2WVEA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
131
Chain Sequence
SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWNPNDESKIAVLVVIYDHHQRELNQRMIDIFHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 31
structure length 131
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wveA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wveA02
4ME7E 2GPEA 2WVEA 1EA4A 3PHTA 2BJ9A 1PARA 2K1OA 2BSQE 1B28A 1P94A 2JXGA 1B01A 3VEAA 2PC6A 1X93A 2BJ7A 2F1FA 3QSIA 1IRQA 1BAZA 3LGHA 2K9IA 1NLAA 2BNZA 1MYKA 1U9PA 2JXIA 3BKFA 3VW4A 3BKUA 4HV0A 2WVFA 2K6LA 3H87C 2WVBA 2WVCA 2CPGA 2CA9A 1ARRA 2KELA 2HZVA 1QTGA 1Q5VA 2RBFA 2CAJA 3VEBA 3OD2A 1MNTA 3QOQA 2AY0A 3FMTA 4FXEA 2CADA 1Q5YA 3BKTA 2JXHA 2HZAA 3FT7A 2CAXA 2BJ1A 2BA3A 2BNWA 1ARQA 3GXQA 2H1OE 2Y3YA 4D8JA 2BJ3A 1BDVA 2NZCA 2WVDA 1BDTA 2K29A 2FGCA 2K5JA 2BJ8A 1MYLA
chains in the Genus database with same CATH superfamily
3FBEA 4CNYA 3FBBA 2RF2A 2YWKA 2XYHB 1FK9B 4FDFA 1XNRF 2ZHAA 2NUUG 2H5JB 1IBKJ 1JLFA 4WKRA 2L9WA 2VA2A 5K14B 2YY3A 3QWUA 3DC2A 2LXUA 3CJQA 3TNVA 2K9IA 4ED8A 3W62A 4ED1A 3RBZA 2OHDA 3FRYA 3KK2A 3CD5A 3SV3A 2GVDB 3BR9A 3PHEA 5GAEI 5KFJA 1XBWA 2C1EB 3K57A 4NEYA 2C2EA 4DCJB 2ZHOA 2CZ9A 2AY0A 2PEHA 2JRSA 1N33J 4OZ5A 4DR1F 2R7UA 1FD8A 1CBKA 1FE0A 2GIQA 4B17A 1CG2A 1B0TA 2V2KA 1AXQA 4J91A 2CUYA 1WHVA 5C25B 5A8KA 4M63A 3LANA 2YH1A 4CH1A 1CS4B 4F3QA 4ME7E 5J2QB 1F9HA 4DV1F 4R25A 2YTCA 3BZQA 2MZTA 4DV4J 2K7JA 3SIPB 5C42B 1GMUA 1TFWA 4C9DA 2DR9A 2PA8D 4MIBA 4WXOA 4GC6A 1L3KA 2OPPA 2DD8S 1L3UA 2CJKA 2OEMA 1QD1A 3ETMA 1S1XB 2AYMA 1N5YA 2HS0A 2DH7A 2AP6A 4TLRA 1N32F 3IAS9 4DQRA 4FYVB 2HQDA 1K1QA 3G82A 1HWUA 4FS1A 5LJ5Y 3NNEA 2XB2D 4GKKJ 3NY0A 2NYIA 4ECWA 1S1VB 4OI6A 2FJVA 1GH8A 4JI2F 4AXIA 3GJSB 1FDNA 4KHRA 3VV2B 4DR6F 2KFNA 2CNNB 4PCQA 2EC2A 4WF9Q 3DNCA 5KFEA 4E0DA 3RRHA 1BDVA 2RRBA 2NREA 3HVWA 1R3NA 3ET6A 5IOLA 2MZ1A 4F67A 5LM7E 3ZFVA 2M9KA 4C3MA 2HVEA 2KU7A 4EWTA 3M8SA 3TVKA 3R2CJ 4DV5J 3W3SA 4DL4A 2XZDB 2AF6A 2PC6A 4OZNA 1VOMA 4R5PB 1T3NA 2FLOA 1A0OB 2WONB 3ZC4A 1ZBTA 3O44A 2B56A 3I0SA 1X9SA 1FERA 4OYOA 3MMBA 3RG6A 2GMLA 2VFVA 1KQFB 4YOEA 2UVVA 3MEEB 2V4JA 4B9VA 3OVBA 2J8SA 3H5UA 4YY3J 3CJRA 2DKOB 5E3RA 1TL4A 4M5LA 2AJ2A 2FJAB 5J2MA 3I55S 2AX1A 1G6BA 1KLMA 4NLYA 3D1QA 2W2NP 2AZ3A 3P96A 2BDPA 4DR4F 3EX7B 1OY8A 3G6XA 4HKQA 2F8MA 3KG4A 2D3ZA 3FCVA 5FLXY 2PI5A 5KG4A 4KT0C 2DJWA 2NZCA 2K29A 2EG2A 4A46A 5IXUA 4EK2A 5HROA 3QFHA 4A48A 4K2JA 1D8ZA 4LBPA 1OY6A 4PQUB 2EFGA 4ECZA 3ZNUA 2N3LA 4OV1A 3MD3A 2O3DA 2EK6A 2YQ0A 3PYGA 1JLQA 2ZH6A 2CVIA 1O8BA 1U6BA 2KYZA 5D77A 4TY8B 2BKNA 1S9FA 1VHIA 2J9DA 4DS4A 3OHAA 4ZN3A 4PKDB 1D9AA 2NXEA 1SKRA 3NMRA 3IWNC 3DXSX 1FFGB 3R27A 3VEBA 4WZMA 2CQ3A 2EFQA 3VCDA 2V0NA 2WTFA 3NS7B 1KN6A 1SPBP 2MKCA 3G6VA 4K4VA 4O0NA 3UCZP 2M0GB 4P2MA 1WC0A 1NM2A 4PAAA 1S6QA 2HNZB 4UOFA 3QT6A 3KLEA 1BQMB 2CJAA 1IKYA 1FA0A 2GGPB 1NJYA 1QUVA 5BYRA 2RD5C 3UD4P 3KNAA 2HZCA 1RAEB 4XDCA 2WVEA 2EC0A 4DQQA 2UUBF 2UXDJ 5KFBA 1Q16B 1IKWB 2LDIA 1Q7LB 3MPUB 1B4SA 2FLNA 1H0HB 3CCJS 3K7RA 4R8UA 1SL1A 3M8ZA 1IKVB 2HQGA 5CH7B 3M05A 2D9PA 2M7SA 1F6TA 2VFSA 3DDIA 3MR3A 5GMDA 2IAJA 1N34J 3PRBA 3CJKA 5IC6B 2MLXA 3HVTA 4IDKB 4RBVA 4KHPJ 1LFPA 2E5LJ 2KYXA 5L1LA 3IM9A 2DHAA 1XWLA 3BEGB 4AUKA 4ZMMA 2M88A 5KFNA 3K5PA 1WJ9A 3VALA 1Z1ZA 3UCGA 2BE9B 4DPWA 2Z8QA 4LFBF 4EO6A 1L3TA 3FSYA 1B3TA 2RQ4A 3IBWA 3VR1A 4X4NA 4FXWA 4PG8A 3OL6A 3VWSA 2DGSA 3TJ9A 4MKYA 4XPEA 5KFHA 1M5SA 5KT3A 2FDNA 3RU0A 3EPIA 3A8IA 1S77D 3DLBA 5M2UA 2KT5A 1IXKA 1CJUA 1SJRA 2Q3PA 2MGZA 4B9UA 4CO3A 4MK8A 2XI2A 5HBMB 2Q66A 2VB6A 1B28A 1N56A 2MPUA 3TZXA 2H4YB 3CC7S 1RGVA 3TUIC 1FRJA 3BSOA 3DDKA 3D2WA 2ZH4A 4N41A 2PFDA 2CFXA 2D3O1 4H4MA 4ZJLA 2K1RB 4DDFA 1AZSB 3RTVA 5KFFA 3OR1B 4WU3A 4ANEA 2JVOA 3GFYA 3KMSA 2KTQA 4CO2A 1MMNA 1S99A 2D1CA 4MAKA 3PFOA 2PEBA 4X4OA 1VYAA 2HNDA 3HSDA 3ZZPA 4E2FB 3OVAA 3QJPA 1NHVA 2NYHA 2WW4A 2ASLA 4DWIA 3ITHA 4CH7A 3RB6A 4JB8B 4BWJA 2HIQA 4RW9A 3GSIA 2V8DA 3M8QB 1OQ3A 2V8GA 1F5CA 2HHPA 1ZH5A 3HHNB 3FZBA 2VJVA 1M5KC 1NDCA 3RRKA 1H74A 5AE1A 4RNFA 4Q43A 3ISND 1HI8A 2E29A 4IH5A 4G65A 2W9BB 1TK8A 2ATCB 2BA9A 1AFIA 4A8XA 1MU2A 5F8NA 4LSZB 3BV8A 1V3ZA 4IFYA 3MUTP 3D67A 1V9OA 1NB7A 1VRQC 1TV6A 1B99A 3PCOB 5D4NA 1WWHA 4RPFA 2WOMA 4FNHA 3PVXA 3K5MA 4DCPB 3VAIA 1TL5A 2ILZA 1WTBA 2ZITA 1ZETA 1RTZA 2QZ8A 3NKYA 1RKIA 2CDRB 2HLTA 4I0WA 4BS2A 2CAXA 4BC7A 3CDUA 4ECXA 1ULRA 4P73A 2BQRA 1DQAA 3AODA 4Q0BA 3RJMB 2IM3A 4PUOB 2CIMA 4UUWA 1YJ9S 1GTEA 1UW9A 1VQPS 3D3CJ 2E5IA 2PSZA 1TUWA 3IA0A 2YH0A 4HT5A 4OYZA 2FHJD 4LRDA 3B4MA 2HS4A 3W1YC 3OUYA 4NL5A 2YNHB 3J80U 4ES2A 1WEZA 2NSCA 2F4VF 1CQNA 3MOZA 3FJ2A 3HMJG 4FF1A 2WVFA 4ZPAA 3SZ2A 2CQPA 3DOLA 1WEYA 3PNIA 1JIHA 1T9VA 3DOMB 4OZ2A 3W9IA 5K9FA 1HWLA 2YPYA 4DUYJ 3UNYA 1RCOB 4I7FA 3RZAA 1QE1A 1ZYQA 1VRTB 2JEGA 2XM3A 1K0TA 3KJQB 3EGNA 1DURA 1LWEA 3CSKA 1UZHA 3IWXA 3QO9A 4QIFA 5CYQA 2EG1A 2ZH7A 1VQLS 5A8WA 3AB4B 4NLOA 3OJUA 4ZCLA 5EN1A 3M6VA 3FCWA 3R1LA 4DPXA 4WIIA 4OIXA 2GVZB 1JLGB 3EPGA 3BS9A 5L1IA 4NASA 1RWPB 4OX7A 2FPHX 2HWIA 4E98A 2V8HA 1M5PC 4YR0A 3GG1A 4MT1A 1R8CA 3MR5A 2JOQA 4YP3A 3N4WA 1N6QB 2IC3B 3KHHA 1S0MA 1ZTTA 1YJRA 3M2VB 4UUXA 1VQ5S 4WFNQ 1WOSA 2C2ZB 2YKQA 3AT1B 2JC1A 4Q44A 5H1SV 3K58A 3B6BA 4RW4A 3J81Y 4KFBA 4H54A 4YFUA 2BR0A 1QTNB 3WIUA 3I31A 3CTRA 1VHFA 3N5BA 2ZBCA 4B9LA 3QT7A 2MEWA 3B4DA 3ULHA 5JMNA 1TUVA 4MK9A 2VG5B 2K5JA 4XAKA 4XTTA 5FDLA 2W8KA 1QAXA 5F8MA 2ROPA 4QR0A 1RACB 3CJ8A 2OSRA 1NMEB 4I1TA 2EBEA 3EICA 3NGSA 4PEOA 4DSKA 3T5JA 5L39A 1YJ7A 2OELA 3A3NB 4H4OA 5IQ6A 1G2EA 4NLSA 2DNYA 1MROA 4B9TA 4ZHRB 1RLCL 3B54A 3S1TA 2V69A 3B8HA 2BYCA 4W4MA 1REVA 1BWEA 1S48A 3GB0A 2HHHF 4FXDA 3NOGA 1RK8A 3R5CA 4J37A 2V8VA 2DR5A 2DVIA 5THWA 1KDNA 4QW9A 3HD2A 4Q7AA 5DG8A 3U02A 3DHWC 3KLHA 3OHBA 1XERA 3T1YF 4N8OA 1S4EA 1JKHA 2ADLA 3M7VA 2L9NA 1JLBB 3EJMA 2DEJA 2UUTA 2R8HA 2CQHA 2B43A 1ZPWX 3KLFA 4DXLA 3AB2B 2L41A 2RQCA 2FJBB 2ROGA 3DLLQ 1RXOB 2LFVA 3GR1A 1VBKA 3ZZZA 2ZOFA 1YKWA 1R6VA 3QRQA 4ZVOB 5DDRC 3AD9C 2ZE2B 1O6XA 1SUQB 1NJIT 2H48B 2F7VA 2V68A 3CXCR 4DV0J 5GMKa 2HBZB 2YVSA 5KFOA 2K06A 1NDLA 4LBIA 3M2UB 1U25A 1SIWA 2XNQA 2QLXA 4IOBA 3W2WB 4OX9J 4NYOA 2MYFA 2AYGA 3AHPA 3KJVA 3AFGA 3TP2A 3PACA 1IWAA 2BV3A 2FC8A 3CCSS 5IT4A 4LRFA 2C2MB 2AJ0A 1F3VA 4CYUA 3EGVA 5H9FJ 5I3UB 1FX2A 2XMTA 4MFBB 2O1PA 5SZTA 3H7HB 3CD6S 2MXYA 1SH3A 3OV7A 4IG0B 3MM8A 3OPKA 4X4UA 2NLWA 1DHMA 5LMNJ 4ANCA 4WFAQ 4O4GA 1P6TA 4IRKA 2ZDOA 4LF8F 2DH9A 4WPAA 1K1SA 2BXJA 1BD6A 1APSA 4DV6J 1NZAA 1YSJA 2VOOA 4B3SJ 3IWLA 1NRKA 2X1GA 2DRAA 2XEXA 3HHDA 1S1WB 1V6HA 1EKSA 2BZ2A 3KJFB 1AYEA 2VL1A 1NK8A 1GXLA 3LTOA 3IRWP 2FZKB 1T95A 2MLZA 4LF5J 3ENQA 2EW9A 5HMXA 4G1IA 1SV5A 4EO8A 2RDJA 3NBPA 3FCHA 4OI3A 1FWLA 4QW8A 1TELA 1RWNB 2JBVA 4ZVHA 3NAHA 1HWIA 1X60A 3CJ5A 1O51A 1Z4UA 2MY7A 4DL7A 1HW8A 5DQHA 2BABA 3AD7C 3G5OA 1CULA 2VQEF 2RE1A 4PXBA 4WE1A 4UTGA 5CZVA 1UKUA 3IRXA 4AT1B 4HACB 4FVCA 2A1BA 2GC8A 4X4TA 2E5HA 1Q8IA 3HULA 1GX5A 4AQYJ 2Q79A 5K20B 1TMJA 3VEAA 2XLJA 2KFYA 1EJ7L 3UDVA 4B3TF 1NCLA 1S1TA 2CQ2A 1DRZA 3GIIA 1HQUA 1CJKB 4Q2MA 1RI7A 2YQ1A 3GP9A 4IFVA 2VH7A 1X0FA 2ZC4A 1PC4A 3IS9B 4F50A 3NCQA 1IBLF 4L73A 3CE8A 3DM2B 1UA1A 4KGZB 2CWXA 2DCLA 4ZIWA 4YEAA 1S6OA 1VLOA 2DNQA 4ES1A 1WOPA 3N0VA 4RBUA 2POKA 2E9TA 1Z2ZA 2XYPB 5CYMA 4IG3A 3CCMS 1G1XA 2H4WB 1HL6A 3PX6A 3W8PA 1R0CB 5KT4A 5DQIA 1Q86T 2ZVIA 1OJ4A 4MKBA 2QLFB 3GU0A 3TOQA 1M90T 2I0XA 3NL0A 2M70A 1AT1B 1N0VC 3KUEA 1S57A 1TAUA 3S8SA 3NGDA 2HVIA 1PYTA 5GMEA 3R2DJ 3MMCB 3KHLA 3MF5A 2VC1A 1YK9A 2RRNA 1JLAA 3LW5C 3RB3A 4JI5J 3SCJE 1RT1B 1HHQA 1FRIA 3Q2SC 1NSQA 4PWDA 1RT3A 5AXMA 4DF8A 2K8GA 5KFGA 1P1LA 2MKJA 2Z2ZA 4M1KA 2JC0A 2DNNA 4ICLB 2QEXS 3MHYA 4GRSA 1KOHA 5AXKA 1NLKL 3DMJA 4DLGA 3EM1A 3TWZA 5KFKA 4LR9A 1FFWB 2ZJPQ 1LW2B 4IYQA 1T11A 2HHUA 2R4FA 1SL0A 2MY8A 4CLUA 4Y2AA 3FEZA 3C16A 5B0DA 3EVOA 4RX6A 2LU2A 1RT5A 4U7CA 5KG0A 2IMOA 3AQPA 1HBNB 5CABA 4DN0A 5F9NA 2OPRB 1CQMA 4ECUA 4UQGA 2IM2A 4TU8A 1ZAWA 3KNGA 3D28A 1T03B 3CT9A 2QYGA 4FBUA 1F2GA 2M3DA 2LQ9A 1TMMA 4C0OC 2MTLA 4I67A 4DR7J 3OSNA 1BAZA 1YX2A 3EVMA 1WNEA 3S6EA 1GK8A 4MH8A 1S6PA 3T1AA 1HLWA 5E3AA 2D7SA 3E2EA 2C2RA 1O0PA 3EMTA 1MMLA 3RB4A 2R8JA 3RR8A 5AXNA 1VQ9S 2E9RX 3AOAA 4DF4A 3A8JA 4QR1A 1Q5VA 5L38A 3N5FA 1R43A 2DNMA 4JI1J 4C8NA 1JWWA 2BJDA 2RIJA 4CT8A 2E1PA 3HT0A 2UUCF 1MG7A 3TAMB 4KO0B 4IO1A 2RHSB 2KL8A 4HTJA 1ARQA 2AW0A 2W2MP 1MNEA 3RBEA 1JXEA 3CJ0A 3SCIE 2AKWB 2AZ1A 3D9BA 2PMZD 5HVHA 2VKRA 3T1HF 2AV5A 1N5SA 1S12A 3T9ZA 3GV8B 4WK1A 2I5JB 1NU4A 1TU0B 1S97A 3DYAB 1S9GB 3UI3A 3UCUP 2DGVA 1ZM3A 4JI0F 2GAGC 1RT7B 2IM1A 1Y0HA 3CNQP 1X4GA 3T6BA 3SI8A 4K4SA 3HD1A 1UFLA 2C3UA 1WHWA 4X4PA 3R5AA 2N82B 1J5OA 2M52A 4DQPA 3BKFA 2UUAF 3H87C 1FTRA 4ZPCA 1BC6A 3HDSA 3HHLA 1NDKA 3FGVA 3G9CA 3D68A 1M0SA 5KOWA 4IH6A 4OHXA 4EZ6A 3MEGA 3HFVA 4QIWD 4WP8A 3M30B 3C14B 5IT0A 1IR1A 4QWBA 3UN5A 5E3CA 3CO0P 2D3UA 5DM7Q 4O3RA 2IVYA 2MJNA 2R8IA 1C0TB 2OMLA 1IUJA 2ILYA 4ZDNA 2P9CA 1AROP 2GHPA 3VZIA 3SQGA 2I1RA 1J5EJ 2EFVA 3VF0B 2YWWA 4NMLA 3NMAA 1UCNA 4WU2A 4OYPA 4O44B 1HYSB 3LO3A 4W90B 2F9DA 3J7YU 4M5KA 3NGRA 1Y10A 4K4WA 2HS3A 3LPYA 2OSQA 3PRVA 2IJFA 2Y8WA 2GQ2A 2CVEA 2XQCA 5ETLA 4GVBB 4WFBQ 1SBRA 5JXSA 4J9OA 1RBOB 3TEHB 3IR7B 4BC9A 2XZWA 3GLJA 5G0RA 2ZZNA 1YGYA 4NOHA 4JYAF 3HT3A 3QQCD 3CMES 2KH9A 1T02A 5LMUF 4I68A 3Q8YA 4FYXB 5KFIA 1JJ2R 1MNTA 4FKYA 3KXDA 3Q83A 2HQ3A 1QAYA 4RW8B 1RCXB 1IBMF 2F63A 2WZ1A 5B0GA 3H4DA 2RU9A 5GADU 4B3RJ 4BWMA 4TLQA 2BJ1A 3GXQA 3VGSA 1VQYA 1D3WA 3MM5B 3W7BA 1X4DA 2C2KB 4O4RA 4WKYA 3ILLA 2VOPA 3ILOA 3D66A 1NPRA 3CW2C 1T05B 4ZP7A 3KLGB 4A8OA 2QRRA 5D8HB 1KQSR 1WF2A 4NI2A 3PW7A 1GAOA 4C11A 1NEEA 2AT1B 2IYGA 2XTJP 4YB1P 2NXUA 4C48A 1XK8A 1FRLA 1TK5A 2RQKA 3L95X 3TW0A 2HRTA 5J2QA 4DX7A 3WDOA 3OL9A 4ZVUB 2KG1A 2EKYA 2DY1A 1YLXA 2HKEA 1Y00A 3GWCA 3TR5A 4GO7X 4LFAJ 1I1GA 3F73A 3NS5A 2KVQE 3A13A 4ZP9A 4LRBA 4M94A 3MURP 2JEFA 3DOKB 3MEDB 2IDEA 3OLAA 2EFOA 3VAJA 3BN4A 1BQNA 4CLYA 3V4MA 1UMJA 4MIWA 3T19A 2O66A 4B3OB 1CJTA 4WP3A 5HK4A 1SKSA 3EDRB 1FKPA 3CCRS 3T3FA 3KTQA 3I9ZA 2DT9A 1U0SA 2LU1A 2WSEC 3O8WA 4NCGA 2EPIA 3G87A 2FYXA 1C1CB 3HF5A 3W2VB 1IKXA 1RA6A 3D7SB 2LXFA 4RUAA 5ETRA 4Y34A 2AJFE 5D0HA 1HBOA 5AE3A 1RU2A 4UOCA 2B8PA 1EP4B 2VPZB 4CI0B 4NZ0A 1G7CB 3QGHA 3HP6A 1JNZB 1X31C 3QZ8A 2KHDA 2DHSA 1FKOB 2NXJA 2JZ5A 3BJYA 2IVMA 2OIHA 3TYTA 2C2NA 2DGWA 2VG7B 3BGRB 4ELVA 4NLGA 1UVIA 4QZVB 4B3MJ 