2WVEA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
131
Chain Sequence
SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWNPNDESKIAVLVVIYDHHQRELNQRMIDIFHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 31
structure length 131
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wveA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wveA02
2K5JA 2BJ8A 4FXEA 2H1OE 2JXIA 1IRQA 2WVBA 2Y3YA 3BKFA 2HZAA 1U9PA 1QTGA 2FGCA 2PC6A 1MYLA 1EA4A 2GPEA 1MYKA 1MNTA 3FMTA 3LGHA 2WVCA 2HZVA 1B28A 1Q5YA 1BAZA 2NZCA 1BDTA 1Q5VA 3VEBA 4D8JA 2RBFA 1B01A 2BNWA 2BNZA 2BJ7A 1ARQA 2K6LA 1NLAA 3H87C 3QOQA 3GXQA 2CAXA 3PHTA 2KELA 3FT7A 1PARA 3BKUA 2BJ9A 2CADA 2CAJA 2CPGA 2JXGA 3VEAA 3VW4A 1ARRA 2CA9A 1BDVA 2WVFA 1P94A 2K9IA 3OD2A 2JXHA 4HV0A 1X93A 2BJ3A 3BKTA 2F1FA 2BJ1A 2K29A 3QSIA 2WVEA 2AY0A 2BA3A 2BSQE 2WVDA 4ME7E 2K1OA
chains in the Genus database with same CATH superfamily
2HVIA 4M8LA 2W4PA 3KK2B 2B43A 4JI1F 2ZNZA 1RAFB 2JLEA 3L4BC 3P45B 3RG6A 4FF4A 4MTPA 2VBXA 2VL1A 5EUHA 5HQ8A 3THVA 1IBKJ 2CWXA 1OMSA 5HMWA 4QPTA 3MD3A 3N4WA 4ID5A 4ILMA 2F4FA 1WSRA 3UDCA 1VRUB 4RU2A 1X4GA 2KOEA 3K57A 2OJ3A 4DX5A 5GMKa 1URNA 3DOMA 2MYFA 4OZ0A 2VG5A 2YNFA 1WKLA 3VEAA 3QYYA 4FPRA 4ZVHA 2YKMB 2Z56B 1R8HA 4F0KA 3KG4A 4AL6A 3MZIA 3RZAA 1VQOS 3HI9A 2QEXS 2D3ZA 2CDRB 4ZJOA 1YBAA 1U25A 2NXNA 3GJQB 3PXGa 3MAQA 1ELOA 3VAJA 3AQPA 1VQ7S 4DV3F 3MEGB 4ZS6A 1SJ4P 1NB2A 2AD9A 3PYFA 1ZOTA 2Q6CA 1JIHA 1KHVA 2XBPA 2KYXA 3O8WA 4IO1A 1RAIB 1K73T 2M9KA 2COLA 2ADCA 1Q82T 1IKWA 3A3NB 3QFHA 4UUXA 4DU7A 4KGMA 3FC9A 3MOZA 4TYAA 3RBEA 3MM5A 1AXQA 1C1CB 3CF5Q 1XTZA 4PUOA 3V2UC 4RR5A 2GIRA 2VDIA 2EI5A 1K9MT 1S4EA 1XEZA 4DV1F 4WK3A 2DR9A 4OJHA 1IN0A 2ZHOA 1NPKA 2VBYA 1OYEA 1SBRA 5K8NA 4V19J 3NNHA 4WFNQ 1ZS6A 2HBZB 2DIVA 3EM1A 4LR7A 4RBTA 1LNQA 1FWPA 4KHRA 4J37A 