLD A;  1HQ2 A;  4LF7 J;  4P7T A;  2BOP A;  2ZZN A;  3SI8 A;  3DC2 A;  2ZH1 A;  1M5V C;  2X7I A;  4J9M A;  3ISZ A;  3HKW A;  5E0O A;  2X3D A;  4DR4 J;  3UN3 A;  1S77 D;  1EP4 B;  2KFZ A;  4FPI A;  3MD3 A;  5IC6 B;  3M2V A;  3PO4 A;  2KHC A;  2K1O A;  3EIC A;  4DR1 J;  4NRU A;  4DV7 F;  4BWJ A;  2WVF A;  1TK5 A;  2P9C A;  3DLK A;  1XER A;  2F4F A;  4HKQ A;  1ZZN A;  4DX5 A;  2Q6C A;  2PFD A;  1Q8L A;  1ZTT A;  3QYY A;  3NGU A;  4PWD B;  2F4V J;  2X1F A;  4GO7 X;  1HNV B;  3PX4 A;  2MKC A;  2HS3 A;  2VG6 B;  2OPQ B;  1JIH A;  4USV A;  1RE1 B;  3NL0 A;  4LQ3 A;  2E9Z A;  3K8W A;  4FKY A;  2JFD A;  3HHE A;  4M5D A;  3CJ5 A;  4KO0 B;  1IKV A;  2IRX A;  3IP0 A;  2Z8Q A;  2YWG A;  2V8G A;  3HXM A;  1IKY B;  3OFH A;  2B9X A;  2A3J A;  2WVE A;  2RKI B;  3B6B A;  1DAR A;  2F1F A;  1BDT A;  5DQH A;  2XHC A;  3L7O A;  3N5F A;  4KFB A;  4NA1 A;  4WFZ A;  1TKZ B;  4ECW A;  2W2M P;  2FHO B;  2RAQ A;  1ZM9 A;  1O5J A;  1EAR A;  3FK4 A;  3U1L A;  2HWT A;  1IXK A;  2IM2 A;  4ED0 A;  3AOA A;  5LMU J;  4ELU A;  2AYB A;  2RBF A;  5LT5 A;  1S1W B;  1HNI B;  4A4J A;  4Y00 A;  4K4U A;  2BBE A;  4O3R A;  2HFU A;  1N5Y A;  7FD1 A;  3VR1 A;  1BAZ A;  4DHV A;  1L3S A;  1WC1 A;  1X7V A;  1UWB B;  3MMA B;  1LW0 B;  2Y1L B;  2C22 A;  2NUH A;  2MDA A;  2DGT A;  2U2F A;  2KDO A;  5DS7 A;  3OTO F;  2IRU A;  2XZW A;  2IAJ B;  1MNT A;  4DLG A;  2R42 A;  3POT A;  3GSI A;  1VC0 A;  2ZOM A;  3ENW A;  3ENA A;  4KV8 B;  2OPS B;  4MIB A; 
#chains in the Genus database with same CATH homology
 2WVD A;  2F1F A;  1BDT A;  3FMT A;  2NZC A;  3FT7 A;  4ME7 E;  4D8J A;  3QOQ A;  3BKT A;  3VW4 A;  2CAJ A;  1IRQ A;  1B28 A;  3LGH A;  2K1O A;  1BDV A;  2WVB A;  2BJ1 A;  2KEL A;  2JXI A;  2BJ8 A;  1B01 A;  2BNZ A;  2GPE A;  2JXG A;  1QTG A;  2WVF A;  3PHT A;  2BJ7 A;  3GXQ A;  2RBF A;  2Y3Y A;  4HV0 A;  2FGC A;  1ARR A;  1X93 A;  2PC6 A;  2WVC A;  1Q5Y A;  2BA3 A;  2HZA A;  3H87 C;  1NLA A;  2HZV A;  1BAZ A;  3VEA A;  1P94 A;  1ARQ A;  2CA9 A;  4FXE A;  2CAX A;  2AY0 A;  2K9I A;  2BJ9 A;  3QSI A;  1Q5V A;  3BKF A;  2H1O E;  1MYK A;  2K6L A;  1PAR A;  2K5J A;  2BNW A;  2BJ3 A;  3VEB A;  2K29 A;  1MYL A;  1MNT A;  1EA4 A;  2JXH A;  2CAD A;  2BSQ E;  1U9P A;  2WVE A;  3OD2 A;  2CPG A;  3BKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...