1XNQF 1VI7A 3MUMP 1U48A 3LP0A 5DO2A 1HHTP 1P1TA 5D3GB 3MM7B 1XNRJ 2VBYA 3RR7A 1T9TA 4URGA 3HX9A 4DQIA 1F9EB 3HFKA 3IR5B 2KJWA 2OFHX 2YNFA 2KHCA 4R0JA 5DJBA 2LMIA 1Q8LA 4AE5A 3SFGA 3SQOP 2CYYA 2Z57B 2QGFB 3K8VA 4BBYA 1Q8KA 4LSNB 1GFWB 2C2OB 2IM0A 3DHXA 2H1YA 1IRQA 2YNIB 3CF5Q 3TO8A 2UZAA 3I9V9 3K0JA 5CQGA 1X5PA 4U8YA 1U0HB 1KD1T 5EWEA 1OO0B 2BM0A 4PQUA 1YJVA 2R7RA 2Z0GA 4DR1J 3FBFA 2AEFA 4RR5A 1VJWA 2RKIB 1WTFA 2IJNA 3M2RB 4URQU 3NNCA 5EUHA 1VLYA 2VG6B 2COLA 4N56A 2E1AA 4U8VA 1W26A 3S7RA 1U1KA 1XR6A 1RTJA 3UVJB 2MQOA 1X4BA 5BYSA 8ATCB 2R2SA 4DV1J 1FJEB 1HNVB 4LQ9A 1GMWD 2C3PA 3CCES 4CLKA 1EHWA 5BJRA 3V4IA 4C2MA 2OPQA 1VQ4S 4FVMA 1TL7B 4Y00A 1DLOB 1TVRB 3Q89A 3PR5B 1YVFA 2DR7A 1S1UA 4M5DA 5C24B 3R8YA 3LGMA 2J6SA 2A2DA 2BANB 3C19A 2FVCA 1BQMA 4HEA9 4OJ3A 4I2QA 3FSIA 2LDYA 1N32J 2DNKA 2K3KA 1HR0F 4AAIA 1XMQF 3PFEA 4OMFG 1FDBA 3A3OB 2M5YA 2B4PA 3DU6A 1CC7A 1QTGA 4BHQA 1LXJA 2DO0A 5K8PA 4JI2J 2J0QD 5IWAF 3QOQA 1EETB 5A0YB 3V81B 4OLOA 4DR6J 1B0PA 2J9EA 5HLFB 1IKVA 2ATLA 1DFDA 2YWFA 2LQ5A 2Q1LA 5HL7Q 3W9HA 3KLIA 3IFEA 1IWGA 4TU9A 1H38A 2QA4S 2HNYB 1KOOA 4YN3B 3UWTA 4C97A 2V2VA 2GQQA 1JLFB 3MXHP 1D1UA 1FFSB 3KK3A 1HNIB 2FHOB 2B9EA 2I9SA 3BO2A 4KR0B 1VRUA 5GAEU 2QN6B 2ZH5A 2IHR1 3L9ZA 4DZDA 1N8RT 4B02A 2C42A 2G2YA 3KK2B 3KHRA 4PXCA 1T9YA 2PGCA 1SKUB 2B6AB 4KH0B 3NO7A 1R8BA 3KG1A 5EGYA 1JB0C 4ER8A 5GAGI 2CPDA 3X1LB 3AH6A 4ID5A 2VBZA 4B9NA 3GJRB 1K73T 3PEHA 4QWEA 2HBRB 1LWXA 4WTOB 2MQ8A 2CAJA 4HL9A 3K5OA 4XIUA 4J9QA 3MDFA 5F3TA 2IY5B 2KM8B 4DR4J 4NYPA 3CIZA 2LKZA 3FKBA 4RNNA 3RBXA 4F0KA 2HZAA 2CJQA 3MM9A 3UW1A 5CA5A 1S76D 1AZSA 4USWA 1SQEA 3FK4A 3C6UA 5A8KB 1RB0A 3QRRA 3OR1A 4X66F 1EX8A 1JXLA 2XCPA 4PWUA 3ISZA 3RB0A 1RT4A 5E7OB 3R97A 3BQ2A 4LBHA 1PGZA 2L9DA 5HJXA 4HI2A 5KG5A 4DL6A 4TVAB 4LF4F 3J7YI 1ACMB 5KT7A 1MW7A 2FVSA 3ZZTA 2OPPB 4Z2XA 4YUDA 4C4WA 2RHQB 3PW4A 1N5YB 5L46A 2J5AA 4M5GA 3JTOA 3KKFA 3U1NA 4J9VA 3UDCA 5EX3A 2B7CB 3RAMA 3FUYA 3UDEA 3GZ7A 3LP1A 4NLUA 3KDNA 3V2UC 4N47A 4HT7A 1RYRA 2HEKA 5E3PA 2ZHBA 3ET6B 3OTOF 3R7BB 2FTRA 3ETOA 1X4AA 3UR3C 1U1MA 4OI0A 5HP1A 4UF4A 2UUBJ 1FX4A 2JL9A 5KFDA 3FEYB 5CXTA 4ZVTB 1NK6A 4OHZA 2J9DE 2P2CB 5JUMA 1RAHB 4F2SA 3BH6B 3WIVA 4H4KA 3I0SB 3W65A 3NCPA 1N5VA 3MMBB 4ZCKA 1TTHB 2U2FA 4ENOA 4OQJA 3QSYB 3M32A 2E5GA 4X4RA 2D9OA 5KFQA 2V4JB 2Z2MA 3PW0A 5CD4A 4C8OA 4YB6A 1GMVA 3ENWA 5J2MB 4LFBJ 1QUPA 1UW4A 1KLMB 4F26A 3NRBA 4L3NA 1RKJA 2BVZA 4DL3A 5H9FK 3I0RB 4FNIA 5D4PA 4JI8F 1Q78A 3CCZA 4YDXA 3V6DA 1RDRA 3GYNA 1UEUA 1C4CA 4FXVA 4QWAA 3TI0A 2F8EX 3MCMA 2U1AA 5ETQA 3UN2A 1SVDA 2PDAA 4DJBA 4USUA 1JLQB 3TUJC 3M8YA 4PABA 3E3XA 3N01A 1U1QA 5F8GA 1F9FA 4RW6A 1PYOB 3M6WA 2H65B 1RP5A 2DGOA 5K8MA 5L9NA 1Q8BA 1X9WA 1VQ8S 1RT2A 5KT2A 3BR8A 2B9YA 1URNA 3IM8A 5D78A 2QC3A 2YNGA 1SJ4P 2HFZA 3ZO7A 4HTIA 3M4XA 5D0EA 4HH1A 4CTAB 1UZDA 2CQ4A 3IGNA 2EI5A 3IBCB 4QR2A 4P2SA 4NA2A 4DV3F 3IR6B 1YHQS 1TKZA 2JLEA 2IC3A 3U27A 4OV6A 2PN6A 3I6PA 2QL9B 3M2VA 3KLEB 3RUBL 1IKYB 1VIOA 5E2QA 1BY9A 2GHWA 2XULA 3MOJB 5DZ6A 4X4QA 1KTQA 1FJ7A 2HURA 5HN0A 4U67Q 5M2RA 1Y9OA 2YKAA 3MPVA 2RH3A 4KGXB 3JSRA 1KQGB 4GVLA 3ZZYA 4QCLA 2RS8A 4QPTA 1JK9B 1VISA 4R8UB 4PWWA 2V5HG 4YQWA 2RB7A 1H2TZ 1TZ0A 2DXEA 2ZH1A 3H8YA 1K47A 2IAJB 1NLAA 3CJKB 3SSQA 3HVTB 2UU9F 3I4HX 3M8WA 1U02A 1J2VA 1UP1A 5EX0A 1ZS6A 2W7OA 1RTIA 2DBBA 1S0NA 4ZN1A 2DNGA 2JLFA 2RU3A 2RJZA 4ECSA 1RWOB 1UTAA 5E33A 3OLBA 4CIOA 3PTWA 4IOAQ 9RUBA 2JXHA 2QO3A 5F8JA 3G8QA 3O5TB 3A1YG 4I4BA 4ZHRA 2WB1D 1CJUB 4NLTA 4LSLA 1K8AT 1E6YA 4ZVPB 3AJDA 4C0BA 4OZJA 2CPXA 1NSKL 3G4SS 3P4UB 4PG7A 1VS3A 4RU2A 2F4VJ 3FSXA 1V5VA 1SH0A 2FLPA 2NPIA 1QAJA 3WC0A 5ETTA 3QSIA 4H4MB 1M5OC 4DX8H 4HV0A 3PKMA 1F2HA 1OMSA 1FNXH 2RNEA 2FIUA 3ZXWA 2CG4A 2XMVA 1ARRA 5DDOC 4IO9Q 2QSFA 1WKKA 3E8OA 3F0NA 1YRTA 3OFGA 4F4KA 4ZLPA 2DXDA 5B7WA 3ITHB 4WIQA 3CC2S 4ZLJA 3CMAS 2E7VA 1G4CA 2G4BA 4RW9B 2XNRA 3S01A 3QGPA 2ZD1A 4LQ3A 3M2UA 2WSCC 3OTEA 3HHEA 4CP5A 3OFHA 5RUBA 3K5LA 1RUSA 3J7ZT 1IR2A 1DQ8A 1MN7A 2KFZA 3W2WA 5LL6d 3BYPA 4NXNF 3Q22A 3GMGA 2YX7A 3IBFB 4DX5A 3ZTQA 5DDPC 3LQVA 5HSPA 2Y1LB 3RBDA 2HYIB 1P9YA 1MU2B 4ZPDA 2VBWA 4IFYB 3JAMY 1PBAA 2QV6A 1TV6B 2PFFB 1KSPA 4FS2A 2DYAA 1UJ5A 4N77A 2WVBA 2WVCA 1H3DA 2WOMB 1DTQA 1FWPA 4JV2A 3LP2A 4U9RA 2ROEA 4RBTA 4KGMA 3THVA 4IOCQ 1QDUB 4PXEA 4S0MA 3OD2A 3CEDA 1YBTA 4MIAA 2J7WA 2KB2A 2Q43A 4DU8A 4F0MA 2B9WA 2P9EA 4Q0BB 2BRLA 2RQMA 1U2FA 2VA3A 5C5JA 2JVRA 3J7Z5 1RHMB 3OFEA 3Q24A 3G71S 1OY9A 2DCUB 2FHJA 4Q5VA 1IJFB 4HHHA 3QGGA 5FD1A 3C46A 3TZWA 2W9CA 2C3OA 2FVQA 1Y7PA 2XZTB 5GVQA 3CO9A 1GEHA 4BLGA 2ASDA 4LF1A 2AWZA 2BEFA 3DOLB 1LK7A 1NXIA 3W60A 2JEJA 2HHHJ 2QMWA 4LF6F 3HSGA 2GFFA 1YIJS 4HHUA 4I7FB 1QE1B 1T7PA 2YX1A 2DNPA 1LWEB 2OEKA 4LREA 3B78A 4C0HA 3QO9B 4CT9A 2XY7A 3TAQA 2A18A 2XS7A 5E5NA 4F3OA 1FXRA 1NO8A 4G3IA 1UVLA 5A8WB 3BDEA 3UDLA 3GILA 3D1HA 3T1YJ 1LW0A 3DGPA 2CPIA 4ZPWR 5B0EA 5A6WA 4FPRA 3KYLA 3EUNA 2UXBF 4M8LA 5F8IA 1CEZA 3NGKA 1RABB 1WI8A 4X84A 3BREA 3T5LA 2IVFB 5J2PA 3BM7A 2BACA 3L7PA 2I2YA 3JQKA 4ZITA 2HVZA 1N48A 1UPPA 5A2QY 1NH8A 2ZM6F 2C22A 5KFRA 2Q6BA 2HSEB 4LUBA 1U47A 1I94F 1C1BA 2IMWP 3C8YA 2HGLA 2NS1B 5DLFA 4NA3A 2C2DA 4ALZA 2FZCB 2N4DA 1M5VC 3UQSA 1A9NB 3A3PB 1WC5A 3JQMA 4RNMA 1VQ7S 3R9LA 3D3BJ 1SQGA 5IZHA 3MMCA 3QT5A 4ZP6A 4CRJA 4KTQA 4K4TA 5E0OA 4EFAC 3ENAA 1TUGB 2QL5B 3QIPA 1EARA 2W01A 4RW4B 1RT1A 4KFBB 1WC1A 3GJQB 2MJUA 8AT1B 3CCQS 2DISA 4TYAA 2ZOGA 2E1RA 3Q86A 4U7UK 4DV7F 3G2XA 4P7VA 1CC8A 2Z2LA 1FJGF 5B0FA 5I3QA 3P5BP 4HH0A 3AJ1A 4OZ3A 3FMBA 4WYLA 3P5TL 1UEKA 3K2YA 3POTA 1RAGB 3H59A 2RS2A 5FDLB 5KG1A 2BKPA 2DO4A 3T9NA 5KFYA 3RRGA 4N5SA 1HARA 2JWNA 1VGYA 4LF8J 1N4LA 4A8KA 4J9UE 1QJHA 2LECA 4CO4A 3DI6A 2ZZMA 3BSAA 1O5JA 4H4OB 4MMOA 1HQEA 5A2QU 2GZOA 3BF4A 5D0GA 1V3SA 2NXNA 2QE5A 1X4EA 1MROB 3IG1A 2O5DA 1REVB 1HBNA 3WX4A 1ZPVA 3PJ9A 3PV8A 1FRHA 3CCLS 1UFWA 1NJWA 3N6LA 3PX0A 2VJUA 4KE5A 2R7OA 1B0VA 2LLZA 1P8GA 1VCTA 2MZSA 3KLHB 4ATNA 4LIWA 2AD9A 3FMTA 1JKHB 4ZA1A 2JSXA 4OYIA 3CC4S 3ZZ0A 3SEOA 3D6TB 2FQQB 1U1PA 3HPOA 1AFJA 2FZGB 4DFMA 4PG4A 3VQTA 4CLSA 5IV4A 1JLCA 1DZ5A 5FLXU 1OYEA 1FRXA 1YZ7A 2HHWA 1S5ZA 3M1VA 1RHKB 2VU5A 2R8KA 2Q2KA 4DL5A 3AXKA 2R7QA 2B8QA 3HO1A 4FKXA 4JP8A 3EZOA 3CDBA 4F4XA 3TAMA 2JXGA 4B3TJ 4KO0A 3EWGA 3W63A 4JV5F 6FDRA 1OSCA 1IBLJ 2KOEA 2JXIA 2XI3A 1U4BA 1GT8A 1BHNA 1H72C 1SIWB 2CNLB 3O6QA 4LIRA 1BWVA 1DY3A 4KGVB 1YBAA 1Q53A 2P6TA 2YKNB 5J2NA 3GFHA 1TP7A 3KJVB 1G3OA 2CPEA 3HKZD 3H5XA 4UY8T 2EBGA 1WEXA 2ZH8A 2G2OA 1PAEX 2PT0A 2DH8A 3NEKA 4HDGA 2AGPA 3DRYA 4PR6A 5CD4H 4FXEA 4ZLLA 1X0PA 4CYUB 1GX6A 5LOQA 3P3DA 4PRFA 4OI1A 4L74A 2AJQA 1HW9A 1W2BR 3HHLD 4FPIA 3HFZB 3M6XA 3E51A 3DLJA 4YHHF 3GONA 1KHWA 4O4GB 2ADCA 2CRLA 5B0AA 4IRCA 1WHXA 3EGZA 2DNLA 1RWXB 1UEVA 2RAQA 2AMCB 3RW6A 1AB8A 4NZ6A 3F44A 3RAQA 3BGUA 4NRTA 2XMWA 3DCAA 2RDIA 1UETA 4ZJQA 1WOOA 1RAJA 2NR0A 2BRKA 2K6LA 5EDWA 2ZJRQ 2KM8C 1SV5B 4U7UD 3NBPB 1CJVA 2DGQA 3MAAB 4UY85 2MQQA 4OX6A 5F8HA 3ZTOA 3HM9A 5BR8F 4NMXA 1JLEB 4O3PA 1WDTA 1EB0A 4ED3A 5K8NA 3FT7A 4F0HA 1H2VZ 2XMMA 2BA3A 2OLWA 3DLEA 4X65J 3G8TA 3THTA 1TL3A 2NQPA 3JYTA 1XR7A 5ITHA 2JLGA 3PX4A 2MKSA 4Z37A 4NCAA 2VPYB 2DGTA 2UUWA 5T41A 3HXMA 1OHNA 3I4PA 1S1TB 1R0AA 1VK3A 2R7SA 4QYZJ 3G86A 1RTHB 2HRUA 2NUHA 3MM5A 1TKTA 1WF1A 4O0IA 4HYKA 4CO1A 2NPFA 1VQMS 3PIPQ 2ZVSA 8RUCA 4UOGA 3ZTRA 5J1NA 3VAFA 3V6HA 2VC0A 3D1OA 3HK2A 1UWBA 4F25A 4DSFA 4ZK7M 1AUSL 2UUCJ 2B4OA 2RBFA 5HQLA 4IG3B 3KWMA 2OPSA 3Q23A 2UVUA 4RO0A 2RRAA 1Y5IB 1T3OA 2VV5A 2DY9A 1R8AA 4JI6F 2GHVC 5DRKA 1RE1B 4Y2CA 1FXLA 2HK3A 1ZM4A 3T1HJ 4OFZA 2G0CA 2BE2A 2HLUA 4KV8A 4PZVA 4U96A 2EWHA 2AJ4A 2Y3YA 3DLHA 1R8PA 4JI0J 1LQ9A 1ZZFA 1AW0A 1JLAB 2LCWA 2RMLA 5J1EB 2HPUA 3CD7A 4QIVA 4ZPTR 4PWDB 1E6VA 1LOUA 3BO4A 1XMOF 5DDQC 3SSSA 2RSQA 3HJFA 5MAOA 1RT3B 1NDPA 4KC5A 1WACA 1X93A 2UUAJ 2GJ2A 2VIHA 3P6YC 3FVYA 2HFNA 2YXLA 5HANA 2QA1A 4RW7A 3QYYA 2W8LA 2Y8YA 1VBZA 1QAIA 3BQ1A 2WCXA 2CG8A 4QPXA 1V5IB 4Y3CA 2MSTA 1FT8A 4IR9A 3TANA 3FFIA 2ZZTA 1PCAA 1C1CA 3ELHA 1IM4A 4ZVFA 4ZPBA 3DRXA 3FNNA 2AGOA 1XIQA 2Z2YB 5KFCA 3LWLA 2HQIA 3C16B 4KJIA 1RT5B 1AA1B 1HNXF 3NNHA 1T94A 1RTDA 4C8KA 2ZUAA 3N79A 2XO6A 3SBMA 1ZM2A 2E7XA 2B5JA 2BJ3A 5AJ3F 3TRGA 2X3GA 2CJ9A 1FKOA 3OXLA 4DL2A 2IFXA 4WWSA 4WFYA 1FJCA 2BOAA 4RNOA 1RBAA 4PYAA 4HI1A 4NPOA 2R2RA 1S6PB 2KXNB 5D3GA 4JYAJ 3MM7A 1FNOA 5LMUJ 3QLHA 2AYBA 2FVPA 3F41A 1OS5A 2WRMA 4J90A 4ERDA 3PKYA 2E9ZA 2AEJA 2DRBA 1OPIA 5IM0A 4DEZA 3QBCA 4LF7F 2OTJS 4MJKA 2JFKA 1XR5A 4EU0A 4DOZA 1IBMJ 1GXTA 3HVRA 3Q8RB 4DV2F 2YNIA 1EQMA 5ETKA 3W61A 2N7CA 2VF3A 3DRSA 4TQRA 4R0EA 3DRRA 1JJCB 4JI4F 4Q8FA 2YBVA 1ZAVA 1U0HA 2AN7A 1M1HA 2PO4A 3RGIA 1NKEA 1W2IA 2FVRA 3D6MB 5LSRA 2LQBA 2OUGA 1FTCA 2WVDA 3AA8A 2XS5A 3CCUS 2E44A 5KFXA 4RUBA 4TYBA 4A8MP 1WC6A 3VGUA 4DFPA 4KKOB 2H3EB 3FEXB 1ITPA 1HPZA 1W7WA 1VDHA 1SIZA 1J5OB 3ADAC 1U45A 2BBEA 1SC3B 3KK1A 1WKJA 3MMAA 3JSBA 1HNWF 4JI3F 3R7NB 3F56A 4Z7CA 2BNZA 2VUGA 1EZZB 2VICA 3HHLB 3BKUA 3MUVP 1ROFA 2P9GA 3TUZC 3MEGB 1SB6A 3GQCA 1TVRA 3LF0A 3MECB 1MMDA 1XC9A 4IH7A 3JTPA 3P49B 1U24A 4KIAA 1UPMB 3CDEA 2JHEA 2CQIA 2G1DA 4JI7F 2XHWA 3J81U 3SQGB 2F5GA 3SDEA 2OH2A 3HKWA 3NP5A 2XY6A 3R1HA 1BQXA 5HMZA 1Q82T 1VBXA 4C6AA 2X51A 4O23A 4O3NA 5D0RA 4LF2A 2J7KA 4F4ZA 1VQNS 2C3YA 2GPEA 4YR3A 2KO1A 3C66A 2R42A 1S79A 4OI4A 2XLIA 3OL7A 1SKWA 4X62F 4P7TA 3JSMB 2VFTA 3CWJA 1B01A 4LF9F 2ERRA 4K4YA 2IBOA 2GIFA 4DPYA 1PSDA 2A6MA 4LMZA 3MEKA 5G0RB 3BO3A 3QMQA 4DU7A 4XDDA 4ZVSB 1TKXA 3VW4A 2CQBA 1SJQA 4DUZF 1TR0A 3KOAA 1UFKA 1HNIA 5KFLA 1LEOA 3D6HB 1RJJA 2GMHA 1JJHA 1OSDA 4U6PA 1JNRB 1VC0A 4WBFA 2KZZA 3NXZA 1RWKB 3GFXA 5CYJA 5HAOA 1XNQJ 2P8IA 2B6AA 2VONA 2FHKA 1RWMB 3Q8PB 3GPAA 2LA4A 3JSYA 2CWKA 2YKPA 2HK2A 2ADBA 2FJDB 1NK9A 1N88A 5KT6A 1DAXA 1XQIA 2W4PA 1NAQA 1Y11A 4JBCA 3DLGA 5CCLA 1JXVA 4F04B 5CHCB 4NI2B 4TNOA 4K4ZA 1HBUB 4C11B 2B7BB 4OZLA 1PARA 2LP4A 1ZA1B 2JJ4D 3D6FB 4NLRA 2V2ZA 1RU1A 3I32A 2RUGA 4NXMF 1KONA 1FDAA 2E7WA 3DRPA 1KVKA 2H5EA 4KBIA 2MB0B 1ZA2B 3PYEA 1TQLA 4KPYA 4YS2A 1P9QC 2XWXA 1NKCA 4LFCF 4LVNP 2QIFA 2Q6CA 4I64A 5IS2A 4L76A 2MQLA 2G0JA 1HMVA 4URSA 4RZRA 4KY3A 3R6LB 3EE3A 4DBQA 4K2XA 5I3PA 1BQNB 4GC7A 2DNRA 3MR6A 4A47A 2ZUGA 7FDRA 3EVWA 1PG5B 3EGWB 1CJTB 5M2PA 2VHGA 1DBDA 3G6YA 2HWHA 3AAWB 3CB4A 1REGX 2IA0A 4LR8A 1M1GA 1FKPB 4LRCA 5KFSA 2JEIA 3GYGA 3OR2A 1KRPA 4YB7A 4NCGB 2VQFJ 4WTYA 3OBIA 1S10A 5KFPA 1FD2A 4GMKA 4DL0C 3L4BC 4ETZA 