4F36A 1XWLA 3FCHA 4KGZB 3CJRA 1KTVA 2JL9A 2HS3A 4Z2XA 3GMGA 1DAXA 1LWEB 3AH6A 3M8QA 8AT1B 5IT0A 3DGPB 4Y2MA 1TL4A 4FS2A 1TELA 4B3SF 1OSCA 2DEIA 2G4BA 3FZBA 4LF8J 4GMKA 4ED3A 3IG1A 4ZVSB 3VGSA 4DPOA 5LOQA 3G6VA 1IM6A 1S6OA 2CPFA 2ZBRA 3HHDA 1YRTA 2DY1A 4NLXA 5SUHA 3RW7A 5A8WA 1T03B 2Q1LA 3UCZP 3PEHA 1RISA 1VBZA 1QE1B 4O4RA 2K6LA 2CAXA 1FE0A 3R2CJ 2XC9A 4ZKAA 5GAEI 1CJUB 2CADA 5A6PA 2KXFA 1PYOB 4DQSA 1GTHA 1GX6A 3CMAS 2YWGA 2CUYA 2B9EA 4Q45A 4JYAF 4RX6A 4XDDA 1NH8A 4DN9A 4NLGA 4OZ3A 2LQ5A 2B8PA 1CS4A 5F0UA 4FXEA 1P27B 2ASLA 3UN3A 1UJ5A 3D66A 3DXSX 4PKDB 3RU0A 2BM0A 5E41A 3QZ7A 1SUQA 2FGOA 3F0NA 4HH1A 3CCUS 3RB0A 3G5OA 3MM6A 1U6BA 4K4VA 3I87A 3W2WA 1Q16B 2CNLB 3IP0A 2IY5B 1MW7A 5A2QY 4OZ2A 4NEYA 1FK9B 1QSYA 1FFGB 2IRYA 5BYQA 4LRVA 3B78A 2E7XA 3VQTA 1X0PA 2DT9A 4LBIA 2M88A 3ISZA 4OHWA 5F0WA 3BO3A 2GX8A 2MZQA 2ZHAA 2ZEJA 5F8JA 3T9NA 2BJ9A 4MIBA 2E9RX 3CT9A 1S1VB 3M2UA 3VW4A 4I6WA 3RAMA 4ZLJA 2AF6A 2MHNA 4KO0B 3LPEA 2QA4S 2GIFA 3KDNA 3PFOA 4F4KA 1EKRA 1TL7A 6FDRA 2IJFA 4EBEA 2HEKA 4Y00A 1UFWA 2E5LF 3EDRB 1TFYA 3OSNA 2MQMA 2P9EA 2YX4A 4RKUC 5D4NA 1X60A 2XS7A 2PO4A 2FZGB 1S0NA 4ZHRA 1L3VA 1D8YA 3OUYB 2YWFA 1FJCA 3H7HB 3MM7B 3DRSB 3T5KA 3CD5A 1OYDA 4GO5X 2Y1RI 1GK8A 1TR0A 2IVMA 3MPWA 2CPEA 4IRDA 1KQGB 2ZH9A 3MEDB 1U26A 3GCWP 3WDOA 5IV4A 2WAQD 3AD7C 4GKKF 2AYEA 1TKTA 2XMMA 3N0VA 4B9TA 1FE4A 3F73A 1ICEB 3MEDA 2MSTA 3IRWP 4EU0A 2CAJA 2WOMB 3BF4A 1PYTA 1K1SA 2V2VA 4JV0A 3H25A 2VQEJ 5K20B 3TANA 2MTLA 1I1GA 3VGVA 1KSPA 3SFGA 3HVRA 4ELTA 4QR1A 3PV8A 5FJ4A 4OQJA 3FK4A 2QGFB 1RTJA 4DV7F 2J9EA 5HLFA 2ZBQA 3D3CJ 4ZVRB 1ZZNA 3BM7A 1LWCA 2E7WA 5B0CA 1S49A 1NMEB 2QA1A 2MKIA 1IXKA 3GR0A 4K2XA 4OX7A 3W9IA 2AJ2A 4NX9A 1JWWA 2NXUA 4BLGA 1S5ZA 1U09A 4RL1A 1GTEA 3Q24A 4YY3F 3NS7B 2UUWA 2YQ3A 4USHA 3OV7A 3PW5A 2PA8D 3PFEA 4TLRA 2UUAF 3K17A 3ETOA 