1IKXB 4P52A 1YBUA 3BBFA 4M5HA 4ED4A 2WBMA 2B4VA 3W8GA 2Z30B 2M8HA 3PJWA 3JTNA 1HBOB 2A2BA 3M9MB 2CPZA 3NCRA 4ZIVA 6FD1A 1HR0J 1P27B 4P72A 1XMQJ 4RLEA 2GAHC 2W2OP 1BLUA 1S9EA 3C15A 4QU7A 2FGOA 4RUCA 2KG0A 3W9JA 2HG4A 5IWAJ 4NLVA 4G1QA 4ZVEA 5KT5A 4ECVA 1MWZA 1FKAF 3MFIA 3OT9A 2J9CA 3BYRA 2OKQA 3V5RA 3HHKA 5LSOA 2EFPA 2L48A 2W1BA 2J0SD 1TAQA 4ZS6A 2R7WA 3H2LA 3E01B 2Y0SD 3PIOQ 3LP0B 2VODA 3K17A 2MQPA 1KP6A 5KFUA 2WB4A 2MKYA 4DPUA 4FF4A 5AXLA 3GIRA 4JV0A 1AUDA 4I69A 2UVRA 4RWWA 2YNFB 5A8RA 3SCLE 4CLTA 1FEEA 2A10A 1HD1A 2QA2A 5C2CA 3BH7B 5T7LA 3GE9A 3AOCA 4ZVRB 3I0RA 1N36F 2HHSA 4J9KA 2NXCA 3PJXA 2F1FA 2DNZA 2IPOB 3DXBA 4I2PA 3U1LA 3LGHA 3IP0A 1H7WA 4GKJF 1CVJA 4DMZA 3OXGA 3OVSA 1NK0A 1Y4ZB 2PI4A 2J76E 1DTTA 5B0CA 2BOPA 1RAFB 1RSCA 2FJEB 1RTJB 1BUXA 5I42B 2DITA 1D9FA 1GMWA 4DSJA 4X66J 4FYYB 3THPA 2W9AA 4C8YA 2R7TA 4NE9C 4WYWA 4F2RA 3W5YA 4HR2A 1R7IA 5L9XA 3PYDA 3V4IB 3MM6A 2OPQB 3LOUA 1LWCB 2ABYA 1BE4A 1RAAB 4CTAA 1S49A 1VQKS 3UD5A 4LF4J 4WP9A 2KN4A 1S1UB 4M5DB 3O3LA 4XK8C 3H5SA 1NNDA 1EA4A 4CM0A 1BXNA 1S4FA 3VTIA 3PO4A 1L5UA 4Q2LA 4I2QB 2CQCA 3HI9A 3FC9A 2BX6A 2H9ZA 3CCTA 4DHVA 1SJFA 3Q0AA 4F4YA 2KRBA 1HBMA 4K5SA 1FF2A 1H2UX 1S0VA 4B9MA 2AX0A 4QJVA 1C0UA 3D0GE 2DPJA 3ZTSA 4ED5A 4MKAA 1BMQB 3G6ES 2HVHA 3PY8A 5CCMA 3OTOJ 3GCWP 3KLIB 3UR0A 2E66A 4AL5A 2BMBA 3C6TB 2UXCF 3BKTA 2HHXA 2VDHA 1T0TV 1OPZA 2Z56B 3QPIA 1QLNA 1R0BG 3IGVA 3AY0A 1WF0A 1BGXT 2JH3A 4W98A 1Y5LB 1IR0A 3MAQA 3KK3B 1VMBA 1BDTA 1VRUB 4J9SA 2GS8A 2GCFA 1NPPA 4RNHA 3JB9k 5GAGU 5F0UA 4EGLA 3BB5A 1J27A 2MQMA 3QFWA 1PYSB 2D74B 1C4AA 2APOA 1EKRA 4V1Ak 1RT6A 1D09B 2X7IA 2XMUA 1EAYC 3M8PA 3U1MA 4J5OA 4OHWA 3PW5A 1NHUA 3M9OB 4ID5B 3PYFA 4HHJA 4QYRA 1JJ4A 1UVJA 3UPFA 1FDDA 3HVAA 4LRVA 1FE4A 4G6VB 3W5XA 3L7UA 2YWGA 1YZ6A 2MKHA 2ASJA 2J0WA 2BM1A 2YKMB 2HMIB 3NWRA 4JI8J 5BYQA 1R31A 4MJWA 5KG2A 3MM9B 1HNZF 2XBPA 1V3RA 1LKZA 3C6UB 3TZYA 1Q5YA 3H25A 3TUPA 2AJ1A 2ZNZA 5KFZA 4EYIB 4K0KF 4DR5F 1RT4B 1FNMA 5IV3A 4MTPA 2EVZA 2IRUA 4DR2F 3JXOA 2MZQA 5EWFA 2HHTA 1FHTA 4JUZA 3MPWA 4P9SA 1WD6A 1QVGR 3SCKE 1R89A 4RWXA 4NEZA 4OZ0A 1FK9A 3J80Y 1R6YA 3H2UB 4KB7A 5IC4B 5K14A 1L3SA 4BDPA 1S7HA 1MYKA 3TQ1A 4UW2A 1N5QA 4KHMA 1JX4A 2QJ3A 1T9WA 4X64F 1F5BA 3D4JA 3JS9A 3LP1B 3VZHA 4D3HA 5D15A 4PG5A 1U7LA 1VR6A 4CLFA 4DV3J 1RHRB 4ZCMA 1N5TA 2GVDA 3DGVA 4DG1B 5DETA 1U1NA 2FJXA 1U6FA 1FRMA 5ETNA 4ES3A 2V50A 3SFUA 3UNGC 5HP1B 2CKWA 4D3GA 1A6LA 2UP1A 1X5OA 4ELTA 5EHHA 2AU0A 4AL6A 2QLWA 1RHQB 2IRYA 2F40A 3UN3A 1Q79A 4ECQA 2V9WA 5C25A 3OL8A 2V4RA 1S72S 3AD8C 5HATA 1VK8A 1KS2A 1CS4A 2ZOMA 2UU9J 3ZNJ1 3W66A 2I8EA 1X4FA 3P8BB 4A8SA 3M32B 5C42A 4DSEA 3GJTB 2WK4A 2J8AA 3OXFA 1HI0P 4TY9A 4M5IA 4YDDB 1WUUA 2ZH2A 3J81j 2XMJA 2R7VA 2R7XA 4DX6A 1S1XA 4IQMA 2MLYA 4A8QA 3V6DB 3OJSA 2IA6A 2GJIA 3BPDA 2WSFC 2XSJB 1RHUB 3K8WA 2V2QA 4WFZA 2KKEA 4Q8EA 5DGAA 1H7XA 2LXIA 1S1VA 4D8JA 2QSWA 1ZM9A 1KC8T 2AGQA 1T8EA 4C7QA 3IC1A 1I6JA 3VAMA 1TL1B 2BJ8A 2ZH3A 4P74A 4C8ZA 2M8DB 3VGVA 4KGKA 2HRYA 3VAHA 5JJBA 3LAMA 2QG9B 2QX0A 4M5NA 1TK0A 4RUHA 4DR3F 4RW6B 4AXJA 1QSYA 3MD1A 3MR7A 4M5MA 1RT2B 1IBKF 1DQ9A 5ETOA 1TFYA 2VASA 4R5PA 3HLUA 2DIVA 2YNGB 1KLNA 2ACYA 2WONA 1QSSA 4USMA 2XG8A 4WFXA 3ILIA 3EXCX 2OI2A 2QMUB 1TKZB 1URRA 2VZ9A 3MEEA 3AA9A 3JQJA 4KPCA 4FYWB 2K7KA 1Q7YT 1RAIB 4FN5A 2F4FA 3I5AA 1N0UA 2N7YA 4WJBA 2VBXA 3NG8A 4NXNJ 1QM9A 1N33F 2NZ4A 2DGUA 2LYVA 5KFWA 3LH2S 1LWFB 4QYZK 1SI9A 2R2TA 2SXLA 2RUSA 2MKKA 1P94A 2B3TB 1XJWB 3DLKB 2K3IA 2OGUA 4G1PA 3KUHA 2J7UA 5CZXA 2DR8A 4DV4F 2N4CA 4USJC 3J7A1 5J1PA 4CZCA 4CO5A 1RTIB 3A8EA 2IDLA 1U8WA 1HI1A 2OO4A 3PO5A 3MCNA 4K4XA 4ZOSA 2DXFA 3PM9A 5F8LA 2JDJA 4TY8A 4P6QA 2R8GA 2E1MC 2KXHA 4NLXA 3ZTPA 1WG4A 1Z2LA 5DM6Q 1YJNS 3EZUA 2KKHA 2D69A 2YX4A 2LA6A 2FJWA 4BCAA 4LSLB 1SJ1A 5U47A 1ZZNA 3TZZA 1X9MA 3T41A 3I5CA 4AFFA 3OTCA 2HFVA 3CGIA 1E6YB 2GA7A 4GKKF 3CULA 4QBUA 3EZ5A 1UJ6A 2HNZA 5L8RC 1EQ0A 1EIYB 3MCOA 2AYEA 3MPDA 4L75A 2Y1IA 4CCHA 2GGPA 2ZC3A 1D0EA 4LJMA 1S6UA 1FVQA 1HKAA 3HHLC 2WAQD 1MWYA 4LF6J 1R8HA 1SC1B 3K89A 2NCKL 3C2PA 2VKZG 3T6JA 2FHMA 2FY8A 3GSDA 3IMQJ 1Q16A 1IKWA 1GXUA 4DV5F 3MFHA 2W7PA 4I6YA 2LVWA 1KEKA 1WG1A 2PMHA 3KUGA 2ZBPA 4ZJOA 2PMWA 3I56S 4JV1A 5B0BA 1KBRA 3IO1A 3TA0A 1Q4RA 2VFUA 3N6MA 2KELA 2VPWB 2UXBJ 3CJ3A 4CH0S 1RBLA 1UL3A 4IDKA 3LGNA 1QSLA 1VBYA 2RF2B 4AYBD 1YJUA 2JX2A 3FZ2A 2ZD1B 5A6PA 4ED7A 5KG6A 2I38A 5DG7A 4YY3F 1F5AA 3MI7X 2YQ3A 2ZM6J 1UVKA 3H5YA 4Y2IA 3Q8QB 4RU9A 1H6KX 2WW8A 4KSEB 2HAFA 5HQ8A 3A12A 1I94J 1YG0A 2OEJA 2YKNA 4OYMA 1WC4A 3TX0A 1X8DA 1RADB 1U6ZA 1MLAA 2A2CA 5T14A 2ACMA 2FD2A 4CDIA 4KRWA 2BJ9A 1Y5NB 3ICLA 3PHTA 4LR7A 5HBMA 5I4MA 2CPYA 1NBEB 2DEIA 2OD6A 3PEJA 3CD0A 4PYDA 2XC9A 1LK5A 1DTQB 5HI7A 3LP2B 1KKHA 1YWXA 5DG9A 3D5MA 2CDQA 3NOCA 4J9LA 4QWDA 4Y6IA 2OP5A 3BSNA 2K1RA 4DV7J 4DFKA 1FJGJ 4A8WA 2Y9HA 5C7PA 3US5A 2N3OA 3VQSA 1VIXA 5DLGA 2YPZA 2AIRB 4NLPA 3ZZUA 3R7SB 3TAPA 1VC6A 2FLLA 3NGUA 2LEPA 1F1BB 3CDWA 2MDAA 2F3JA 2RILA 4I56A 4CLZA 2ZH9A 1WSRA 1SJ3P 3MAAA 3TA2A 2W9CB 1U2CA 6AT1B 3BGFA 4Q45A 1JLEA 3M8QA 7AT1B 3TQEA 1DARA 4E8UA 5H9EK 4NYZA 2DHHA 1RISA 4K7QA 3KHGA 3G82B 4IRDA 3CIMA 3H40A 2GO9A 5JVGQ 2HAIA 2UXDF 2P6SA 3FQLA 3GIKA 3H4BA 2W9BA 2PE8A 1M5HA 5IFMA 4NCBA 2R9LA 5DGBA 1B7FA 3Q8UA 5F3ZA 3QIDA 4A4JA 1LW0B 3DGPB 1UAWA 2MZRA 2CQDA 2EKNA 4IKAA 3PZPA 1N34F 4OYBA 1RTHA 2O67A 3ONQA 3VAGA 5J2PB 2DGXA 4KHPF 2CZVC 2E5LF 3DU5A 1PJ5A 1WORA 3TJAA 2HHQA 2XHCA 1D8YA 4ETXA 5DQGA 1KR4A 2M4MA 1C1BB 2FC9A 1YTYA 3SYZA 4W92B 4F4WA 4JV5J 3OFFA 4PUOA 4F3MA 3OQ2A 1Q1KA 1U2RA 3VAKA 4PXDA 2GO8A 2KZMA 1ICEB 2OJ3A 1NH7A 1PBUA 2K2PA 1F60B 1MN9A 1NK4A 2YNHA 1U9PA 2M2BA 2X3DA 3MTJA 2Y1RI 1NHKL 3QIPB 5J1EA 5ETPA 1WSVA 3LAKA 3UE2A 3CCVS 1NSAA 4F8RA 3DOMA 2H5IB 4DSIA 2J6TA 1KTVA 3KJNB 5HROB 2QA4G 3B82A 3WZ0A 3PR4A 1VRTA 1VC5A 5KFVA 1NKBA 3GV5B 2VDIA 5AE2A 2H54B 4HLBA 3I87A 3POTB 2F9JA 2W2PP 1Q0NA 3J7AN 3MGJA 4YHHJ 3OSPA 3H90A 3BPSP 4ZLNA 3I96A 1RHJB 1SC6A 3EXYA 2XMKA 3W64A 2HW3A 2XMAA 3N9UC 4O3OA 2KT2A 4DCOB 2V6AA 2GVZA 5DS7A 2XCAA 1JLGA 2V34A 2GQCA 3DI6B 2HQFA 1HQEB 3CUNA 2K1OA 2BSQE 5L1KA 3K5NA 2VD3A 1GTHA 5HO4A 3IG1B 3A4TA 2ZFHA 4RKUC 3TEGA 5IT9Y 1CSJA 1T9UA 4X65F 3HZEA 4FYDA 2HWTA 3QJJA 2A6OA 4TU7A 3BGOP 4P71A 2UV8A 3FRZA 5SUHA 1N6QA 5IQQA 1S6QB 1Q81T 5BR8J 4HVZA 4KYZA 3R5DA 1IQTA 3R6GB 2CPJA 3R5JB 5F41A 1F0XA 3HSZA 3WBZA 4OYWA 1JLCB 4USVA 3FMWA 1QVFR 3M1VB 4K5RA 3MMJA 2BW2A 2LEBA 1KFDA 5LXYA 3EDQB 4OJ1A 5HJYA 2HGMA 3AOBA 2DRDA 4UOHA 3P45B 1YJTA 1NB2A 2VG5A 2DK2A 2V8PA 2GMJA 4TXSA 4F02A 2O01C 3TJ8A 4F4AA 2BJ7A 4CWBA 3G96A 2G0IA 3V6JA 5KFMA 1M1KT 4OHYA 3R3TA 2IIHA 2LEAA 3QAEA 5F0WA 5J2NB 3FBCA 2OMOA 4USIA 5E3QA 4J9MA 1U1LA 4KKOA 2CPFA 2ZKUA 4JI6J 2B9XA 1IBCB 1U49A 2XGPA 5IT9U 3RYLA 2MGZB 1LFWA 4DUYF 4ECRA 4K50A 1H98A 2MHEA 2X1AA 5D4LA 1SH2A 3M9NB 2HGNA 1YRUA 4KAIA 2E1CA 3TARA 4ECYA 3BDPA 3MECA 2L08A 2F65A 3HZGA 3GYXB 5C2GA 1XMOJ 2GX8A 5K8OA 5EWGA 1NUEA 1GQEA 3R5BA 5GAHU 1JLBA 1XTZA 1T9XA 4NLWA 1TKDA 3BBBA 4I6WA 2RT3A 3CMQA 1NPKA 4RJVA 1KVIA 4JOUA 4YB5A 2G2ZA 3CDAA 1UWAA 5LT5A 2HNDB 2ZE2A 1SUQA 5ADZA 1CJVB 1HQ2A 4LT6A 1I3OB 4LRAA 5D6GA 2DB1A 3JSMA 2HZVA 1ZOTA 2X1BA 4CNZA 1HNXJ 3TA1A 2FY1A 4C98A 4PG6A 2Z4PA 2NSBA 4F36A 5AJ3J 3DLEB 4CO0A 4CLLA 1TL3B 4TQSA 3JYTB 2ZKTA 1PIEA 3CJ4A 2V4QA 4P2FA 3NGTA 3ZZRA 1X5TA 3RAXA 1B64A 3G8SA 4O3QA 2HVDA 3H0PA 5I3UA 3MZIA 5HVGA 4MFBA 1CLFA 3HJVA 5L1JA 1R0AB 1HA1A 5HMYA 3BQ0A 4IG0A 2XLKA 2V94A 1TKTB 1Q95G 2AQ4A 5JVHQ 3BN7A 1KHVA 4FF3A 2UVWA 3R5GA 4LF7J 2XS2A 2XYGB 3V6KA 1UWBB 3QAUA 3BSCA 4IR1A 4ID8A 4RL1A 5HVFA 1IN0A 2WHOA 4DV2J 1S1WA 2UV8G 4J7CA 1HBUA 3AJ2A 2OPSB 4ILRA 1VJQA 3UO0A 2CJYB 2V67A 4JI4J 1XN9A 2H3AA 2CNKB 2BE2B 4UT4A 2GV1A 4KV8B 5FIIA 5A76A 1U1RA 3TX8A 3NAIA 3OUYB 2BNWA 4H4KC 1RWWB 4UQTA 3CJSA 2ZBIA 1E6VB 3H2VE 4ED0A 2ZBRA 1N52B 4F7VA 3L7OA 4EBCA 4P75A 1HNWJ 4JI3J 3LALA 1UVMA 1LNQA 1K44A 3MWBA 4HACA 3QNWB 7FD1A 4WCEQ 4DZ6A 3MAHA 2IJRA 4OL8A 4QIEA 4RW7B 5KFAA 5CYQB 4DLEA 3LPEA 3VVTA 1I5OB 2CJXB 3JAMU 1ZAXA 2CQ0A 3DFEA 4Z7YA 4L3KA 1OG7A 3OTBA 3GR0A 2GJFA 1WELA 4JI7J 3FFIB 3D0IE 2B0GA 1CJKA 4PPDA 4ILLA 3DKDA 4DV0F 3IS9A 4DSLA 3DDNA 1LV5A 4L6V3 4HDHA 2JNJA 3MCSA 3DM2A 3PRDA 1W25A 1RTDB 5DZ7A 1NJZA 2CJBA 4CM2A 2B5JB 4USKA 2J0XA 4OX9F 3Q8VA 2AHOB 5HMWA 1U09A 1X4HA 2BJEA 3GG0A 3CJTA 3H98A 2QT7A 4X62J 1QTMA 1KQKA 4LF9J 2ASYA 4CQ1A 1RYSA 3E01A 4C8LA 3PG9A 5B09A 2WBRA 3D54A 4OLPA 4EUVA 4FF2A 3QLHB 5LMNF 4DUZJ 4B9SA 2ZJQQ 1FESA 1X5SA 3OW2R 5IM0B 4TKTA 5F9LA 3HCXA 4DV6F 2BE7D 2H51B 2MHNA 3IN5A 4B3SF 1WG5A 2CPGA 2CA9A 4QQBA 2ZDPA 1H73A 4ICLA 3VGTA 4A8FA 4LF5F 3DRSB 3DRRB 3QZ7A 1PC5A 4IUFA 5MLCV 2VPXB 4OX8A 1WI6A 3GV7B 3HSJA 3SXLA 4EBDA 1LW2A 2MKIA 2KJVA 2QLJB 2HQCA 2GNKA 2GW8A 3MR2A 4ZKAA 4FBTA 1HPZB 3NLCA 3LWMA 2MMYA 2YKOA 1HFEL 3N28A 5I42A 3VHQA 4EBEA 4NXMJ 3KK1B 3LJPA 3MMAB 2W4CA 2XSFA 4V19X 2HFOA 2OPRA 2DIUA 4ZVGA 2ALYB 1T03A 1YRXA 1RQ0A 2QLBB 4PQAA 1YJWS 1LWCA 2YWHA 4AQYF 5HQMA 4LFCJ 4U95A 4XPCA 2W2QP 2IBKA 5KG3A 2R3VA 1FRKA 1FI4A 2VQFF 2VQEJ 1OYDA 1NK5A 4PPZA 5KAKA 3KLFB 3KLVA 3SDEB 1UVNA 5FJ4A 2CXEA 2KT3A 1RWUA 2CADA 1FCAA 4K59A 2DHXA 1MSWD 4NX9A 3K59A 2CQGA 2BW7A 1Y3KA 4UZBA 3WC2A 4Y0FA 1NJXA 3WQPA 2DPIA 3Q2TC 1SQFA 4LVOP 1L3VA 4J9RA 1WKLA 3PW2A 3UFCX 3PXGa 2I5JA 3C6TA 2C3MA 3DYAA 1S9GA 4Y2KA 4DFJA 2E5JA 2B4UA 3EYZA 4EEYA 1TKXB 1RT7A 4J9PA 4JI5F 2OD4A 3L3CA 5LSLA 2OFGX 3UD3P 3KFWX 2XWYA 3LA0A 4KH1B 2DHGA 5KTQA 1PKUA 4USHA 4TN2A 1UJ4A 1PAUB 1D9DA 4J9NA 1X4CA 3RW7A 3SV4A 3GCXP 3ENVA 3ISNC 3MM8B 4DUTA 2QMXA 4NA1A 4MYTA 3M30A 4ITSA 3C14A 4KQZA 4I6AA 5E41A 2YWEA 2ZBQA 2BQUA 1IJEB 1A7GE 1SC4B 2RDDA 3DLGB 1U1OA 1C0TA 4XO0A 2EEYA 4MYUA 2YKMA 4FP9A 2ZNYA 2HMIA 1N36J 2HFUA 1SXLA 1RAOA 3T5KA 1CPZA 5GAHI 2ZEJA 1RLDA 4O44A 3DRPB 1HYSA 2HHVA 3KG0A 3GTYX 2VFRA 4QWCA 4GKJJ 3VVUA 3M8RA 2DTJA 4C3LA 4N7TA 3TVYA 4ZCIA 2DR6A 3X3UA 2I6WA 4GVBA 4NLDA 4NWBA 4DR7F 2KDOA 3TVZA 1HMVB 4WXWA 3IR7A 3GIJA 1CULB 3GFZA 1F3FA 1KFSA 4WE1B 3QT8A 5D4OA 3H42A 2LQ8A 3IRXB 3I82A 2XGQA 2IYIA 4ZVQB 2OTLS 2KI2A 2QTWA 3QRPA 4MKVA 3H20A 4JI1F 2G1HA 4RW8A 4DS5A 3OR2B 2H1OE 2JFDA 3SMZA 1YITS 4YMEA 4FZVA 4C8MA 3GIMA 3L09A 2DNOA 1VQOS 3CJ2A 1KNZA 3OTDA 2CQ1A 4DG1A 4EMDA 4ECTA 1X7VA 2PIIA 1HQUB 5KFTA 3CVKA 1S59A 4IFVB 3DN9A 1RA7A 5CAAA 5GADI 4V19J 1HD0A 1FWKA 4C3KA 1HWKA 1JMTA 4M95A 1K0VA 2Z58B 3BBCA 4M5JA 4DPTA 1ELOA 3Q8SB 1S9EB 1T05A 3KLGA 3C15B 2PA3A 1VQSA 1WHYA 2KXFA 1FO1A 1S7IA 2ZWPA 4OI2A 3NNAA 2CNOB 5CYMB 2J6UA 4G1QB 2QL7B 4ZP8A 1OIAA 1OQ6A 1U8SA 4WZQA 3QJLA 4K4UA 4YR2A 2AEMA 4Y65A 1YQHA 2A0FB 2B51A 2UXCJ 3I5BA 1HWJA 4ILMA 3ILJA 3IXQA 1NZ8A 3CPWR 1PJ6A 4X4SA 5ETVA 2OAUA 5AT1B 3FDSA 1YDLA 2ALZA 5A8RB 1GNKA 2ZWOA 4OZ1A 2CPHA 3DOKA 1KWMA 3MEDA 2G13A 5T7LB 3O2IA 1PO6A 2MQNA 1C2PA 1IVZA 3D0HE 2W4DA 1J5EF 1IM6A 4B3OA 2EXUA 1I51B 1WC3A 3NWGA 3MTKA 4OYXA 4GO5X 2XSJA 4I2PB 4L72B 1N54B 3FQKA 3DMJB 1XEZA 1PILA 2QFJA 3NS6A 1XMBA 1ZTWA 4DPOA 1KVJA 2V63A 1U26A 1LXNA 2W24A 5ETMA 1TL1A 3W2VA 3T5HA 3QWPA 4O3SA 3MPYA 1DTTB 4MK7A 4USTA 2HBYB 2HBQB 2X1FA 3O1LA 1HNZJ 1FVSA 1EP4A 2HIYA 1DJ0A 2D3OR 1JQGA 4QIGA 4EZ9A 4DI6A 1FXDA 2BUNA 4AD6A 3ZZOA 2PD1A 4K0KJ 4DR5J 5KG7A 1YI2S 5LXRA 4A8YA 3C3LA 4OYAA 3MM6B 4P2XA 4ANDA 4DR2J 4ZPVR 4UZCA 3AXMA 2VG7A 3BGRA 4B3RF 4OJGA 1B70B 3SSRA 2L3MA 2HFSA 1UA0A 2CZ4A 4QU6A 4NRUA 2BQ3A 4X64J 1HBMB 3KMQA 4LSNA 1MWQA 4DN9A 4EI2A 1HHSA 1C0UB 2QYCA 9ATCB 4NLQA 1RWVB 1LWFA 1B7YB 1NSPA 2XO7A 2BKOA 2MSSA 1IQZA 1FEHA 3QGIA 5B08A 3DLKA 2G9OA 2R2UA 2IRXA 3IAM9 4Y2MA 2Y0BB 3WX8A 2RKIA 3PDNA 3CCWA 3M2RA 4OJHA 2D41A 4QOTA 4LFAF 1HIYA 2GIRA 2VG6A 2MZJA 1VQ6S 2KRRA 3N6NA 3UVJA 1PJ7A 4ELUA 1RZMA 2RVJA 2QFIA 5KOXA 1MYLA 1HNVA 3AQOA 1S0OA 2LQJA 4B08A 3M6UA 3W5ZA 3BGLA 5H9EJ 3WHIA 5BXIA 1RT6B 4IQXA 4X2BA 3M8PB 1TL7A 4N8NA 1DLOA 2W25A 4WK3A 1Y3JA 4AL7A 1R27B 2P5VA 3A8KA 5C24A 2EFNA 2F8HA 2BANA 2FUG9 4ED2A 2V9KA 2DNHA 1SL2A 5K5MA 4K8RA 1QY7A 5LJ3Y 5ETSA 4Y28C 4CLWA 2Y1JA 4NZ7A 4N76A 1WDDA 4EYHB 3LUYA 1SCJB 2EK1A 4ED6A 1K9MT 2XY5A 1NK7A 4DQSA 4OHVA 4X4VA 1EETA 5A0YA 2C28A 3V81A 3QATA 3U7JA 5HLFA 1VFJA 3KDOA 5G4DA 2KVIA 4CLPA 2A3JA 2FB0A 2W7AA 2FGCA 4P10A 2HNYA 4DR3J 4B3MF 1OWXA
chains in the Genus database with same CATH topology
4ME7E 2GPEA 2WVEA 1EA4A 3PHTA 2BJ9A 1PARA 2K1OA 2BSQE 1B28A 1P94A 2JXGA 1B01A 3VEAA 2PC6A 1X93A 2BJ7A 2F1FA 3QSIA 1IRQA 1BAZA 3LGHA 2K9IA 1NLAA 2BNZA 1MYKA 1U9PA 2JXIA 3BKFA 3VW4A 3BKUA 4HV0A 2WVFA 2K6LA 3H87C 2WVBA 2WVCA 2CPGA 2CA9A 1ARRA 2KELA 2HZVA 1QTGA 1Q5VA 2RBFA 2CAJA 3VEBA 3OD2A 1MNTA 3QOQA 2AY0A 3FMTA 4FXEA 2CADA 1Q5YA 3BKTA 2JXHA 2HZAA 3FT7A 2CAXA 2BJ1A 2BA3A 2BNWA 1ARQA 3GXQA 2H1OE 2Y3YA 4D8JA 2BJ3A 1BDVA 2NZCA 2WVDA 1BDTA 2K29A 2FGCA 2K5JA 2BJ8A 1MYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME7 E;  2GPE A;  2WVE A;  1EA4 A;  3PHT A;  2BJ9 A;  1PAR A;  2K1O A;  2BSQ E;  1B28 A;  1P94 A;  2JXG A;  1B01 A;  3VEA A;  2PC6 A;  1X93 A;  2BJ7 A;  2F1F A;  3QSI A;  1IRQ A;  1BAZ A;  3LGH A;  2K9I A;  1NLA A;  2BNZ A;  1MYK A;  1U9P A;  2JXI A;  3BKF A;  3VW4 A;  3BKU A;  4HV0 A;  2WVF A;  2K6L A;  3H87 C;  2WVB A;  2WVC A;  2CPG A;  2CA9 A;  1ARR A;  2KEL A;  2HZV A;  1QTG A;  1Q5V A;  2RBF A;  2CAJ A;  3VEB A;  3OD2 A;  1MNT A;  3QOQ A;  2AY0 A;  3FMT A;  4FXE A;  2CAD A;  1Q5Y A;  3BKT A;  2JXH A;  2HZA A;  3FT7 A;  2CAX A;  2BJ1 A;  2BA3 A;  2BNW A;  1ARQ A;  3GXQ A;  2H1O E;  2Y3Y A;  4D8J A;  2BJ3 A;  1BDV A;  2NZC A;  2WVD A;  1BDT A;  2K29 A;  2FGC A;  2K5J A;  2BJ8 A;  1MYL A; 
#chains in the Genus database with same CATH topology
 3FBE A;  4CNY A;  3FBB A;  2RF2 A;  2YWK A;  2XYH B;  1FK9 B;  4FDF A;  1XNR F;  2ZHA A;  2NUU G;  2H5J B;  1IBK J;  1JLF A;  4WKR A;  2L9W A;  2VA2 A;  5K14 B;  2YY3 A;  3QWU A;  3DC2 A;  2LXU A;  3CJQ A;  3TNV A;  2K9I A;  4ED8 A;  3W62 A;  4ED1 A;  3RBZ A;  2OHD A;  3FRY A;  3KK2 A;  3CD5 A;  3SV3 A;  2GVD B;  3BR9 A;  3PHE A;  5GAE I;  5KFJ A;  1XBW A;  2C1E B;  3K57 A;  4NEY A;  2C2E A;  4DCJ B;  2ZHO A;  2CZ9 A;  2AY0 A;  2PEH A;  2JRS A;  1N33 J;  4OZ5 A;  4DR1 F;  2R7U A;  1FD8 A;  1CBK A;  1FE0 A;  2GIQ A;  4B17 A;  1CG2 A;  1B0T A;  2V2K A;  1AXQ A;  4J91 A;  2CUY A;  1WHV A;  5C25 B;  5A8K A;  4M63 A;  3LAN A;  2YH1 A;  4CH1 A;  1CS4 B;  4F3Q A;  4ME7 E;  5J2Q B;  1F9H A;  4DV1 F;  4R25 A;  2YTC A;  3BZQ A;  2MZT A;  4DV4 J;  2K7J A;  3SIP B;  5C42 B;  1GMU A;  1TFW A;  4C9D A;  2DR9 A;  2PA8 D;  4MIB A;  4WXO A;  4GC6 A;  1L3K A;  2OPP A;  2DD8 S;  1L3U A;  2CJK A;  2OEM A;  1QD1 A;  3ETM A;  1S1X B;  2AYM A;  1N5Y A;  2HS0 A;  2DH7 A;  2AP6 A;  4TLR A;  1N32 F;  3IAS 9;  4DQR A;  4FYV B;  2HQD A;  1K1Q A;  3G82 A;  1HWU A;  4FS1 A;  5LJ5 Y;  3NNE A;  2XB2 D;  4GKK J;  3NY0 A;  2NYI A;  4ECW A;  1S1V B;  4OI6 A;  2FJV A;  1GH8 A;  4JI2 F;  4AXI A;  3GJS B;  1FDN A;  4KHR A;  3VV2 B;  4DR6 F;  2KFN A;  2CNN B;  4PCQ A;  2EC2 A;  4WF9 Q;  3DNC A;  5KFE A;  4E0D A;  3RRH A;  1BDV A;  2RRB A;  2NRE A;  3HVW A;  1R3N A;  3ET6 A;  5IOL A;  2MZ1 A;  4F67 A;  5LM7 E;  3ZFV A;  2M9K A;  4C3M A;  2HVE A;  2KU7 A;  4EWT A;  3M8S A;  3TVK A;  3R2C J;  4DV5 J;  3W3S A;  4DL4 A;  2XZD B;  2AF6 A;  2PC6 A;  4OZN A;  1VOM A;  4R5P B;  1T3N A;  2FLO A;  1A0O B;  2WON B;  3ZC4 A;  1ZBT A;  3O44 A;  2B56 A;  3I0S A;  1X9S A;  1FER A;  4OYO A;  3MMB A;  3RG6 A;  2GML A;  2VFV A;  1KQF B;  4YOE A;  2UVV A;  3MEE B;  2V4J A;  4B9V A;  3OVB A;  2J8S A;  3H5U A;  4YY3 J;  3CJR A;  2DKO B;  5E3R A;  1TL4 A;  4M5L A;  2AJ2 A;  2FJA B;  5J2M A;  3I55 S;  2AX1 A;  1G6B A;  1KLM A;  4NLY A;  3D1Q A;  2W2N P;  2AZ3 A;  3P96 A;  2BDP A;  4DR4 F;  3EX7 B;  1OY8 A;  3G6X A;  4HKQ A;  2F8M A;  3KG4 A;  2D3Z A;  3FCV A;  5FLX Y;  2PI5 A;  5KG4 A;  4KT0 C;  2DJW A;  2NZC A;  2K29 A;  2EG2 A;  4A46 A;  5IXU A;  4EK2 A;  5HRO A;  3QFH A;  4A48 A;  4K2J A;  1D8Z A;  4LBP A;  1OY6 A;  4PQU B;  2EFG A;  4ECZ A;  3ZNU A;  2N3L A;  4OV1 A;  3MD3 A;  2O3D A;  2EK6 A;  2YQ0 A;  3PYG A;  1JLQ A;  2ZH6 A;  2CVI A;  1O8B A;  1U6B A;  2KYZ A;  5D77 A;  4TY8 B;  2BKN A;  1S9F A;  1VHI A;  2J9D A;  4DS4 A;  3OHA A;  4ZN3 A;  4PKD B;  1D9A A;  2NXE A;  1SKR A;  3NMR A;  3IWN C;  3DXS X;  1FFG B;  3R27 A;  3VEB A;  4WZM A;  2CQ3 A;  2EFQ A;  3VCD A;  2V0N A;  2WTF A;  3NS7 B;  1KN6 A;  1SPB P;  2MKC A;  3G6V A;  4K4V A;  4O0N A;  3UCZ P;  2M0G B;  4P2M A;  1WC0 A;  1NM2 A;  4PAA A;  1S6Q A;  2HNZ B;  4UOF A;  3QT6 A;  3KLE A;  1BQM B;  2CJA A;  1IKY A;  1FA0 A;  2GGP B;  1NJY A;  1QUV A;  5BYR A;  2RD5 C;  3UD4 P;  3KNA A;  2HZC A;  1RAE B;  4XDC A;  2WVE A;  2EC0 A;  4DQQ A;  2UUB F;  2UXD J;  5KFB A;  1Q16 B;  1IKW B;  2LDI A;  1Q7L B;  3MPU B;  1B4S A;  2FLN A;  1H0H B;  3CCJ S;  3K7R A;  4R8U A;  1SL1 A;  3M8Z A;  1IKV B;  2HQG A;  5CH7 B;  3M05 A;  2D9P A;  2M7S A;  1F6T A;  2VFS A;  3DDI A;  3MR3 A;  5GMD A;  2IAJ A;  1N34 J;  3PRB A;  3CJK A;  5IC6 B;  2MLX A;  3HVT A;  4IDK B;  4RBV A;  4KHP J;  1LFP A;  2E5L J;  2KYX A;  5L1L A;  3IM9 A;  2DHA A;  1XWL A;  3BEG B;  4AUK A;  4ZMM A;  2M88 A;  5KFN A;  3K5P A;  1WJ9 A;  3VAL A;  1Z1Z A;  3UCG A;  2BE9 B;  4DPW A;  2Z8Q A;  4LFB F;  4EO6 A;  1L3T A;  3FSY A;  1B3T A;  2RQ4 A;  3IBW A;  3VR1 A;  4X4N A;  4FXW A;  4PG8 A;  3OL6 A;  3VWS A;  2DGS A;  3TJ9 A;  4MKY A;  4XPE A;  5KFH A;  1M5S A;  5KT3 A;  2FDN A;  3RU0 A;  3EPI A;  3A8I A;  1S77 D;  3DLB A;  5M2U A;  2KT5 A;  1IXK A;  1CJU A;  1SJR A;  2Q3P A;  2MGZ A;  4B9U A;  4CO3 A;  4MK8 A;  2XI2 A;  5HBM B;  2Q66 A;  2VB6 A;  1B28 A;  1N56 A;  2MPU A;  3TZX A;  2H4Y B;  3CC7 S;  1RGV A;  3TUI C;  1FRJ A;  3BSO A;  3DDK A;  3D2W A;  2ZH4 A;  4N41 A;  2PFD A;  2CFX A;  2D3O 1;  4H4M A;  4ZJL A;  2K1R B;  4DDF A;  1AZS B;  3RTV A;  5KFF A;  3OR1 B;  4WU3 A;  4ANE A;  2JVO A;  3GFY A;  3KMS A;  2KTQ A;  4CO2 A;  1MMN A;  1S99 A;  2D1C A;  4MAK A;  3PFO A;  2PEB A;  4X4O A;  1VYA A;  2HND A;  3HSD A;  3ZZP A;  4E2F B;  3OVA A;  3QJP A;  1NHV A;  2NYH A;  2WW4 A;  2ASL A;  4DWI A;  3ITH A;  4CH7 A;  3RB6 A;  4JB8 B;  4BWJ A;  2HIQ A;  4RW9 A;  3GSI A;  2V8D A;  3M8Q B;  1OQ3 A;  2V8G A;  1F5C A;  2HHP A;  1ZH5 A;  3HHN B;  3FZB A;  2VJV A;  1M5K C;  1NDC A;  3RRK A;  1H74 A;  5AE1 A;  4RNF A;  4Q43 A;  3ISN D;  1HI8 A;  2E29 A;  4IH5 A;  4G65 A;  2W9B B;  1TK8 A;  2ATC B;  2BA9 A;  1AFI A;  4A8X A;  1MU2 A;  5F8N A;  4LSZ B;  3BV8 A;  1V3Z A;  4IFY A;  3MUT P;  3D67 A;  1V9O A;  1NB7 A;  1VRQ C;  1TV6 A;  1B99 A;  3PCO B;  5D4N A;  1WWH A;  4RPF A;  2WOM A;  4FNH A;  3PVX A;  3K5M A;  4DCP B;  3VAI A;  1TL5 A;  2ILZ A;  1WTB A;  2ZIT A;  1ZET A;  1RTZ A;  2QZ8 A;  3NKY A;  1RKI A;  2CDR B;  2HLT A;  4I0W A;  4BS2 A;  2CAX A;  4BC7 A;  3CDU A;  4ECX A;  1ULR A;  4P73 A;  2BQR A;  1DQA A;  3AOD A;  4Q0B A;  3RJM B;  2IM3 A;  4PUO B;  2CIM A;  4UUW A;  1YJ9 S;  1GTE A;  1UW9 A;  1VQP S;  3D3C J;  2E5I A;  2PSZ A;  1TUW A;  3IA0 A;  2YH0 A;  4HT5 A;  4OYZ A;  2FHJ D;  4LRD A;  3B4M A;  2HS4 A;  3W1Y C;  3OUY A;  4NL5 A;  2YNH B;  3J80 U;  4ES2 A;  1WEZ A;  2NSC A;  2F4V F;  1CQN A;  3MOZ A;  3FJ2 A;  3HMJ G;  4FF1 A;  2WVF A;  4ZPA A;  3SZ2 A;  2CQP A;  3DOL A;  1WEY A;  3PNI A;  1JIH A;  1T9V A;  3DOM B;  4OZ2 A;  3W9I A;  5K9F A;  1HWL A;  2YPY A;  4DUY J;  3UNY A;  1RCO B;  4I7F A;  3RZA A;  1QE1 A;  1ZYQ A;  1VRT B;  2JEG A;  2XM3 A;  1K0T A;  3KJQ B;  3EGN A;  1DUR A;  1LWE A;  3CSK A;  1UZH A;  3IWX A;  3QO9 A;  4QIF A;  5CYQ A;  2EG1 A;  2ZH7 A;  1VQL S;  5A8W A;  3AB4 B;  4NLO A;  3OJU A;  4ZCL A;  5EN1 A;  3M6V A;  3FCW A;  3R1L A;  4DPX A;  4WII A;  4OIX A;  2GVZ B;  1JLG B;  3EPG A;  3BS9 A;  5L1I A;  4NAS A;  1RWP B;  4OX7 A;  2FPH X;  2HWI A;  4E98 A;  2V8H A;  1M5P C;  4YR0 A;  3GG1 A;  4MT1 A;  1R8C A;  3MR5 A;  2JOQ A;  4YP3 A;  3N4W A;  1N6Q B;  2IC3 B;  3KHH A;  1S0M A;  1ZTT A;  1YJR A;  3M2V B;  4UUX A;  1VQ5 S;  4WFN Q;  1WOS A;  2C2Z B;  2YKQ A;  3AT1 B;  2JC1 A;  4Q44 A;  5H1S V;  3K58 A;  3B6B A;  4RW4 A;  3J81 Y;  4KFB A;  4H54 A;  4YFU A;  2BR0 A;  1QTN B;  3WIU A;  3I31 A;  3CTR A;  1VHF A;  3N5B A;  2ZBC A;  4B9L A;  3QT7 A;  2MEW A;  3B4D A;  3ULH A;  5JMN A;  1TUV A;  4MK9 A;  2VG5 B;  2K5J A;  4XAK A;  4XTT A;  5FDL A;  2W8K A;  1QAX A;  5F8M A;  2ROP A;  4QR0 A;  1RAC B;  3CJ8 A;  2OSR A;  1NME B;  4I1T A;  2EBE A;  3EIC A;  3NGS A;  4PEO A;  4DSK A;  3T5J A;  5L39 A;  1YJ7 A;  2OEL A;  3A3N B;  4H4O A;  5IQ6 A;  1G2E A;  4NLS A;  2DNY A;  1MRO A;  4B9T A;  4ZHR B;  1RLC L;  3B54 A;  3S1T A;  2V69 A;  3B8H A;  2BYC A;  4W4M A;  1REV A;  1BWE A;  1S48 A;  3GB0 A;  2HHH F;  4FXD A;  3NOG A;  1RK8 A;  3R5C A;  4J37 A;  2V8V A;  2DR5 A;  2DVI A;  5THW A;  1KDN A;  4QW9 A;  3HD2 A;  4Q7A A;  5DG8 A;  3U02 A;  3DHW