3PYGA 1N5TA 4N76A 1Y5IB 1GT8A 2E5HA 4KQZA 2C2DA 2C2EA 3UCUP 2GJFA 2XZDB 3CCJS 3HT0A 1Y0HA 3IRXA 3DHWC 3FRYA 4KGKA 1RWNB 3RGIA 3M9MB 4ED6A 1C2PA 1RACB 2BOPA 2LEBA 3IC1A 4DV5F 3O3LA 4F67A 1GAOA 4Q2MA 2MJUA 4E0DA 4ZITA 4EEYA 3Q8QB 2M52A 2K1OA 5D6GA 3AJDA 3PRVA 4YOEA 1NK7A 4FXDA 4DFMA 2CJYB 1FVSA 1HNZJ 2GAGC 3M9NB 1X8DA 2G2YA 1V3SA 2RU9A 2NYIA 2I8EA 4I7FB 5MAOA 3I96A 2W9CB 3KJQB 4M5DA 2HFOA 3RRKA 4QR0A 4DLEA 4DSKA 3ZO7A 1AA1B 4WFYA 1RTHA 4C8NA 3LP1A 1CC8A 2GQQA 1CJKB 1NM2A 5H9FJ 3TZYA 3H5SA 2A2CA 2CNKB 4G1QB 4FKYA 5D78A 2W9BB 1H0HB 1RTHB 1UVLA 1S76D 2FHOB 1NHKL 4K0KJ 1CJKA 3HMJG 1XNRF 1VS3A 1RK8A 4M5JA 3LPYA 4OLPA 5J1EA 2B5JA 1RAOA 1U6FA 3C66A 4LRDA 1FERA 3CVKA 3VTIA 5GADI 1U2FA 2C3PA 4LFCF 2IM2A 1OPZA 4WP8A 3CCVS 2GQ2A 1RGVA 3TA0A 5IOLA 5G0RA 2U2FA 3GU0A 3TEHB 5J2QB 2UUBF 2ZBPA 1YKWA 2L9DA 1Q81T 1J5OB 2KKEA 3A8EA 1VQLS 4X4VA 1S9EB 4EI2A 4AFFA 4YS2A 5LSRA 2E29A 2PFDA 4DR1F 4A8XA 4ECYA 1RU1A 4EZ6A 5CZXA 4NLDA 2CZ4A 5CABA 1NLKL 3DRXA 5M2RA 3Q86A 4NLSA 3UI3A 3NRBA 1C1BA 5D3GA 1QUVA 1VGYA 2XS5A 2J9CA 1NRKA 2B51A 3HJFA 2WONA 3FCWA 2DNKA 2MGZA 1FO1A 2OEMA 3F41A 1XBWA 1FKPA 1AFJA 4PABA 4WU3A 3IWXA 5DRKA 2HRTA 1C4CA 4DV2J 3T5LA 2RU3A 1XMOF 4LF2A 2UUCF 4LF7J 4M95A 3ZZYA 2XI2A 5IQ6A 3OTOJ 2OGUA 4ZPBA 3QJJA 4I69A 3OVSA 3C6TB 3W5ZA 2R7OA 4EUVA 4K4YA 4K2JA 1TL3A 3O6QA 3R5GA 3D6FB 4G1PA 1R8CA 1HHQA 4NCGB 5BYSA 2VJUA 4JI3F 1HPZA 1VYAA 3LF0A 4KKOB 1U1OA 3E01B 5KG0A 4NWBA 1F60B 4UY85 2IJNA 3H20A 4DBQA 3RYLA 3PZPA 3THPA 3FCVA 2KXHA 3DCAA 2D69A 1BC6A 3QT5A 2FUG9 3MAAA 2B0GA 5IM0B 2EFGA 2WSEC 5AE3A 1JLEB 5JJBA 3F44A 1O6XA 2DH8A 3D0GE 2B3TB 3CSKA 3MM9A 1PKUA 3FSIA 2LP4A 2AGPA 1B3TA 4XAKA 1RTDB 3R9LA 3GG1A 4HV0A 1YRUA 3RAXA 2MSSA 4IUFA 3GQCA 1JMTA 1VJQA 2R4FA 4CQ1A 5KFAA 1JNRB 2QZ8A 2Z58B 4ZDNA 2X3DA 1YJUA 2DVIA 4PZVA 3GONA 4J9KA 3Q8RB 