C;  3KLH A;  3OHB A;  1XER A;  3T1Y F;  4N8O A;  1S4E A;  1JKH A;  2ADL A;  3M7V A;  2L9N A;  1JLB B;  3EJM A;  2DEJ A;  2UUT A;  2R8H A;  2CQH A;  2B43 A;  1ZPW X;  3KLF A;  4DXL A;  3AB2 B;  2L41 A;  2RQC A;  2FJB B;  2ROG A;  3DLL Q;  1RXO B;  2LFV A;  3GR1 A;  1VBK A;  3ZZZ A;  2ZOF A;  1YKW A;  1R6V A;  3QRQ A;  4ZVO B;  5DDR C;  3AD9 C;  2ZE2 B;  1O6X A;  1SUQ B;  1NJI T;  2H48 B;  2F7V A;  2V68 A;  3CXC R;  4DV0 J;  5GMK a;  2HBZ B;  2YVS A;  5KFO A;  2K06 A;  1NDL A;  4LBI A;  3M2U B;  1U25 A;  1SIW A;  2XNQ A;  2QLX A;  4IOB A;  3W2W B;  4OX9 J;  4NYO A;  2MYF A;  2AYG A;  3AHP A;  3KJV A;  3AFG A;  3TP2 A;  3PAC A;  1IWA A;  2BV3 A;  2FC8 A;  3CCS S;  5IT4 A;  4LRF A;  2C2M B;  2AJ0 A;  1F3V A;  4CYU A;  3EGV A;  5H9F J;  5I3U B;  1FX2 A;  2XMT A;  4MFB B;  2O1P A;  5SZT A;  3H7H B;  3CD6 S;  2MXY A;  1SH3 A;  3OV7 A;  4IG0 B;  3MM8 A;  3OPK A;  4X4U A;  2NLW A;  1DHM A;  5LMN J;  4ANC A;  4WFA Q;  4O4G A;  1P6T A;  4IRK A;  2ZDO A;  4LF8 F;  2DH9 A;  4WPA A;  1K1S A;  2BXJ A;  1BD6 A;  1APS A;  4DV6 J;  1NZA A;  1YSJ A;  2VOO A;  4B3S J;  3IWL A;  1NRK A;  2X1G A;  2DRA A;  2XEX A;  3HHD A;  1S1W B;  1V6H A;  1EKS A;  2BZ2 A;  3KJF B;  1AYE A;  2VL1 A;  1NK8 A;  1GXL A;  3LTO A;  3IRW P;  2FZK B;  1T95 A;  2MLZ A;  4LF5 J;  3ENQ A;  2EW9 A;  5HMX A;  4G1I A;  1SV5 A;  4EO8 A;  2RDJ A;  3NBP A;  3FCH A;  4OI3 A;  1FWL A;  4QW8 A;  1TEL A;  1RWN B;  2JBV A;  4ZVH A;  3NAH A;  1HWI A;  1X60 A;  3CJ5 A;  1O51 A;  1Z4U A;  2MY7 A;  4DL7 A;  1HW8 A;  5DQH A;  2BAB A;  3AD7 C;  3G5O A;  1CUL A;  2VQE F;  2RE1 A;  4PXB A;  4WE1 A;  4UTG A;  5CZV A;  1UKU A;  3IRX A;  4AT1 B;  4HAC B;  4FVC A;  2A1B A;  2GC8 A;  4X4T A;  2E5H A;  1Q8I A;  3HUL A;  1GX5 A;  4AQY J;  2Q79 A;  5K20 B;  1TMJ A;  3VEA A;  2XLJ A;  2KFY A;  1EJ7 L;  3UDV A;  4B3T F;  1NCL A;  1S1T A;  2CQ2 A;  1DRZ A;  3GII A;  1HQU A;  1CJK B;  4Q2M A;  1RI7 A;  2YQ1 A;  3GP9 A;  4IFV A;  2VH7 A;  1X0F A;  2ZC4 A;  1PC4 A;  3IS9 B;  4F50 A;  3NCQ A;  1IBL F;  4L73 A;  3CE8 A;  3DM2 B;  1UA1 A;  4KGZ B;  2CWX A;  2DCL A;  4ZIW A;  4YEA A;  1S6O A;  1VLO A;  2DNQ A;  4ES1 A;  1WOP A;  3N0V A;  4RBU A;  2POK A;  2E9T A;  1Z2Z A;  2XYP B;  5CYM A;  4IG3 A;  3CCM S;  1G1X A;  2H4W B;  1HL6 A;  3PX6 A;  3W8P A;  1R0C B;  5KT4 A;  5DQI A;  1Q86 T;  2ZVI A;  1OJ4 A;  4MKB A;  2QLF B;  3GU0 A;  3TOQ A;  1M90 T;  2I0X A;  3NL0 A;  2M70 A;  1AT1 B;  1N0V C;  3KUE A;  1S57 A;  1TAU A;  3S8S A;  3NGD A;  2HVI A;  1PYT A;  5GME A;  3R2D J;  3MMC B;  3KHL A;  3MF5 A;  2VC1 A;  1YK9 A;  2RRN A;  1JLA A;  3LW5 C;  3RB3 A;  4JI5 J;  3SCJ E;  1RT1 B;  1HHQ A;  1FRI A;  3Q2S C;  1NSQ A;  4PWD A;  1RT3 A;  5AXM A;  4DF8 A;  2K8G A;  5KFG A;  1P1L A;  2MKJ A;  2Z2Z A;  4M1K A;  2JC0 A;  2DNN A;  4ICL B;  2QEX S;  3MHY A;  4GRS A;  1KOH A;  5AXK A;  1NLK L;  3DMJ A;  4DLG A;  3EM1 A;  3TWZ A;  5KFK A;  4LR9 A;  1FFW B;  2ZJP Q;  1LW2 B;  4IYQ A;  1T11 A;  2HHU A;  2R4F A;  1SL0 A;  2MY8 A;  4CLU A;  4Y2A A;  3FEZ A;  3C16 A;  5B0D A;  3EVO A;  4RX6 A;  2LU2 A;  1RT5 A;  4U7C A;  5KG0 A;  2IMO A;  3AQP A;  1HBN B;  5CAB A;  4DN0 A;  5F9N A;  2OPR B;  1CQM A;  4ECU A;  4UQG A;  2IM2 A;  4TU8 A;  1ZAW A;  3KNG A;  3D28 A;  1T03 B;  3CT9 A;  2QYG A;  4FBU A;  1F2G A;  2M3D A;  2LQ9 A;  1TMM A;  4C0O C;  2MTL A;  4I67 A;  4DR7 J;  3OSN A;  1BAZ A;  1YX2 A;  3EVM A;  1WNE A;  3S6E A;  1GK8 A;  4MH8 A;  1S6P A;  3T1A A;  1HLW A;  5E3A A;  2D7S A;  3E2E A;  2C2R A;  1O0P A;  3EMT A;  1MML A;  3RB4 A;  2R8J A;  3RR8 A;  5AXN A;  1VQ9 S;  2E9R X;  3AOA A;  4DF4 A;  3A8J A;  4QR1 A;  1Q5V A;  5L38 A;  3N5F A;  1R43 A;  2DNM A;  4JI1 J;  4C8N A;  1JWW A;  2BJD A;  2RIJ A;  4CT8 A;  2E1P A;  3HT0 A;  2UUC F;  1MG7 A;  3TAM B;  4KO0 B;  4IO1 A;  2RHS B;  2KL8 A;  4HTJ A;  1ARQ A;  2AW0 A;  2W2M P;  1MNE A;  3RBE A;  1JXE A;  3CJ0 A;  3SCI E;  2AKW B;  2AZ1 A;  3D9B A;  2PMZ D;  5HVH A;  2VKR A;  3T1H F;  2AV5 A;  1N5S A;  1S12 A;  3T9Z A;  3GV8 B;  4WK1 A;  2I5J B;  1NU4 A;  1TU0 B;  1S97 A;  3DYA B;  1S9G B;  3UI3 A;  3UCU P;  2DGV A;  1ZM3 A;  4JI0 F;  2GAG C;  1RT7 B;  2IM1 A;  1Y0H A;  3CNQ P;  1X4G A;  3T6B A;  3SI8 A;  4K4S A;  3HD1 A;  1UFL A;  2C3U A;  1WHW A;  4X4P A;  3R5A A;  2N82 B;  1J5O A;  2M52 A;  4DQP A;  3BKF A;  2UUA F;  3H87 C;  1FTR A;  4ZPC A;  1BC6 A;  3HDS A;  3HHL A;  1NDK A;  3FGV A;  3G9C A;  3D68 A;  1M0S A;  5KOW A;  4IH6 A;  4OHX A;  4EZ6 A;  3MEG A;  3HFV A;  4QIW D;  4WP8 A;  3M30 B;  3C14 B;  5IT0 A;  1IR1 A;  4QWB A;  3UN5 A;  5E3C A;  3CO0 P;  2D3U A;  5DM7 Q;  4O3R A;  2IVY A;  2MJN A;  2R8I A;  1C0T B;  2OML A;  1IUJ A;  2ILY A;  4ZDN A;  2P9C A;  1ARO P;  2GHP A;  3VZI A;  3SQG A;  2I1R A;  1J5E J;  2EFV A;  3VF0 B;  2YWW A;  4NML A;  3NMA A;  1UCN A;  4WU2 A;  4OYP A;  4O44 B;  1HYS B;  3LO3 A;  4W90 B;  2F9D A;  3J7Y U;  4M5K A;  3NGR A;  1Y10 A;  4K4W A;  2HS3 A;  3LPY A;  2OSQ A;  3PRV A;  2IJF A;  2Y8W A;  2GQ2 A;  2CVE A;  2XQC A;  5ETL A;  4GVB B;  4WFB Q;  1SBR A;  5JXS A;  4J9O A;  1RBO B;  3TEH B;  3IR7 B;  4BC9 A;  2XZW A;  3GLJ A;  5G0R A;  2ZZN A;  1YGY A;  4NOH A;  4JYA F;  3HT3 A;  3QQC D;  3CME S;  2KH9 A;  1T02 A;  5LMU F;  4I68 A;  3Q8Y A;  4FYX B;  5KFI A;  1JJ2 R;  1MNT A;  4FKY A;  3KXD A;  3Q83 A;  2HQ3 A;  1QAY A;  4RW8 B;  1RCX B;  1IBM F;  2F63 A;  2WZ1 A;  5B0G A;  3H4D A;  2RU9 A;  5GAD U;  4B3R J;  4BWM A;  4TLQ A;  2BJ1 A;  3GXQ A;  3VGS A;  1VQY A;  1D3W A;  3MM5 B;  3W7B A;  1X4D A;  2C2K B;  4O4R A;  4WKY A;  3ILL A;  2VOP A;  3ILO A;  3D66 A;  1NPR A;  3CW2 C;  1T05 B;  4ZP7 A;  3KLG B;  4A8O A;  2QRR A;  5D8H B;  1KQS R;  1WF2 A;  4NI2 A;  3PW7 A;  1GAO A;  4C11 A;  1NEE A;  2AT1 B;  2IYG A;  2XTJ P;  4YB1 P;  2NXU A;  4C48 A;  1XK8 A;  1FRL A;  1TK5 A;  2RQK A;  3L95 X;  3TW0 A;  2HRT A;  5J2Q A;  4DX7 A;  3WDO A;  3OL9 A;  4ZVU B;  2KG1 A;  2EKY A;  2DY1 A;  1YLX A;  2HKE A;  1Y00 A;  3GWC A;  3TR5 A;  4GO7 X;  4LFA J;  1I1G A;  3F73 A;  3NS5 A;  2KVQ E;  3A13 A;  4ZP9 A;  4LRB A;  4M94 A;  3MUR P;  2JEF A;  3DOK B;  3MED B;  2IDE A;  3OLA A;  2EFO A;  3VAJ A;  3BN4 A;  1BQN A;  4CLY A;  3V4M A;  1UMJ A;  4MIW A;  3T19 A;  2O66 A;  4B3O B;  1CJT A;  4WP3 A;  5HK4 A;  1SKS A;  3EDR B;  1FKP A;  3CCR S;  3T3F A;  3KTQ A;  3I9Z A;  2DT9 A;  1U0S A;  2LU1 A;  2WSE C;  3O8W A;  4NCG A;  2EPI A;  3G87 A;  2FYX A;  1C1C B;  3HF5 A;  3W2V B;  1IKX A;  1RA6 A;  3D7S B;  2LXF A;  4RUA A;  5ETR A;  4Y34 A;  2AJF E;  5D0H A;  1HBO A;  5AE3 A;  1RU2 A;  4UOC A;  2B8P A;  1EP4 B;  2VPZ B;  4CI0 B;  4NZ0 A;  1G7C B;  3QGH A;  3HP6 A;  1JNZ B;  1X31 C;  3QZ8 A;  2KHD A;  2DHS A;  1FKO B;  2NXJ A;  2JZ5 A;  3BJY A;  2IVM A;  2OIH A;  3TYT A;  2C2N A;  2DGW A;  2VG7 B;  3BGR B;  4ELV A;  4NLG A;  1UVI A;  4QZV B;  4B3M J;  1XNQ F;  1VI7 A;  3MUM P;  1U48 A;  3LP0 A;  5DO2 A;  1HHT P;  1P1T A;  5D3G B;  3MM7 B;  1XNR J;  2VBY A;  3RR7 A;  1T9T A;  4URG A;  3HX9 A;  4DQI A;  1F9E B;  3HFK A;  3IR5 B;  2KJW A;  2OFH X;  2YNF A;  2KHC A;  4R0J A;  5DJB A;  2LMI A;  1Q8L A;  4AE5 A;  3SFG A;  3SQO P;  2CYY A;  2Z57 B;  2QGF B;  3K8V A;  4BBY A;  1Q8K A;  4LSN B;  1GFW B;  2C2O B;  2IM0 A;  3DHX A;  2H1Y A;  1IRQ A;  2YNI B;  3CF5 Q;  3TO8 A;  2UZA A;  3I9V 9;  3K0J A;  5CQG A;  1X5P A;  4U8Y A;  1U0H B;  1KD1 T;  5EWE A;  1OO0 B;  2BM0 A;  4PQU A;  1YJV A;  2R7R A;  2Z0G A;  4DR1 J;  3FBF A;  2AEF A;  4RR5 A;  1VJW A;  2RKI B;  1WTF A;  2IJN A;  3M2R B;  4URQ U;  3NNC A;  5EUH A;  1VLY A;  2VG6 B;  2COL A;  4N56 A;  2E1A A;  4U8V A;  1W26 A;  3S7R A;  1U1K A;  1XR6 A;  1RTJ A;  3UVJ B;  2MQO A;  1X4B A;  5BYS A;  8ATC B;  2R2S A;  4DV1 J;  1FJE B;  1HNV B;  4LQ9 A;  1GMW D;  2C3P A;  3CCE S;  4CLK A;  1EHW A;  5BJR A;  3V4I A;  4C2M A;  2OPQ A;  1VQ4 S;  4FVM A;  1TL7 B;  4Y00 A;  1DLO B;  1TVR B;  3Q89 A;  3PR5 B;  1YVF A;  2DR7 A;  1S1U A;  4M5D A;  5C24 B;  3R8Y A;  3LGM A;  2J6S A;  2A2D A;  2BAN B;  3C19 A;  2FVC A;  1BQM A;  4HEA 9;  4OJ3 A;  4I2Q A;  3FSI A;  2LDY A;  1N32 J;  2DNK A;  2K3K A;  1HR0 F;  4AAI A;  1XMQ F;  3PFE A;  4OMF G;  1FDB A;  3A3O B;  2M5Y A;  2B4P A;  3DU6 A;  1CC7 A;  1QTG A;  4BHQ A;  1LXJ A;  2DO0 A;  5K8P A;  4JI2 J;  2J0Q D;  5IWA F;  3QOQ A;  1EET B;  5A0Y B;  3V81 B;  4OLO A;  4DR6 J;  1B0P A;  2J9E A;  5HLF B;  1IKV A;  2ATL A;  1DFD A;  2YWF A;  2LQ5 A;  2Q1L A;  5HL7 Q;  3W9H A;  3KLI A;  3IFE A;  1IWG A;  4TU9 A;  1H38 A;  2QA4 S;  2HNY B;  1KOO A;  4YN3 B;  3UWT A;  4C97 A;  2V2V A;  2GQQ A;  1JLF B;  3MXH P;  1D1U A;  1FFS B;  3KK3 A;  1HNI B;  2FHO B;  2B9E A;  2I9S A;  3BO2 A;  4KR0 B;  1VRU A;  5GAE U;  2QN6 B;  2ZH5 A;  2IHR 1;  3L9Z A;  4DZD A;  1N8R T;  4B02 A;  2C42 A;  2G2Y A;  3KK2 B;  3KHR A;  4PXC A;  1T9Y A;  2PGC A;  1SKU B;  2B6A B;  4KH0 B;  3NO7 A;  1R8B A;  3KG1 A;  5EGY A;  1JB0 C;  4ER8 A;  5GAG I;  2CPD A;  3X1L B;  3AH6 A;  4ID5 A;  2VBZ A;  4B9N A;  3GJR B;  1K73 T;  3PEH A;  4QWE A;  2HBR B;  1LWX A;  4WTO B;  2MQ8 A;  2CAJ A;  4HL9 A;  3K5O A;  4XIU A;  4J9Q A;  3MDF A;  5F3T A;  2IY5 B;  2KM8 B;  4DR4 J;  4NYP A;  3CIZ A;  2LKZ A;  3FKB A;  4RNN A;  3RBX A;  4F0K A;  2HZA A;  2CJQ A;  3MM9 A;  3UW1 A;  5CA5 A;  1S76 D;  1AZS A;  4USW A;  1SQE A;  3FK4 A;  3C6U A;  5A8K B;  1RB0 A;  3QRR A;  3OR1 A;  4X66 F;  1EX8 A;  1JXL A;  2XCP A;  4PWU A;  3ISZ A;  3RB0 A;  1RT4 A;  5E7O B;  3R97 A;  3BQ2 A;  4LBH A;  1PGZ A;  2L9D A;  5HJX A;  4HI2 A;  5KG5 A;  4DL6 A;  4TVA B;  4LF4 F;  3J7Y I;  1ACM B;  5KT7 A;  1MW7 A;  2FVS A;  3ZZT A;  2OPP B;  4Z2X A;  4YUD A;  4C4W A;  2RHQ B;  3PW4 A;  1N5Y B;  5L46 A;  2J5A A;  4M5G A;  3JTO A;  3KKF A;  3U1N A;  4J9V A;  3UDC A;  5EX3 A;  2B7C B;  3RAM A;  3FUY A;  3UDE A;  3GZ7 A;  3LP1 A;  4NLU A;  3KDN A;  3V2U C;  4N47 A;  4HT7 A;  1RYR A;  2HEK A;  5E3P A;  2ZHB A;  3ET6 B;  3OTO F;  3R7B B;  2FTR A;  3ETO A;  1X4A A;  3UR3 C;  1U1M A;  4OI0 A;  5HP1 A;  4UF4 A;  2UUB J;  1FX4 A;  2JL9 A;  5KFD A;  3FEY B;  5CXT A;  4ZVT B;  1NK6 A;  4OHZ A;  2J9D E;  2P2C B;  5JUM A;  1RAH B;  4F2S A;  3BH6 B;  3WIV A;  4H4K A;  3I0S B;  3W65 A;  3NCP A;  1N5V A;  3MMB B;  4ZCK A;  1TTH B;  2U2F A;  4ENO A;  4OQJ A;  3QSY B;  3M32 A;  