4QJVA 1IBLF 4PUOB 5IFMA 5HVHA 1S6PA 3D4JA 4NLQA 1R0AB 2I5JB 3W61A 1HKAA 1SH2A 4TU9A 4UUWA 2CQCA 1PBAA 2JX2A 2ZH4A 4IG0A 4JYAJ 2FIUA 1TL7B 3CD0A 4CLPA 4DU8A 4OI2A 2L3MA 3TAPA 3R6LB 4WTYA 2PE8A 1IBLJ 2YKNB 5DDRC 4QU7A 2HQFA 2WBMA 1S1XA 3AB4B 2XULA 4K5SA 3KG1A 4O4GA 1RAAB 2YKAA 1J27A 4DUTA 4LF5F 4UZCA 2VHGA 3J7A1 1N36F 4O23A 5RUBA 3J81Y 3JAMY 4I68A 1BWEA 5B0GA 2KDOA 2MY7A 3HXMA 3H2LA 3D6MB 3HVWA 2DNMA 1RWUA 1MU2B 1PO6A 1H3DA 2B56A 2H4YB 1RWOB 2ROPA 4LR8A 2D74B 4X4SA 2E9ZA 2NUUG 2RRNA 3HHLD 2F3JA 4EYHB 1IKVA 3MCMA 4HR2A 1WKJA 2F4VJ 4NZ6A 1P9QC 2EFOA 2QTWA 3CCMS 1RDRA 2AJQA 4ZPAA 4FF2A 3JAMU 1SL2A 2KJWA 4DR4F 1NXIA 1RTJB 1DBDA 2VIHA 1RWVB 1UW9A 3JXOA 3TJ8A 1BXNA 2B6AA 1TKXA 4ZIVA 3EZ5A 3CCRS 1LWCB 2QT7A 5DGAA 3HFKA 4F2RA 1KVIA 2KG1A 3Q8VA 3D2WA 3FEYB 3UDEA 1KDNA 4WP9A 2LXIA 4DQIA 5FDLB 2CPIA 5BR8F 1U8WA 2FC8A 2M5YA 2MQNA 2XWXA 3PACA 4NA3A 5EWGA 2JLGA 4EBDA 1I94J 3HVTB 1DLOB 2CPDA 2YKPA 3M1VB 2YNGA 1EHWA 1DTTB 1OO0B 2FZKB 1ZA1B 2MKYA 5EGYA 1IR1A 1ZPVA 1BQMA 1LXJA 3TQEA 1HHTP 3SBMA 2VBZA 1CC7A 2JZ5A 1FF2A 4UOFA 2NQPA 1EQ0A 3NOCA 2DGUA 4DSJA 4OX9J 1C1CA 4S0MA 1QJHA 3ZZZA 2F5GA 4K0KF 2ASDA 2AZ1A 3W63A 1NAQA 4ED4A 1ZETA 3WIUA 4PQUB 1B7FA 2ZZNA 3NKYA 1KOOA 4K4TA 2HK2A 4PG4A 2WK4A 2K1RA 2VG7A 5KFLA 4DR5J 4KTQA 3SYZA 2KM8B 1VK8A 2WVDA 1HQEA 1SC1B 2FJBB 2CNNB 2PD1A 5B09A 1H72C 3BH7B 5CYQA 3K5PA 3UWTA 3JB9k 1ZPWX 2ZBCA 3AHPA 1X0FA 1F2GA 4J9UE 3GCXP 1PAEX 5A8RA 3GPAA 4P7VA 1XJWB 2AT1B 5T7LB 5KT5A 3JTNA 2VQFJ 1NK9A 2XSFA 4LF8F 3HD1A 3DRPB 1ZM4A 4KH1B 4LVNP 2HFSA 1JLAA 3AODA 2DK2A 2XYHB 2UVRA 3BKUA 2BE7D 4DR6F 1VQMS 3HHLB 2DTJA 4PXEA 4XPCA 3C2PA 3MR3A 3VHQA 4CI0B 4K59A 5HLFB 2QL7B 4O3NA 2KVIA 3IN5A 1S9GB 2I2YA 2OPPB 4DV6J 1J5OA 1SJRA 3SQOP 2O1PA 4LF6F 3DDNA 3HULA 2GA7A 2CWKA 3N6LA 4OI4A 3W64A 3OL6A 1DQ8A 3MGJA 3MPVA 1U1NA 2UV8G 5CCLA 2BE2B 3ICLA 3Q8PB 1YJ9S 4CIOA 1AUSL 4KR0B 3NY0A 4WU2A 5DZ7A 5C42A 3DMJB 3TUZC 1OHNA 3PTWA 5DLFA 3M4XA 1GFWB 1K8AT 1FT8A 1S6UA 2AJ0A 2R7QA 3PO5A 1NLAA 3LUYA 4LSLB 3BBCA 1HBMB 1JLBA 3BV8A 2R42A 2VA3A 2KZMA 4NLUA 3CJ4A 4CO0A 2R9LA 5CD4H 1R8BA 1RHQB 3AD9C 3RUBL 3CDWA 3LP0A 4I56A 4ES3A 4NCAA 1JJ2R 2EEYA 2OHDA 2V2QA 2VPYB 2KT2A 5C25B 2GC8A 2K9IA 4NZ0A 1C4AA 3CJ5A 3G87A 3VV2B 4JI0J 2CIMA 2XLKA 5EHHA 1WJ9A 2DNGA 2L48A 3G6XA 2CDQA 3D6HB 4K4SA 4PQUA 4NLRA 2MQOA 3LANA 1QD1A 1FDAA 4IKAA 5HVGA 4PXBA 4ECXA 3M2VB 1G2EA 4V1Ak 3VWSA 4Y2IA 3B8HA 4JV2A 2XS2A 4YFUA 4RW7B 4DLGA 1C0TB 4I67A 4IDKA 3LGHA 5KG4A 4AYBD 4IH6A 1JLEA 1NBEB 3E3XA 3KG0A 3DLBA 4BC9A 1UEKA 4JI7F 2WRMA 1TUWA 3SXLA 3I4PA 1V5IB 2IYGA 2JOQA 1W2BR 5CYMA 2H5EA 5ITHA 1XN9A 3NGDA 4WFZA 5KT7A 2L9WA 4USIA 4USKA 1D8ZA 3OFGA 5FLXY 1U0SA 2NXEA 4J91A 1UWAA 4FP9A 3PX4A 4F2SA 1ZA2B 4Z37A 4ZP9A 1SB6A 4ZCLA 1PC4A 3EZOA 4Y6IA 1FX2A 1HNIB 1YBTA 2OFGX 3L09A 4CO1A 1D9AA 1R7IA 2P6TA 2QE5A 1FWLA 1VQYA 2YNHB 3SCLE 5A8KB 3KJVB 5THWA 3IAM9 1BMQB 4JI7J 3OFEA 5D0EA 3GV7B 5I3UA 3EGZA 3SDEB 4KB7A 2JFDA 2HVHA 2LKZA 4OYAA 5DQHA 3NP5A 2UU9F 2D41A 3I82A 1WOSA 2AHOB 5J2PA 1S6QA 1FJEB 1RHMB 3DLEB 3P5TL 4OI3A 5J1NA 4UOHA 2QL9B 1XERA 1NKCA 5KFEA 3FBEA 3TOQA 2PI4A 3MEKA 2DNLA 5AXMA 1U0HA 3S7RA 5DDOC 5KAKA 4PQAA 1H38A 4WIQA 2HBRB 1BWVA 1D9FA 3CNQP 2HBQB 1AZSA 4WTOB 2DXEA 3PR4A 2VASA 4DR1J 4JI6F 2DHAA 2BRLA 5CHCB 4YHHF 2ZE2A 5I3PA 4QIVA 5HROA 1TK8A 2UXCJ 2WONB 5CD4A 2XGPA 1NEEA 5BR8J 5M2UA 3FEXB 2OELA 1SH0A 4P2SA 1TL1B 4RW8A 2QSWA 4ME7E 1HBNA 2OPQA 4OV1A 1RLDA 2EG1A 2JNJA 3C15B 3W8GA 2VFSA 3BBFA 3M32A 2KH9A 2B8QA 2C3OA 2LEPA 3ONQA 2HRYA 2HFVA 3FBCA 2MLZA 4RW4B 5KG5A 1L5UA 3ZTOA 4Y0FA 1QTMA 4O0IA 1VQ9S 2O3DA 3OXGA 1RADB 2DHXA 1SQEA 3DYAA 4M5DB 5FIIA 4FNIA 3TAMB 4O44B 2ZJPQ 2Z2LA 2VDHA 3BS9A 2HWHA 4JI8F 