2E5G A;  4X4R A;  2D9O A;  5KFQ A;  2V4J B;  2Z2M A;  3PW0 A;  5CD4 A;  4C8O A;  4YB6 A;  1GMV A;  3ENW A;  5J2M B;  4LFB J;  1QUP A;  1UW4 A;  1KLM B;  4F26 A;  3NRB A;  4L3N A;  1RKJ A;  2BVZ A;  4DL3 A;  5H9F K;  3I0R B;  4FNI A;  5D4P A;  4JI8 F;  1Q78 A;  3CCZ A;  4YDX A;  3V6D A;  1RDR A;  3GYN A;  1UEU A;  1C4C A;  4FXV A;  4QWA A;  3TI0 A;  2F8E X;  3MCM A;  2U1A A;  5ETQ A;  3UN2 A;  1SVD A;  2PDA A;  4DJB A;  4USU A;  1JLQ B;  3TUJ C;  3M8Y A;  4PAB A;  3E3X A;  3N01 A;  1U1Q A;  5F8G A;  1F9F A;  4RW6 A;  1PYO B;  3M6W A;  2H65 B;  1RP5 A;  2DGO A;  5K8M A;  5L9N A;  1Q8B A;  1X9W A;  1VQ8 S;  1RT2 A;  5KT2 A;  3BR8 A;  2B9Y A;  1URN A;  3IM8 A;  5D78 A;  2QC3 A;  2YNG A;  1SJ4 P;  2HFZ A;  3ZO7 A;  4HTI A;  3M4X A;  5D0E A;  4HH1 A;  4CTA B;  1UZD A;  2CQ4 A;  3IGN A;  2EI5 A;  3IBC B;  4QR2 A;  4P2S A;  4NA2 A;  4DV3 F;  3IR6 B;  1YHQ S;  1TKZ A;  2JLE A;  2IC3 A;  3U27 A;  4OV6 A;  2PN6 A;  3I6P A;  2QL9 B;  3M2V A;  3KLE B;  3RUB L;  1IKY B;  1VIO A;  5E2Q A;  1BY9 A;  2GHW A;  2XUL A;  3MOJ B;  5DZ6 A;  4X4Q A;  1KTQ A;  1FJ7 A;  2HUR A;  5HN0 A;  4U67 Q;  5M2R A;  1Y9O A;  2YKA A;  3MPV A;  2RH3 A;  4KGX B;  3JSR A;  1KQG B;  4GVL A;  3ZZY A;  4QCL A;  2RS8 A;  4QPT A;  1JK9 B;  1VIS A;  4R8U B;  4PWW A;  2V5H G;  4YQW A;  2RB7 A;  1H2T Z;  1TZ0 A;  2DXE A;  2ZH1 A;  3H8Y A;  1K47 A;  2IAJ B;  1NLA A;  3CJK B;  3SSQ A;  3HVT B;  2UU9 F;  3I4H X;  3M8W A;  1U02 A;  1J2V A;  1UP1 A;  5EX0 A;  1ZS6 A;  2W7O A;  1RTI A;  2DBB A;  1S0N A;  4ZN1 A;  2DNG A;  2JLF A;  2RU3 A;  2RJZ A;  4ECS A;  1RWO B;  1UTA A;  5E33 A;  3OLB A;  4CIO A;  3PTW A;  4IOA Q;  9RUB A;  2JXH A;  2QO3 A;  5F8J A;  3G8Q A;  3O5T B;  3A1Y G;  4I4B A;  4ZHR A;  2WB1 D;  1CJU B;  4NLT A;  4LSL A;  1K8A T;  1E6Y A;  4ZVP B;  3AJD A;  4C0B A;  4OZJ A;  2CPX A;  1NSK L;  3G4S S;  3P4U B;  4PG7 A;  1VS3 A;  4RU2 A;  2F4V J;  3FSX A;  1V5V A;  1SH0 A;  2FLP A;  2NPI A;  1QAJ A;  3WC0 A;  5ETT A;  3QSI A;  4H4M B;  1M5O C;  4DX8 H;  4HV0 A;  3PKM A;  1F2H A;  1OMS A;  1FNX H;  2RNE A;  2FIU A;  3ZXW A;  2CG4 A;  2XMV A;  1ARR A;  5DDO C;  4IO9 Q;  2QSF A;  1WKK A;  3E8O A;  3F0N A;  1YRT A;  3OFG A;  4F4K A;  4ZLP A;  2DXD A;  5B7W A;  3ITH B;  4WIQ A;  3CC2 S;  4ZLJ A;  3CMA S;  2E7V A;  1G4C A;  2G4B A;  4RW9 B;  2XNR A;  3S01 A;  3QGP A;  2ZD1 A;  4LQ3 A;  3M2U A;  2WSC C;  3OTE A;  3HHE A;  4CP5 A;  3OFH A;  5RUB A;  3K5L A;  1RUS A;  3J7Z T;  1IR2 A;  1DQ8 A;  1MN7 A;  2KFZ A;  3W2W A;  5LL6 d;  3BYP A;  4NXN F;  3Q22 A;  3GMG A;  2YX7 A;  3IBF B;  4DX5 A;  3ZTQ A;  5DDP C;  3LQV A;  5HSP A;  2Y1L B;  3RBD A;  2HYI B;  1P9Y A;  1MU2 B;  4ZPD A;  2VBW A;  4IFY B;  3JAM Y;  1PBA A;  2QV6 A;  1TV6 B;  2PFF B;  1KSP A;  4FS2 A;  2DYA A;  1UJ5 A;  4N77 A;  2WVB A;  2WVC A;  1H3D A;  2WOM B;  1DTQ A;  1FWP A;  4JV2 A;  3LP2 A;  4U9R A;  2ROE A;  4RBT A;  4KGM A;  3THV A;  4IOC Q;  1QDU B;  4PXE A;  4S0M A;  3OD2 A;  3CED A;  1YBT A;  4MIA A;  2J7W A;  2KB2 A;  2Q43 A;  4DU8 A;  4F0M A;  2B9W A;  2P9E A;  4Q0B B;  2BRL A;  2RQM A;  1U2F A;  2VA3 A;  5C5J A;  2JVR A;  3J7Z 5;  1RHM B;  3OFE A;  3Q24 A;  3G71 S;  1OY9 A;  2DCU B;  2FHJ A;  4Q5V A;  1IJF B;  4HHH A;  3QGG A;  5FD1 A;  3C46 A;  3TZW A;  2W9C A;  2C3O A;  2FVQ A;  1Y7P A;  2XZT B;  5GVQ A;  3CO9 A;  1GEH A;  4BLG A;  2ASD A;  4LF1 A;  2AWZ A;  2BEF A;  3DOL B;  1LK7 A;  1NXI A;  3W60 A;  2JEJ A;  2HHH J;  2QMW A;  4LF6 F;  3HSG A;  2GFF A;  1YIJ S;  4HHU A;  4I7F B;  1QE1 B;  1T7P A;  2YX1 A;  2DNP A;  1LWE B;  2OEK A;  4LRE A;  3B78 A;  4C0H A;  3QO9 B;  4CT9 A;  2XY7 A;  3TAQ A;  2A18 A;  2XS7 A;  5E5N A;  4F3O A;  1FXR A;  1NO8 A;  4G3I A;  1UVL A;  5A8W B;  3BDE A;  3UDL A;  3GIL A;  3D1H A;  3T1Y J;  1LW0 A;  3DGP A;  2CPI A;  4ZPW R;  5B0E A;  5A6W A;  4FPR A;  3KYL A;  3EUN A;  2UXB F;  4M8L A;  5F8I A;  1CEZ A;  3NGK A;  1RAB B;  1WI8 A;  4X84 A;  3BRE A;  3T5L A;  2IVF B;  5J2P A;  3BM7 A;  2BAC A;  3L7P A;  2I2Y A;  3JQK A;  4ZIT A;  2HVZ A;  1N48 A;  1UPP A;  5A2Q Y;  1NH8 A;  2ZM6 F;  2C22 A;  5KFR A;  2Q6B A;  2HSE B;  4LUB A;  1U47 A;  1I94 F;  1C1B A;  2IMW P;  3C8Y A;  2HGL A;  2NS1 B;  5DLF A;  4NA3 A;  2C2D A;  4ALZ A;  2FZC B;  2N4D A;  1M5V C;  3UQS A;  1A9N B;  3A3P B;  1WC5 A;  3JQM A;  4RNM A;  1VQ7 S;  3R9L A;  3D3B J;  1SQG A;  5IZH A;  3MMC A;  3QT5 A;  4ZP6 A;  4CRJ A;  4KTQ A;  4K4T A;  5E0O A;  4EFA C;  3ENA A;  1TUG B;  2QL5 B;  3QIP A;  1EAR A;  2W01 A;  4RW4 B;  1RT1 A;  4KFB B;  1WC1 A;  3GJQ B;  2MJU A;  8AT1 B;  3CCQ S;  2DIS A;  4TYA A;  2ZOG A;  2E1R A;  3Q86 A;  4U7U K;  4DV7 F;  3G2X A;  4P7V A;  1CC8 A;  2Z2L A;  1FJG F;  5B0F A;  5I3Q A;  3P5B P;  4HH0 A;  3AJ1 A;  4OZ3 A;  3FMB A;  4WYL A;  3P5T L;  1UEK A;  3K2Y A;  3POT A;  1RAG B;  3H59 A;  2RS2 A;  5FDL B;  5KG1 A;  2BKP A;  2DO4 A;  3T9N A;  5KFY A;  3RRG A;  4N5S A;  1HAR A;  2JWN A;  1VGY A;  4LF8 J;  1N4L A;  4A8K A;  4J9U E;  1QJH A;  2LEC A;  4CO4 A;  3DI6 A;  2ZZM A;  3BSA A;  1O5J A;  4H4O B;  4MMO A;  1HQE A;  5A2Q U;  2GZO A;  3BF4 A;  5D0G A;  1V3S A;  2NXN A;  2QE5 A;  1X4E A;  1MRO B;  3IG1 A;  2O5D A;  1REV B;  1HBN A;  3WX4 A;  1ZPV A;  3PJ9 A;  3PV8 A;  1FRH A;  3CCL S;  1UFW A;  1NJW A;  3N6L A;  3PX0 A;  2VJU A;  4KE5 A;  2R7O A;  1B0V A;  2LLZ A;  1P8G A;  1VCT A;  2MZS A;  3KLH B;  4ATN A;  4LIW A;  2AD9 A;  3FMT A;  1JKH B;  4ZA1 A;  2JSX A;  4OYI A;  3CC4 S;  3ZZ0 A;  3SEO A;  3D6T B;  2FQQ B;  1U1P A;  3HPO A;  1AFJ A;  2FZG B;  4DFM A;  4PG4 A;  3VQT A;  4CLS A;  5IV4 A;  1JLC A;  1DZ5 A;  5FLX U;  1OYE A;  1FRX A;  1YZ7 A;  2HHW A;  1S5Z A;  3M1V A;  1RHK B;  2VU5 A;  2R8K A;  2Q2K A;  4DL5 A;  3AXK A;  2R7Q A;  2B8Q A;  3HO1 A;  4FKX A;  4JP8 A;  3EZO A;  3CDB A;  4F4X A;  3TAM A;  2JXG A;  4B3T J;  4KO0 A;  3EWG A;  3W63 A;  4JV5 F;  6FDR A;  1OSC A;  1IBL J;  2KOE A;  2JXI A;  2XI3 A;  1U4B A;  1GT8 A;  1BHN A;  1H72 C;  1SIW B;  2CNL B;  3O6Q A;  4LIR A;  1BWV A;  1DY3 A;  4KGV B;  1YBA A;  1Q53 A;  2P6T A;  2YKN B;  5J2N A;  3GFH A;  1TP7 A;  3KJV B;  1G3O A;  2CPE A;  3HKZ D;  3H5X A;  4UY8 T;  2EBG A;  1WEX A;  2ZH8 A;  2G2O A;  1PAE X;  2PT0 A;  2DH8 A;  3NEK A;  4HDG A;  2AGP A;  3DRY A;  4PR6 A;  5CD4 H;  4FXE A;  4ZLL A;  1X0P A;  4CYU B;  1GX6 A;  5LOQ A;  3P3D A;  4PRF A;  4OI1 A;  4L74 A;  2AJQ A;  1HW9 A;  1W2B R;  3HHL D;  4FPI A;  3HFZ B;  3M6X A;  3E51 A;  3DLJ A;  4YHH F;  3GON A;  1KHW A;  4O4G B;  2ADC A;  2CRL A;  5B0A A;  4IRC A;  1WHX A;  3EGZ A;  2DNL A;  1RWX B;  1UEV A;  2RAQ A;  2AMC B;  3RW6 A;  1AB8 A;  4NZ6 A;  3F44 A;  3RAQ A;  3BGU A;  4NRT A;  2XMW A;  3DCA A;  2RDI A;  1UET A;  4ZJQ A;  1WOO A;  1RAJ A;  2NR0 A;  2BRK A;  2K6L A;  5EDW A;  2ZJR Q;  2KM8 C;  1SV5 B;  4U7U D;  3NBP B;  1CJV A;  2DGQ A;  3MAA B;  4UY8 5;  2MQQ A;  4OX6 A;  5F8H A;  3ZTO A;  3HM9 A;  5BR8 F;  4NMX A;  1JLE B;  4O3P A;  1WDT A;  1EB0 A;  4ED3 A;  5K8N A;  3FT7 A;  4F0H A;  1H2V Z;  2XMM A;  2BA3 A;  2OLW A;  3DLE A;  4X65 J;  3G8T A;  3THT A;  1TL3 A;  2NQP A;  3JYT A;  1XR7 A;  5ITH A;  2JLG A;  3PX4 A;  2MKS A;  4Z37 A;  4NCA A;  2VPY B;  2DGT A;  2UUW A;  5T41 A;  3HXM A;  1OHN A;  3I4P A;  1S1T B;  1R0A A;  1VK3 A;  2R7S A;  4QYZ J;  3G86 A;  1RTH B;  2HRU A;  2NUH A;  3MM5 A;  1TKT A;  1WF1 A;  4O0I A;  4HYK A;  4CO1 A;  2NPF A;  1VQM S;  3PIP Q;  2ZVS A;  8RUC A;  4UOG A;  3ZTR A;  5J1N A;  3VAF A;  3V6H A;  2VC0 A;  3D1O A;  3HK2 A;  1UWB A;  4F25 A;  4DSF A;  4ZK7 M;  1AUS L;  2UUC J;  2B4O A;  2RBF A;  5HQL A;  4IG3 B;  3KWM A;  2OPS A;  3Q23 A;  2UVU A;  4RO0 A;  2RRA A;  1Y5I B;  1T3O A;  2VV5 A;  2DY9 A;  1R8A A;  4JI6 F;  2GHV C;  5DRK A;  1RE1 B;  4Y2C A;  1FXL A;  2HK3 A;  1ZM4 A;  3T1H J;  4OFZ A;  2G0C A;  2BE2 A;  2HLU A;  4KV8 A;  4PZV A;  4U96 A;  2EWH A;  2AJ4 A;  2Y3Y A;  3DLH A;  1R8P A;  4JI0 J;  1LQ9 A;  1ZZF A;  1AW0 A;  1JLA B;  2LCW A;  2RML A;  5J1E B;  2HPU A;  3CD7 A;  4QIV A;  4ZPT R;  4PWD B;  1E6V A;  1LOU A;  3BO4 A;  1XMO F;  5DDQ C;  3SSS A;  2RSQ A;  3HJF A;  5MAO A;  1RT3 B;  1NDP A;  4KC5 A;  1WAC A;  1X93 A;  2UUA J;  2GJ2 A;  2VIH A;  3P6Y C;  3FVY A;  2HFN A;  2YXL A;  5HAN A;  2QA1 A;  4RW7 A;  3QYY A;  2W8L A;  2Y8Y A;  1VBZ A;  1QAI A;  3BQ1 A;  2WCX A;  2CG8 A;  4QPX A;  1V5I B;  4Y3C A;  2MST A;  1FT8 A;  4IR9 A;  3TAN A;  3FFI A;  2ZZT A;  1PCA A;  1C1C A;  3ELH A;  1IM4 A;  4ZVF A;  4ZPB A;  3DRX A;  3FNN A;  2AGO A;  1XIQ A;  2Z2Y B;  5KFC A;  3LWL A;  2HQI A;  3C16 B;  4KJI A;  1RT5 B;  1AA1 B;  1HNX F;  3NNH A;  1T94 A;  1RTD A;  4C8K A;  2ZUA A;  3N79 A;  2XO6 A;  3SBM A;  1ZM2 A;  2E7X A;  2B5J A;  2BJ3 A;  5AJ3 F;  3TRG A;  2X3G A;  2CJ9 A;  1FKO A;  3OXL A;  4DL2 A;  2IFX A;  4WWS A;  4WFY A;  1FJC A;  2BOA A;  4RNO A;  1RBA A;  4PYA A;  4HI1 A;  4NPO A;  2R2R A;  1S6P B;  2KXN B;  5D3G A;  4JYA J;  3MM7 A;  1FNO A;  5LMU J;  3QLH A;  2AYB A;  2FVP A;  3F41 A;  1OS5 A;  2WRM A;  4J90 A;  4ERD A;  3PKY A;  2E9Z A;  2AEJ A;  2DRB A;  1OPI A;  5IM0 A;  4DEZ A;  3QBC A;  4LF7 F;  2OTJ S;  4MJK A;  2JFK A;  1XR5 A;  4EU0 A;  4DOZ A;  1IBM J;  1GXT A;  3HVR A;  3Q8R B;  4DV2 F;  2YNI A;  1EQM A;  5ETK A;  3W61 A;  2N7C A;  2VF3 A;  3DRS A;  4TQR A;  4R0E A;  3DRR A;  1JJC B;  4JI4 F;  4Q8F A;  2YBV A;  1ZAV A;  1U0H A;  2AN7 A;  1M1H A;  2PO4 A;  3RGI A;  1NKE A;  1W2I A;  2FVR A;  3D6M B;  5LSR A;  2LQB A;  2OUG A;  1FTC A;  2WVD A;  3AA8 A;  2XS5 A;  3CCU S;  2E44 A;  5KFX A;  4RUB A;  4TYB A;  4A8M P;  1WC6 A;  3VGU A;  4DFP A;  4KKO B;  2H3E B;  3FEX B;  1ITP A;  1HPZ A;  1W7W A;  1VDH A;  1SIZ A;  1J5O B;  3ADA C;  1U45 A;  2BBE A;  1SC3 B;  3KK1 A;  1WKJ A;  3MMA A;  3JSB A;  1HNW F;  4JI3 F;  3R7N B;  3F56 A;  4Z7C A;  2BNZ A;  2VUG A;  1EZZ B;  2VIC A;  3HHL B;  3BKU A;  3MUV P;  1ROF A;  2P9G A;  3TUZ C;  3MEG B;  1SB6 A;  3GQC A;  1TVR A;  3LF0 A;  3MEC B;  1MMD A;  1XC9 A;  4IH7 A;  3JTP A;  3P49 B;  1U24 A;  4KIA A;  1UPM B;  3CDE A;  2JHE A;  2CQI A;  2G1D A;  4JI7 F;  2XHW A;  3J81 U;  3SQG B;  2F5G A;  3SDE A;  2OH2 A;  3HKW A;  3NP5 A;  2XY6 A;  3R1H A;  1BQX A;  5HMZ A;  1Q82 T;  1VBX A;  4C6A A;  2X51 A;  4O23 A;  4O3N A;  5D0R A;  4LF2 A;  2J7K A;  4F4Z A;  1VQN