2JEJA 5F9LA 1T0TV 5I3QA 2FJVA 3TUIC 4MIWA 5IM0A 1P6TA 2HK3A 2W9BA 2ZOMA 4L75A 2OMOA 1S1WA 2GVDA 1T05B 2G9OA 3MM9B 3P3DA 4GKKJ 1EP4A 2BBEA 1QAYA 3I9ZA 4LF4F 1H74A 1YTYA 1NJYA 3AXMA 2PN6A 3BPSP 3NMRA 4QZVB 2FJXA 1OQ6A 4MFBA 1GMWA 2RMLA 2NSBA 1FTRA 3PG9A 4MK9A 1PGZA 3MD1A 2BR0A 3WZ0A 5F8IA 2HGNA 5L1LA 1M5KC 2P8IA 4U8YA 2IIHA 4J7CA 1YZ7A 4O0NA 5LMUJ 1K0TA 4A8OA 2DRBA 2R7XA 2FJDB 4WYWA 1TKZB 1JKHA 3HD2A 4CO4A 3TUPA 2CKWA 1HWUA 1IKWB 3H87C 3BSNA 1RI7A 3QMQA 4URSA 3JYTA 4LF4J 2P5VA 2VONA 4URGA 2ASYA 3GSDA 1Z4UA 2RS8A 3M05A 1O51A 3QT6A 2RUGA 4DL3A 1YI2S 1SCJB 1KTQA 5DS7A 2DHGA 3MEEA 2RB7A 2YX1A 3ZFVA 4TVAB 2UV8A 2F8MA 4C11A 1HQEB 4RNFA 2N82B 2B7BB 5EWEA 4TU7A 2MKKA 4IOAQ 2JXHA 1JLCA 2G0IA 3SSQA 4MKBA 2QLJB 2A10A 3OVBA 2IM0A 4ZP8A 3L7UA 1NJXA 2AEJA 3O5TB 3CIZA 5G4DA 1T03A 2W8KA 4LR9A 1RT6B 4DUZJ 3NS5A 4HHHA 4B3TJ 3DRPA 3KK2A 1SI9A 3G2XA 2G2OA 1CEZA 1Q95G 2CQIA 3VAFA 3RBZA 1NDCA 4ZVEA 3JQKA 3NS6A 2B9XA 3G96A 1NJWA 1HBUA 2XMUA 3OVAA 1PIEA 3SV3A 5C5JA 1T9VA 3KK3A 1L3TA 2CPGA 4P2MA 1QE1A 2H9ZA 4BHQA 3D0IE 3PKYA 2PT0A 3MMJA 4WWSA 2WW8A 2MQ8A 3BPDA 5KFIA 4U6PA 3RAQA 4JBCA 4O3PA 1WHYA 3V6KA 3CO9A 1VC6A 3OPKA 3MTKA 2KFYA 1IWGA 2BJEA 1X93A 5KFTA 3A3PB 3TR5A 2E7VA 4USWA 2VFRA 2XMAA 1APSA 3TAQA 2CPXA 2AJ4A 2PMHA 4HT7A 4LJMA 4U7UK 3DM2B 3LAMA 1CVJA 3BQ0A 2GVDB 3I9V9 4ED8A 3NGTA 4JB8B 4DX8H 5B0AA 3EMTA 4M63A 1T05A 2VA2A 2PC6A 4HI1A 4ED7A 3D67A 8ATCB 1VQ5S 5FDLA 3CD7A 3I31A 1LFWA 2B4VA 4OYPA 4ANDA 1UETA 3W62A 4UOGA 2RJZA 1RP5A 3BSAA 5DM7Q 2WSCC 1RWKB 3DRRB 2BJ7A 3M1VA 5BYRA 2ALZA 2KM8C 4JI8J 1Q16A 3A12A 2EWHA 3MM5B 1MMDA 2N4CA 3NBPB 3IMQJ 1GMWD 3K2YA 6AT1B 1T3NA 2BANA 2LEAA 4NA1A 3Q2TC 1Q53A 2Z57B 1WHXA 4LUBA 1YX2A 2RHSB 5D4PA 2D3UA 3D1HA 4YN3B 5U47A 3LWLA 3V4IA 2DR5A 3RRGA 2WB1D 3NCQA 2Z2MA 3QIPB 3CMES 3AJ1A 4GKJJ 1JXLA 1B70B 1L3SA 3SIPB 3FBFA 1S99A 3MMBB 4X65J 3DLKB 1RHJB 3CJKA 5FLXU 2BVZA 4G6VB 5LMNF 1N32J 1N5VA 4OYBA 3MHYA 4ECZA 5CXTA 3CCES 3AB2B 4A48A 4X62F 1RT7B 1IUJA 3W2VB 4GVLA 2G2ZA 2O66A 4X4PA 2YQ1A 5KFBA 4DZDA 3PW7A 4I6AA 1X4CA 4CLZA 3M8ZA 3Q0AA 3CULA 3NGKA 2OUGA 3OTOF 2L08A 1GMVA 1NK4A 1U2RA 2YNHA 1FXRA 3K59A 3GE9A 4PG7A 4DJBA 5CQGA 3TO8A 1F6TA 2IA6A 4K4XA 4WIIA 5J2QA 2DR8A 1LW2B 4KH0B 2F8EX 5D3GB 1N33J 4Y2AA 4DL6A 5KT4A 2M8DB 3DHXA 3LP2A 1NHUA 1MSWD 1TVRB 4OHZA 3BGUA 2A2BA 4DHVA 3EVWA 2I6WA 1YHQS 4A4JA 4X64F 2XSJA 2Y1JA 2GHWA 1HR0F 3V6JA 3P49B 2R7TA 1HHSA 1YJTA 4QWBA 3FFIA 3TJ9A 4E2FB 1A7GE 4IYQA 3A3OB 3VZHA 5IT9Y 3AAWB 1LK7A 4G1IA 1UTAA 5LJ3Y 4U7CA 4XO0A 5DQIA 1MWZA 2LDYA 3MDFA 3HDSA 4ZJLA 4LFCJ 2IPOB 2V5HG 3GYNA 1JK9B 2OP5A 2HVEA 4L76A 5ETMA 4DV3J 3ILLA 4P2FA 3TRGA 4WZQA 2MHEA 2GV1A 4QPXA 1A0OB 1VIXA 3W1YC 2GHPA 1VQSA 1BDVA 2PMWA 4MIAA 1TL3B 2HVDA 4CM0A 3HK2A 1XR5A 3BGFA 4R0JA 3QJLA 3JSMB 2R8GA 4WF9Q 4CH7A 2VFUA 4NE9C 4KO0A 3B54A 2MZSA 4QW8A 5BXIA 4DR3F 3I0SB 3M8RA 4HLBA 1Z2LA 2VKZG 5A76A 4CZCA 2QYCA 3MR6A 5ETLA 4QR2A 1U49A 1DHMA 1FWKA 1QTGA 2MZTA 1CJTB 4MK8A 2Q66A 3MAAB 5GAHU 3QO9B 1UWBB 4DUYJ 1JXEA 3BH6B 2YPZA 4AL7A 3FMBA 3VAIA 2V8PA 3PYDA 3EJMA 1VC5A 1UEVA 1R27B 4USMA 1LK5A 3CDEA 2FDNA 1C0UA 1ZM3A 2NXJA 3SCIE 1VHIA 3O44A 1RWWB 3A8JA 2E5LJ 3C16A 2R2SA 3MMCB 4PXCA 3G6YA 3GYGA 3UD4P 1N88A 5GAGU 2DR7A 1EKSA 4CP5A 1NH7A 3PJXA 2AZ3A 3CCLS 1HARA 3ZXWA 3PIPQ 2V67A 2UVUA 4JI1J 4NCBA 3IBFB 4R0EA 2RHQB 3VALA 2BM1A 2JLFA 2YXLA 3Q8UA 1N34J 2AU0A 4DR7J 1CULA 3H0PA 1HI1A 3BB5A 4LFBJ 2B5JB 2ZITA 2LU1A 1H2VZ 3VGTA 2X1AA 2VODA 5D0GA 2OPPA 1JLGA 3RR7A 3VAKA 2XLIA 3TA1A 2RT3A 1SL0A 3HHNB 3QRRA 3HFVA 3JSYA 1OS5A 2CJXB 2UP1A 4IQXA 2UXBF 2GO8A 2XHWA 2ZZTA 4QIFA 4Y3CA 2HG4A 4QWCA 2DGWA 4FDFA 2V9WA 5F3ZA 1S1TB 2OTLS 2DNQA 3BGRA 5HMXA 4DMZA 2KJVA 4M5LA 