S;  2C3Y A;  2GPE A;  4YR3 A;  2KO1 A;  3C66 A;  2R42 A;  1S79 A;  4OI4 A;  2XLI A;  3OL7 A;  1SKW A;  4X62 F;  4P7T A;  3JSM B;  2VFT A;  3CWJ A;  1B01 A;  4LF9 F;  2ERR A;  4K4Y A;  2IBO A;  2GIF A;  4DPY A;  1PSD A;  2A6M A;  4LMZ A;  3MEK A;  5G0R B;  3BO3 A;  3QMQ A;  4DU7 A;  4XDD A;  4ZVS B;  1TKX A;  3VW4 A;  2CQB A;  1SJQ A;  4DUZ F;  1TR0 A;  3KOA A;  1UFK A;  1HNI A;  5KFL A;  1LEO A;  3D6H B;  1RJJ A;  2GMH A;  1JJH A;  1OSD A;  4U6P A;  1JNR B;  1VC0 A;  4WBF A;  2KZZ A;  3NXZ A;  1RWK B;  3GFX A;  5CYJ A;  5HAO A;  1XNQ J;  2P8I A;  2B6A A;  2VON A;  2FHK A;  1RWM B;  3Q8P B;  3GPA A;  2LA4 A;  3JSY A;  2CWK A;  2YKP A;  2HK2 A;  2ADB A;  2FJD B;  1NK9 A;  1N88 A;  5KT6 A;  1DAX A;  1XQI A;  2W4P A;  1NAQ A;  1Y11 A;  4JBC A;  3DLG A;  5CCL A;  1JXV A;  4F04 B;  5CHC B;  4NI2 B;  4TNO A;  4K4Z A;  1HBU B;  4C11 B;  2B7B B;  4OZL A;  1PAR A;  2LP4 A;  1ZA1 B;  2JJ4 D;  3D6F B;  4NLR A;  2V2Z A;  1RU1 A;  3I32 A;  2RUG A;  4NXM F;  1KON A;  1FDA A;  2E7W A;  3DRP A;  1KVK A;  2H5E A;  4KBI A;  2MB0 B;  1ZA2 B;  3PYE A;  1TQL A;  4KPY A;  4YS2 A;  1P9Q C;  2XWX A;  1NKC A;  4LFC F;  4LVN P;  2QIF A;  2Q6C A;  4I64 A;  5IS2 A;  4L76 A;  2MQL A;  2G0J A;  1HMV A;  4URS A;  4RZR A;  4KY3 A;  3R6L B;  3EE3 A;  4DBQ A;  4K2X A;  5I3P A;  1BQN B;  4GC7 A;  2DNR A;  3MR6 A;  4A47 A;  2ZUG A;  7FDR A;  3EVW A;  1PG5 B;  3EGW B;  1CJT B;  5M2P A;  2VHG A;  1DBD A;  3G6Y A;  2HWH A;  3AAW B;  3CB4 A;  1REG X;  2IA0 A;  4LR8 A;  1M1G A;  1FKP B;  4LRC A;  5KFS A;  2JEI A;  3GYG A;  3OR2 A;  1KRP A;  4YB7 A;  4NCG B;  2VQF J;  4WTY A;  3OBI A;  1S10 A;  5KFP A;  1FD2 A;  4GMK A;  4DL0 C;  3L4B C;  4ETZ A;  1IKX B;  4P52 A;  1YBU A;  3BBF A;  4M5H A;  4ED4 A;  2WBM A;  2B4V A;  3W8G A;  2Z30 B;  2M8H A;  3PJW A;  3JTN A;  1HBO B;  2A2B A;  3M9M B;  2CPZ A;  3NCR A;  4ZIV A;  6FD1 A;  1HR0 J;  1P27 B;  4P72 A;  1XMQ J;  4RLE A;  2GAH C;  2W2O P;  1BLU A;  1S9E A;  3C15 A;  4QU7 A;  2FGO A;  4RUC A;  2KG0 A;  3W9J A;  2HG4 A;  5IWA J;  4NLV A;  4G1Q A;  4ZVE A;  5KT5 A;  4ECV A;  1MWZ A;  1FKA F;  3MFI A;  3OT9 A;  2J9C A;  3BYR A;  2OKQ A;  3V5R A;  3HHK A;  5LSO A;  2EFP A;  2L48 A;  2W1B A;  2J0S D;  1TAQ A;  4ZS6 A;  2R7W A;  3H2L A;  3E01 B;  2Y0S D;  3PIO Q;  3LP0 B;  2VOD A;  3K17 A;  2MQP A;  1KP6 A;  5KFU A;  2WB4 A;  2MKY A;  4DPU A;  4FF4 A;  5AXL A;  3GIR A;  4JV0 A;  1AUD A;  4I69 A;  2UVR A;  4RWW A;  2YNF B;  5A8R A;  3SCL E;  4CLT A;  1FEE A;  2A10 A;  1HD1 A;  2QA2 A;  5C2C A;  3BH7 B;  5T7L A;  3GE9 A;  3AOC A;  4ZVR B;  3I0R A;  1N36 F;  2HHS A;  4J9K A;  2NXC A;  3PJX A;  2F1F A;  2DNZ A;  2IPO B;  3DXB A;  4I2P A;  3U1L A;  3LGH A;  3IP0 A;  1H7W A;  4GKJ F;  1CVJ A;  4DMZ A;  3OXG A;  3OVS A;  1NK0 A;  1Y4Z B;  2PI4 A;  2J76 E;  1DTT A;  5B0C A;  2BOP A;  1RAF B;  1RSC A;  2FJE B;  1RTJ B;  1BUX A;  5I42 B;  2DIT A;  1D9F A;  1GMW A;  4DSJ A;  4X66 J;  4FYY B;  3THP A;  2W9A A;  4C8Y A;  2R7T A;  4NE9 C;  4WYW A;  4F2R A;  3W5Y A;  4HR2 A;  1R7I A;  5L9X A;  3PYD A;  3V4I B;  3MM6 A;  2OPQ B;  3LOU A;  1LWC B;  2ABY A;  1BE4 A;  1RAA B;  4CTA A;  1S49 A;  1VQK S;  3UD5 A;  4LF4 J;  4WP9 A;  2KN4 A;  1S1U B;  4M5D B;  3O3L A;  4XK8 C;  3H5S A;  1NND A;  1EA4 A;  4CM0 A;  1BXN A;  1S4F A;  3VTI A;  3PO4 A;  1L5U A;  4Q2L A;  4I2Q B;  2CQC A;  3HI9 A;  3FC9 A;  2BX6 A;  2H9Z A;  3CCT A;  4DHV A;  1SJF A;  3Q0A A;  4F4Y A;  2KRB A;  1HBM A;  4K5S A;  1FF2 A;  1H2U X;  1S0V A;  4B9M A;  2AX0 A;  4QJV A;  1C0U A;  3D0G E;  2DPJ A;  3ZTS A;  4ED5 A;  4MKA A;  1BMQ B;  3G6E S;  2HVH A;  3PY8 A;  5CCM A;  3OTO J;  3GCW P;  3KLI B;  3UR0 A;  2E66 A;  4AL5 A;  2BMB A;  3C6T B;  2UXC F;  3BKT A;  2HHX A;  2VDH A;  1T0T V;  1OPZ A;  2Z56 B;  3QPI A;  1QLN A;  1R0B G;  3IGV A;  3AY0 A;  1WF0 A;  1BGX T;  2JH3 A;  4W98 A;  1Y5L B;  1IR0 A;  3MAQ A;  3KK3 B;  1VMB A;  1BDT A;  1VRU B;  4J9S A;  2GS8 A;  2GCF A;  1NPP A;  4RNH A;  3JB9 k;  5GAG U;  5F0U A;  4EGL A;  3BB5 A;  1J27 A;  2MQM A;  3QFW A;  1PYS B;  2D74 B;  1C4A A;  2APO A;  1EKR A;  4V1A k;  1RT6 A;  1D09 B;  2X7I A;  2XMU A;  1EAY C;  3M8P A;  3U1M A;  4J5O A;  4OHW A;  3PW5 A;  1NHU A;  3M9O B;  4ID5 B;  3PYF A;  4HHJ A;  4QYR A;  1JJ4 A;  1UVJ A;  3UPF A;  1FDD A;  3HVA A;  4LRV A;  1FE4 A;  4G6V B;  3W5X A;  3L7U A;  2YWG A;  1YZ6 A;  2MKH A;  2ASJ A;  2J0W A;  2BM1 A;  2YKM B;  2HMI B;  3NWR A;  4JI8 J;  5BYQ A;  1R31 A;  4MJW A;  5KG2 A;  3MM9 B;  1HNZ F;  2XBP A;  1V3R A;  1LKZ A;  3C6U B;  3TZY A;  1Q5Y A;  3H25 A;  3TUP A;  2AJ1 A;  2ZNZ A;  5KFZ A;  4EYI B;  4K0K F;  4DR5 F;  1RT4 B;  1FNM A;  5IV3 A;  4MTP A;  2EVZ A;  2IRU A;  4DR2 F;  3JXO A;  2MZQ A;  5EWF A;  2HHT A;  1FHT A;  4JUZ A;  3MPW A;  4P9S A;  1WD6 A;  1QVG R;  3SCK E;  1R89 A;  4RWX A;  4NEZ A;  4OZ0 A;  1FK9 A;  3J80 Y;  1R6Y A;  3H2U B;  4KB7 A;  5IC4 B;  5K14 A;  1L3S A;  4BDP A;  1S7H A;  1MYK A;  3TQ1 A;  4UW2 A;  1N5Q A;  4KHM A;  1JX4 A;  2QJ3 A;  1T9W A;  4X64 F;  1F5B A;  3D4J A;  3JS9 A;  3LP1 B;  3VZH A;  4D3H A;  5D15 A;  4PG5 A;  1U7L A;  1VR6 A;  4CLF A;  4DV3 J;  1RHR B;  4ZCM A;  1N5T A;  2GVD A;  3DGV A;  4DG1 B;  5DET A;  1U1N A;  2FJX A;  1U6F A;  1FRM A;  5ETN A;  4ES3 A;  2V50 A;  3SFU A;  3UNG C;  5HP1 B;  2CKW A;  4D3G A;  1A6L A;  2UP1 A;  1X5O A;  4ELT A;  5EHH A;  2AU0 A;  4AL6 A;  2QLW A;  1RHQ B;  2IRY A;  2F40 A;  3UN3 A;  1Q79 A;  4ECQ A;  2V9W A;  5C25 A;  3OL8 A;  2V4R A;  1S72 S;  3AD8 C;  5HAT A;  1VK8 A;  1KS2 A;  1CS4 A;  2ZOM A;  2UU9 J;  3ZNJ 1;  3W66 A;  2I8E A;  1X4F A;  3P8B B;  4A8S A;  3M32 B;  5C42 A;  4DSE A;  3GJT B;  2WK4 A;  2J8A A;  3OXF A;  1HI0 P;  4TY9 A;  4M5I A;  4YDD B;  1WUU A;  2ZH2 A;  3J81 j;  2XMJ A;  2R7V A;  2R7X A;  4DX6 A;  1S1X A;  4IQM A;  2MLY A;  4A8Q A;  3V6D B;  3OJS A;  2IA6 A;  2GJI A;  3BPD A;  2WSF C;  2XSJ B;  1RHU B;  3K8W A;  2V2Q A;  4WFZ A;  2KKE A;  4Q8E A;  5DGA A;  1H7X A;  2LXI A;  1S1V A;  4D8J A;  2QSW A;  1ZM9 A;  1KC8 T;  2AGQ A;  1T8E A;  4C7Q A;  3IC1 A;  1I6J A;  3VAM A;  1TL1 B;  2BJ8 A;  2ZH3 A;  4P74 A;  4C8Z A;  2M8D B;  3VGV A;  4KGK A;  2HRY A;  3VAH A;  5JJB A;  3LAM A;  2QG9 B;  2QX0 A;  4M5N A;  1TK0 A;  4RUH A;  4DR3 F;  4RW6 B;  4AXJ A;  1QSY A;  3MD1 A;  3MR7 A;  4M5M A;  1RT2 B;  1IBK F;  1DQ9 A;  5ETO A;  1TFY A;  2VAS A;  4R5P A;  3HLU A;  2DIV A;  2YNG B;  1KLN A;  2ACY A;  2WON A;  1QSS A;  4USM A;  2XG8 A;  4WFX A;  3ILI A;  3EXC X;  2OI2 A;  2QMU B;  1TKZ B;  1URR A;  2VZ9 A;  3MEE A;  3AA9 A;  3JQJ A;  4KPC A;  4FYW B;  2K7K A;  1Q7Y T;  1RAI B;  4FN5 A;  2F4F A;  3I5A A;  1N0U A;  2N7Y A;  4WJB A;  2VBX A;  3NG8 A;  4NXN J;  1QM9 A;  1N33 F;  2NZ4 A;  2DGU A;  2LYV A;  5KFW A;  3LH2 S;  1LWF B;  4QYZ K;  1SI9 A;  2R2T A;  2SXL A;  2RUS A;  2MKK A;  1P94 A;  2B3T B;  1XJW B;  3DLK B;  2K3I A;  2OGU A;  4G1P A;  3KUH A;  2J7U A;  5CZX A;  2DR8 A;  4DV4 F;  2N4C A;  4USJ C;  3J7A 1;  5J1P A;  4CZC A;  4CO5 A;  1RTI B;  3A8E A;  2IDL A;  1U8W A;  1HI1 A;  2OO4 A;  3PO5 A;  3MCN A;  4K4X A;  4ZOS A;  2DXF A;  3PM9 A;  5F8L A;  2JDJ A;  4TY8 A;  4P6Q A;  2R8G A;  2E1M C;  2KXH A;  4NLX A;  3ZTP A;  1WG4 A;  1Z2L A;  5DM6 Q;  1YJN S;  3EZU A;  2KKH A;  2D69 A;  2YX4 A;  2LA6 A;  2FJW A;  4BCA A;  4LSL B;  1SJ1 A;  5U47 A;  1ZZN A;  3TZZ A;  1X9M A;  3T41 A;  3I5C A;  4AFF A;  3OTC A;  2HFV A;  3CGI A;  1E6Y B;  2GA7 A;  4GKK F;  3CUL A;  4QBU A;  3EZ5 A;  1UJ6 A;  2HNZ A;  5L8R C;  1EQ0 A;  1EIY B;  3MCO A;  2AYE A;  3MPD A;  4L75 A;  2Y1I A;  4CCH A;  2GGP A;  2ZC3 A;  1D0E A;  4LJM A;  1S6U A;  1FVQ A;  1HKA A;  3HHL C;  2WAQ D;  1MWY A;  4LF6 J;  1R8H A;  1SC1 B;  3K89 A;  2NCK L;  3C2P A;  2VKZ G;  3T6J A;  2FHM A;  2FY8 A;  3GSD A;  3IMQ J;  1Q16 A;  1IKW A;  1GXU A;  4DV5 F;  3MFH A;  2W7P A;  4I6Y A;  2LVW A;  1KEK A;  1WG1 A;  2PMH A;  3KUG A;  2ZBP A;  4ZJO A;  2PMW A;  3I56 S;  4JV1 A;  5B0B A;  1KBR A;  3IO1 A;  3TA0 A;  1Q4R A;  2VFU A;  3N6M A;  2KEL A;  2VPW B;  2UXB J;  3CJ3 A;  4CH0 S;  1RBL A;  1UL3 A;  4IDK A;  3LGN A;  1QSL A;  1VBY A;  2RF2 B;  4AYB D;  1YJU A;  2JX2 A;  3FZ2 A;  2ZD1 B;  5A6P A;  4ED7 A;  5KG6 A;  2I38 A;  5DG7 A;  4YY3 F;  1F5A A;  3MI7 X;  2YQ3 A;  2ZM6 J;  1UVK A;  3H5Y A;  4Y2I A;  3Q8Q B;  4RU9 A;  1H6K X;  2WW8 A;  4KSE B;  2HAF A;  5HQ8 A;  3A12 A;  1I94 J;  1YG0 A;  2OEJ A;  2YKN A;  4OYM A;  1WC4 A;  3TX0 A;  1X8D A;  1RAD B;  1U6Z A;  1MLA A;  2A2C A;  5T14 A;  2ACM A;  2FD2 A;  4CDI A;  4KRW A;  2BJ9 A;  1Y5N B;  3ICL A;  3PHT A;  4LR7 A;  5HBM A;  5I4M A;  2CPY A;  1NBE B;  2DEI A;  2OD6 A;  3PEJ A;  3CD0 A;  4PYD A;  2XC9 A;  1LK5 A;  1DTQ B;  5HI7 A;  3LP2 B;  1KKH A;  1YWX A;  5DG9 A;  3D5M A;  2CDQ A;  3NOC A;  4J9L A;  4QWD A;  4Y6I A;  2OP5 A;  3BSN A;  2K1R A;  4DV7 J;  4DFK A;  1FJG J;  4A8W A;  2Y9H A;  5C7P A;  3US5 A;  2N3O A;  3VQS A;  1VIX A;  5DLG A;  2YPZ A;  2AIR B;  4NLP A;  3ZZU A;  3R7S B;  3TAP A;  1VC6 A;  2FLL A;  3NGU A;  2LEP A;  1F1B B;  3CDW A;  2MDA A;  2F3J A;  2RIL A;  4I56 A;  4CLZ A;  2ZH9 A;  1WSR A;  1SJ3 P;  3MAA A;  3TA2 A;  2W9C B;  1U2C A;  6AT1 B;  3BGF A;  4Q45 A;  1JLE A;  3M8Q A;  7AT1 B;  3TQE A;  1DAR A;  4E8U A;  5H9E K;  4NYZ A;  2DHH A;  1RIS A;  4K7Q A;  3KHG A;  3G82 B;  4IRD A;  3CIM A;  3H40 A;  2GO9 A;  5JVG Q;  2HAI A;  2UXD F;  2P6S A;  3FQL A;  3GIK A;  3H4B A;  2W9B A;  2PE8 A;  1M5H A;  5IFM A;  4NCB A;  2R9L A;  5DGB A;  1B7F A;  3Q8U A;  5F3Z A;  3QID A;  4A4J A;  1LW0 B;  3DGP B;  1UAW A;  2MZR A;  2CQD A;  2EKN A;  4IKA A;  3PZP A;  1N34 F;  4OYB A;  1RTH A;  2O67 A;  3ONQ A;  3VAG A;  5J2P B;  2DGX A;  4KHP F;  2CZV C;  2E5L F;  3DU5 A;  1PJ5 A;  1WOR A;  3TJA A;  2HHQ A;  2XHC A;  1D8Y A;  4ETX A;  5DQG A;  1KR4 A;  2M4M A;  1C1B B;  2FC9 A;  1YTY A;  3SYZ A;  4W92 B;  4F4W A;  4JV5 J;  3OFF A;  4PUO A;  4F3M A;  3OQ2 A;  1Q1K A;  1U2R A;  3VAK A;  4PXD A;  2GO8 A;  2KZM A;  1ICE B;  2OJ3 A;  1NH7 A;  1PBU A;  2K2P A;  1F60 B;  1MN9 A;  1NK4 A;  2YNH A;  1U9P A;  2M2B A;  2X3D A;  3MTJ A;  2Y1R I;  1NHK L;  3QIP B;  5J1E A;  5ETP A;  1WSV A;  3LAK A;  3UE2 A;  3CCV S;  1NSA A;  4F8R A;  3DOM A;  2H5I B;  4DSI A;  2J6T A;  1KTV A;  3KJN B;  5HRO B;  2QA4 G;  3B82 A;  3WZ0 A;  3PR4 A;  1VRT A;  1VC5 A;  5KFV A;  1NKB A;  3GV5 B;  2VDI A;  5AE2 A;  2H54 B;  4HLB A;  3I87 A;  3POT B;  2F9J A;  2W2P P;  1Q0N A;  3J7A N;  3MGJ A;  4YHH J;  3OSP A;  3H90 A;  3BPS P;  4ZLN A;  3I96 A;  1RHJ B;  1SC6 A;  3EXY A;  2XMK A;  3W64 A;  2HW3 A;  2XMA A;  3N9U C;  4O3O A;  2KT2 A;  4DCO B;  2V6A A;  2GVZ A;  5DS7 A;  2XCA A;  1JLG A;  2V34 A;  2GQC A;  3DI6 B;  2HQF A;  1HQE B;  3CUN A;  2K1O A;  2BSQ E;  5L1K A;  3K5N A;  2VD3 A;  1GTH A;  5HO4 A;  3IG1 B;  3A4T A;  2ZFH A;  4RKU C;  3TEG A;  5IT9 Y;  1CSJ A;  1T9U A;  4X65 F;  3HZE A;  4FYD A;  2HWT A;  3QJJ A;  2A6O A;  4TU7 A;  3BGO P;  4P71 A;  2UV8 A;  3FRZ A;  5SUH A;  1N6Q A;  5IQQ A;  1S6Q B;  1Q81 T;  5BR8 J;  4HVZ A;  4KYZ A;  3R5D A;  1IQT A;  3R6G B;  2CPJ A;  3R5J B;  5F41 A;  1F0X A;  3HSZ A;  3WBZ A;  4OYW A;  1JLC B;  4USV A;  3FMW A;  1QVF R;  3M1V B;  4K5R A;  3MMJ A;  2BW2 A;  2LEB A;  1KFD A;  5LXY A;  3EDQ B;  4OJ1 A;  5HJY A;  2HGM A;  3AOB A;  2DRD A;  4UOH A;  3P45 B;  1YJT A;  1NB2 A;  2VG5 A;  2DK2 A;  2V8P A;  2GMJ A;  4TXS A;  4F02 A;  2O01 C;  3TJ8 A;  4F4A A;  2BJ7 A;  4CWB A;  3G96 A;  2G0I A;  3V6J A;  5KFM A;  1M1K T;  4OHY A;  3R3T A;  2IIH A;  2LEA A;  3QAE A;  5F0W A;  5J2N B;  3FBC A;  2OMO A;  4USI A;  5E3Q A;  4J9M A;  1U1L A;  4KKO A;  2CPF A;  2ZKU A;  4JI6 J;  2B9X A;  1IBC B;  1U49 A;  2XGP A;  5IT9 U;  3RYL A;  2MGZ B;  1LFW A;  4DUY F;  4ECR A;  4K50 A;  1H98 A;  2MHE A;  2X1A A;  5D4L A;  1SH2 A;  3M9N B;  2HGN A;  1YRU A;  4KAI A;  2E1C A;  3TAR A;  4ECY A;  3BDP A;  3MEC A;  2L08 A;  2F65 A;  3HZG A;  3GYX B;  5C2G A;  1XMO J;  2GX8 A;  5K8O A;  5EWG A;  1NUE A;  1GQE A;  3R5B A;  5GAH U;  1JLB A;  1XTZ A;  1T9X A;  4NLW A;  1TKD A;  3BBB A;  4I6W A;  2RT3 A;  3CMQ A;  1NPK A;  4RJV A;  1KVI A;  4JOU A;  4YB5 A;  2G2Z A;  3CDA A;  1UWA A;  5LT5 A;  2HND B;  2ZE2 A;  1SUQ A;  5ADZ A;  1CJV B;  1HQ2 A;  4LT6 A;  1I3O B;  4LRA A;  5D6G A;  2DB1 A;  3JSM A;  2HZV A;  1ZOT A;  2X1B A;  4CNZ A;  1HNX J;  3TA1 A;  2FY1 A;  4C98 A;  4PG6 A;  2Z4P A;  2NSB A;  4F36 A;  5AJ3 J;  3DLE B;  4CO0 A;  4CLL A;  1TL3 B;  4TQS A;  3JYT B;  2ZKT A;  1PIE A;  3CJ4 A;  2V4Q A;  4P2F A;  3NGT A;  3ZZR A;  1X5T A;  3RAX A;  1B64 A;  3G8S A;  4O3Q A;  2HVD A;  3H0P A;  5I3U A;  3MZI A;  5HVG A;  4MFB A;  1CLF A;  3HJV A;  5L1J A;  1R0A B;  1HA1 A;  5HMY A;  3BQ0 A;  4IG0 A;  2XLK A;  2V94 A;  1TKT B;  1Q95 G;  2AQ4 A;  5JVH Q;  3BN7 A;  1KHV A;  4FF3 A;  2UVW A;  3R5G A;  4LF7 J;  2XS2 A;  2XYG B;  3V6K A;  1UWB B;  3QAU A;  3BSC A;  4IR1 A;  4ID8 A;  4RL1 A;  5HVF A;  1IN0 A;  2WHO A;  4DV2 J;  1S1W A;  2UV8 G;  4J7C A;  1HBU A;  3AJ2 A;  2OPS B;  4ILR A;  1VJQ A;  3UO0 A;  2CJY B;  2V67 A;  4JI4 J;  1XN9 A;  2H3A A;  2CNK B;  2BE2 B;  4UT4 A;  2GV1 A;  4KV8 B;  5FII A;  5A76 A;  1U1R A;  3TX8 A;  3NAI A;  3OUY B;  2BNW A;  4H4K C;  1RWW B;  4UQT A;  3CJS A;  2ZBI A;  1E6V B;  3H2V E;  4ED0 A;  2ZBR A;  1N52 B;  4F7V A;  3L7O A;  4EBC A;  4P75 A;  1HNW J;  4JI3 J;  3LAL A;  1UVM A;  1LNQ A;  1K44 A;  3MWB A;  4HAC A;  3QNW B;  7FD1 A;  4WCE Q;  4DZ6 A;  3MAH A;  2IJR A;  4OL8 A;  4QIE A;  4RW7 B;  5KFA A;  5CYQ B;  4DLE A;  3LPE A;  3VVT A;  1I5O B;  2CJX B;  3JAM U;  1ZAX A;  2CQ0 A;  3DFE A;  4Z7Y A;  4L3K A;  1OG7 A;  3OTB A;  3GR0 A;  2GJF A;  1WEL A;  4JI7 J;  3FFI B;  3D0I E;  2B0G A;  1CJK A;  4PPD A;  4ILL A;  3DKD A;  4DV0 F;  3IS9 A;  4DSL A;  3DDN A;  1LV5 A;  4L6V 3;  4HDH A;  2JNJ A;  3MCS A;  3DM2 A;  3PRD A;  1W25 A;  1RTD B;  5DZ7 A;  1NJZ A;  2CJB A;  4CM2 A;  2B5J B;  4USK A;  2J0X A;  4OX9 F;  3Q8V A;  2AHO B;  5HMW A;  1U09 A;  1X4H A;  2BJE A;  3GG0 A;  3CJT A;  3H98 A;  2QT7 A;  4X62 J;  1QTM A;  1KQK A;  4LF9 J;  2ASY A;  4CQ1 A;  1RYS A;  3E01 A;  4C8L A;  3PG9 A;  5B09 A;  2WBR A;  3D54 A;  4OLP A;  4EUV A;  4FF2 A;  3QLH B;  5LMN F;  4DUZ J;  4B9S A;  2ZJQ Q;  1FES A;  1X5S A;  3OW2 R;  5IM0 B;  4TKT A;  5F9L A;  3HCX A;  4DV6 F;  2BE7 D;  2H51 B;  2MHN A;  3IN5 A;  4B3S F;  1WG5 A;  2CPG A;  2CA9 A;  4QQB A;  2ZDP A;  1H73 A;  4ICL A;  3VGT A;  4A8F A;  4LF5 F;  3DRS B;  3DRR B;  3QZ7 A;  1PC5 A;  4IUF A;  5MLC V;  2VPX B;  4OX8 A;  1WI6 A;  3GV7 B;  3HSJ A;  3SXL A;  4EBD A;  1LW2 A;  2MKI A;  2KJV A;  2QLJ B;  2HQC A;  2GNK A;  2GW8 A;  3MR2 A;  4ZKA A;  4FBT A;  1HPZ B;  3NLC A;  3LWM A;  2MMY A;  2YKO A;  1HFE L;  3N28 A;  5I42 A;  3VHQ A;  4EBE A;  4NXM J;  3KK1 B;  3LJP A;  3MMA B;  2W4C A;  2XSF A;  4V19 X;  2HFO A;  2OPR A;  2DIU A;  4ZVG A;  2ALY B;  1T03 A;  1YRX A;  1RQ0 A;  2QLB B;  4PQA A;  1YJW S;  1LWC A;  2YWH A;  4AQY F;  5HQM A;  4LFC J;  4U95 A;  4XPC A;  2W2Q P;  2IBK A;  5KG3 A;  2R3V A;  1FRK A;  1FI4 A;  2VQF F;  2VQE J;  1OYD A;  1NK5 A;  4PPZ A;  5KAK A;  3KLF B;  3KLV A;  3SDE B;  1UVN A;  5FJ4 A;  2CXE A;  2KT3 A;  1RWU A;  2CAD A;  1FCA A;  4K59 A;  2DHX A;  1MSW D;  4NX9 A;  3K59 A;  2CQG A;  2BW7 A;  1Y3K A;  4UZB A;  3WC2 A;  4Y0F A;  1NJX A;  3WQP A;  2DPI A;  3Q2T C;  1SQF A;  4LVO P;  1L3V A;  4J9R A;  1WKL A;  3PW2 A;  3UFC X;  3PXG a;  2I5J A;  3C6T A;  2C3M A;  3DYA A;  1S9G A;  4Y2K A;  4DFJ A;  2E5J A;  2B4U A;  3EYZ A;  4EEY A;  1TKX B;  1RT7 A;  4J9P A;  4JI5 F;  2OD4 A;  3L3C A;  5LSL A;  2OFG X;  3UD3 P;  3KFW X;  2XWY A;  3LA0 A;  4KH1 B;  2DHG A;  5KTQ A;  1PKU A;  4USH A;  4TN2 A;  1UJ4 A;  1PAU B;  1D9D A;  4J9N A;  1X4C A;  3RW7 A;  3SV4 A;  3GCX P;  3ENV A;  3ISN C;  3MM8 B;  4DUT A;  2QMX A;  4NA1 A;  4MYT A;  3M30 A;  4ITS A;  3C14 A;  4KQZ A;  4I6A A;  5E41 A;  2YWE A;  2ZBQ A;  2BQU A;  1IJE B;  1A7G E;  1SC4 B;  2RDD A;  3DLG B;  1U1O A;  1C0T A;  4XO0 A;  2EEY A;  4MYU A;  2YKM A;  4FP9 A;  2ZNY A;  2HMI A;  1N36 J;  2HFU A;  1SXL A;  1RAO A;  3T5K A;  1CPZ A;  5GAH I;  2ZEJ A;  1RLD A;  4O44 A;  3DRP B;  1HYS A;  2HHV A;  3KG0 A;  3GTY X;  2VFR A;  4QWC A;  4GKJ J;  3VVU A;  3M8R A;  2DTJ A;  4C3L A;  4N7T A;  3TVY A;  4ZCI A;  2DR6 A;  3X3U A;  2I6W A;  4GVB A;  4NLD A;  4NWB A;  4DR7 F;  2KDO A;  3TVZ A;  1HMV B;  4WXW A;  3IR7 A;  3GIJ A;  1CUL B;  3GFZ A;  1F3F A;  1KFS A;  4WE1 B;  3QT8 A;  5D4O A;  3H42 A;  2LQ8 A;  3IRX B;  3I82 A;  2XGQ A;  2IYI A;  4ZVQ B;  2OTL S;  2KI2 A;  2QTW A;  3QRP A;  4MKV A;  3H20 A;  4JI1 F;  2G1H A;  4RW8 A;  4DS5 A;  3OR2 B;  2H1O E;  2JFD A;  3SMZ A;  1YIT S;  4YME A;  4FZV A;  4C8M A;  3GIM A;  3L09 A;  2DNO A;  1VQO S;  3CJ2 A;  1KNZ A;  3OTD A;  2CQ1 A;  4DG1 A;  4EMD A;  4ECT A;  1X7V A;  2PII A;  1HQU B;  5KFT A;  3CVK A;  1S59 A;  4IFV B;  3DN9 A;  1RA7 A;  5CAA A;  5GAD I;  4V19 J;  1HD0 A;  1FWK A;  4C3K A;  1HWK A;  1JMT A;  4M95 A;  1K0V A;  2Z58 B;  3BBC A;  4M5J A;  4DPT A;  1ELO A;  3Q8S B;  1S9E B;  1T05 A;  3KLG A;  3C15 B;  2PA3 A;  1VQS A;  1WHY A;  2KXF A;  1FO1 A;  1S7I A;  2ZWP A;  4OI2 A;  3NNA A;  2CNO B;  5CYM B;  2J6U A;  4G1Q B;  2QL7 B;  4ZP8 A;  1OIA A;  1OQ6 A;  1U8S A;  4WZQ A;  3QJL A;  4K4U A;  4YR2 A;  2AEM A;  4Y65 A;  1YQH A;  2A0F B;  2B51 A;  2UXC J;  3I5B A;  1HWJ A;  4ILM A;  3ILJ A;  3IXQ A;  1NZ8 A;  3CPW R;  1PJ6 A;  4X4S A;  5ETV A;  2OAU A;  5AT1 B;  3FDS A;  1YDL A;  2ALZ A;  5A8R B;  1GNK A;  2ZWO A;  4OZ1 A;  2CPH A;  3DOK A;  1KWM A;  3MED A;  2G13 A;  5T7L B;  3O2I A;  1PO6 A;  2MQN A;  1C2P A;  1IVZ A;  3D0H E;  2W4D A;  1J5E F;  1IM6 A;  4B3O A;  2EXU A;  1I51 B;  1WC3 A;  3NWG A;  3MTK A;  4OYX A;  4GO5 X;  2XSJ A;  4I2P B;  4L72 B;  1N54 B;  3FQK A;  3DMJ B;  1XEZ A;  1PIL A;  2QFJ A;  3NS6 A;  1XMB A;  1ZTW A;  4DPO A;  1KVJ A;  2V63 A;  1U26 A;  1LXN A;  2W24 A;  5ETM A;  1TL1 A;  3W2V A;  3T5H A;  3QWP A;  4O3S A;  3MPY A;  1DTT B;  4MK7 A;  4UST A;  2HBY B;  2HBQ B;  2X1F A;  3O1L A;  1HNZ J;  1FVS A;  1EP4 A;  2HIY A;  1DJ0 A;  2D3O R;  1JQG A;  4QIG A;  4EZ9 A;  4DI6 A;  1FXD A;  2BUN A;  4AD6 A;  3ZZO A;  2PD1 A;  4K0K J;  4DR5 J;  5KG7 A;  1YI2 S;  5LXR A;  4A8Y A;  3C3L A;  4OYA A;  3MM6 B;  4P2X A;  4AND A;  4DR2 J;  4ZPV R;  4UZC A;  3AXM A;  2VG7 A;  3BGR A;  4B3R F;  4OJG A;  1B70 B;  3SSR A;  2L3M A;  2HFS A;  1UA0 A;  2CZ4 A;  4QU6 A;  4NRU A;  2BQ3 A;  4X64 J;  1HBM B;  3KMQ A;  4LSN A;  1MWQ A;  4DN9 A;  4EI2 A;  1HHS A;  1C0U B;  2QYC A;  9ATC B;  4NLQ A;  1RWV B;  1LWF A;  1B7Y B;  1NSP A;  2XO7 A;  2BKO A;  2MSS A;  1IQZ A;  1FEH A;  3QGI A;  5B08 A;  3DLK A;  2G9O A;  2R2U A;  2IRX A;  3IAM 9;  4Y2M A;  2Y0B B;  3WX8 A;  2RKI A;  3PDN A;  3CCW A;  3M2R A;  4OJH A;  2D41 A;  4QOT A;  4LFA F;  1HIY A;  2GIR A;  2VG6 A;  2MZJ A;  1VQ6 S;  2KRR A;  3N6N A;  3UVJ A;  1PJ7 A;  4ELU A;  1RZM A;  2RVJ A;  2QFI A;  5KOX A;  1MYL A;  1HNV A;  3AQO A;  1S0O A;  2LQJ A;  4B08 A;  3M6U A;  3W5Z A;  3BGL A;  5H9E J;  3WHI A;  5BXI A;  1RT6 B;  4IQX A;  4X2B A;  3M8P B;  1TL7 A;  4N8N A;  1DLO A;  2W25 A;  4WK3 A;  1Y3J A;  4AL7 A;  1R27 B;  2P5V A;  3A8K A;  5C24 A;  2EFN A;  2F8H A;  2BAN A;  2FUG 9;  4ED2 A;  2V9K A;  2DNH A;  1SL2 A;  5K5M A;  4K8R A;  1QY7 A;  5LJ3 Y;  5ETS A;  4Y28 C;  4CLW A;  2Y1J A;  4NZ7 A;  4N76 A;  1WDD A;  4EYH B;  3LUY A;  1SCJ B;  2EK1 A;  4ED6 A;  1K9M T;  2XY5 A;  1NK7 A;  4DQS A;  4OHV A;  4X4V A;  1EET A;  5A0Y A;  2C28 A;  3V81 A;  3QAT A;  3U7J A;  5HLF A;  1VFJ A;  3KDO A;  5G4D A;  2KVI A;  4CLP A;  2A3J A;  2FB0 A;  2W7A A;  2FGC A;  4P10 A;  2HNY A;  4DR3 J;  4B3M F;  1OWX A; 
#chains in the Genus database with same CATH homology
 4ME7 E;  2GPE A;  2WVE A;  1EA4 A;  3PHT A;  2BJ9 A;  1PAR A;  2K1O A;  2BSQ E;  1B28 A;  1P94 A;  2JXG A;  1B01 A;  3VEA A;  2PC6 A;  1X93 A;  2BJ7 A;  2F1F A;  3QSI A;  1IRQ A;  1BAZ A;  3LGH A;  2K9I A;  1NLA A;  2BNZ A;  1MYK A;  1U9P A;  2JXI A;  3BKF A;  3VW4 A;  3BKU A;  4HV0 A;  2WVF A;  2K6L A;  3H87 C;  2WVB A;  2WVC A;  2CPG A;  2CA9 A;  1ARR A;  2KEL A;  2HZV A;  1QTG A;  1Q5V A;  2RBF A;  2CAJ A;  3VEB A;  3OD2 A;  1MNT A;  3QOQ A;  2AY0 A;  3FMT A;  4FXE A;  2CAD A;  1Q5Y A;  3BKT A;  2JXH A;  2HZA A;  3FT7 A;  2CAX A;  2BJ1 A;  2BA3 A;  2BNW A;  1ARQ A;  3GXQ A;  2H1O E;  2Y3Y A;  4D8J A;  2BJ3 A;  1BDV A;  2NZC A;  2WVD A;  1BDT A;  2K29 A;  2FGC A;  2K5J A;  2BJ8 A;  1MYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...