1FKAF 2UUBJ 1CJVB 2R7RA 4DPXA 2MQQA 4C0BA 2DH7A 5HSPA 1H2TZ 1UW4A 2KB2A 3Q89A 3GJSB 1I94F 1HBMA 1V9OA 2RRAA 1DZ5A 3TUJC 3FKBA 3LGMA 3O2IA 1RT3A 1HNVA 4NA2A 1Q79A 1YJRA 3SCJE 3KLEB 4ETZA 3W3SA 4X84A 1A6LA 2UUAJ 4KRWA 4I0WA 3GFHA 4IFVB 1Q4RA 2V0NA 4GRSA 4N7TA 2AN7A 2V6AA 3MMAB 4TKTA 4JI2F 5LL6d 3R7BB 1Y10A 1V6HA 2FHJD 3OTEA 1KNZA 1U8SA 3MCNA 5AXNA 3BR9A 3QWUA 1R0BG 2J7UA 3SSRA 4X65F 2Z8QA 3A1YG 2BKPA 3NXZA 2RQMA 2B4PA 2H54B 4WXWA 2M2BA 4ZIWA 3EXYA 3OL7A 2DXFA 3UCGA 3MCSA 4IFYA 2C22A 1GX5A 3OJSA 4DUZF 1X4BA 4B3TF 1VLYA 1WOPA 2QC3A 3IM9A 4Y65A 1HNZF 2VUGA 4FS1A 3T5JA 2WTFA 1SJQA 3GLJA 1UPMB 5CYJA 2M0GB 5HN0A 3MPUB 4RWWA 4YQWA 1VQ8S 5A0YB 3TI0A 1VMBA 2IBKA 5KT6A 4P75A 1JKHB 3QT8A 1FXDA 5E0OA 4LF9J 4ZK7M 3SFUA 4UY8T 2BX6A 2CPJA 2VC1A 1XNRJ 2C3MA 1TTHB 1NDPA 1EX8A 2BNZA 4P10A 4X64J 1ARQA 4EZ9A 5DG8A 4GKJF 1Q0NA 1S4FA 2BANB 4LFAF 3V4IB 3AQOA 1TKZA 2H3EB 4DL0C 2N7CA 3V6HA 4MT1A 2WHOA 3H42A 3QGPA 2H48B 1S79A 2DH9A 2JWNA 2E1PA 1X7VA 1U1MA 1IKXB 3C14B 1U24A 2VPWB 3B82A 3IG1B 2V4JB 5IV3A 3LJPA 4PR6A 2O5DA 4WE1A 1SQGA 1OIAA 3OQ2A 5IQQA 3ZTPA 1HWJA 2HMIB 1M5PC 1J5EJ 2FJEB 2HZAA 2V2ZA 1AROP 2CJAA 1WD6A 4LIRA 4WE1B 1F5CA 4KFBB 5B0BA 3NAHA 4PWDA 4XIUA 2E66A 2WVCA 4EWTA 2ZM6J 4JI3J 3R6GB 1D3WA 4DL7A 1U1KA 4DCPB 3BYRA 4U95A 2MKJA 4FVCA 4H54A 1SC3B 2A0FB 2LECA 2J9DA 3GFYA 4DEZA 2KVQE 3HSDA 2J5AA 1LW2A 3DU6A 1R31A 1S12A 1U4BA 1IBKF 1QM9A 1Q8KA 2DHHA 3DFEA 1D09B 1X5PA 1TUVA 3OTBA 4CLYA 1R6YA 1QDUB 4NI2A 4M5KA 4PG6A 2VZ9A 2YKMA 4OI6A 3G8SA 3VAHA 2J6SA 4LQ3A 4Q0BB 4CO3A 3B4MA 4DPUA 2ALYB 1VOMA 2XZWA 2AJ1A 1Q7LB 1PJ7A 4MJKA 5KG3A 4CLUA 5KT3A 2R8JA 4ZCIA 3FDSA 1Q8BA 1EA4A 2E5IA 3OFHA 3SEOA 3X1LB 1A9NB 3V6DB 3D54A 4C97A 4RUHA 3FQKA 4CYUB 5HP1B 4B3RJ 1FDNA 1SKUB 3O1LA 3HVAA 1LOUA 4BBYA 4QYRA 5HP1A 1KQKA 2UXBJ 1FD2A 3QIPA 4YB6A 3KK1B 2XYGB 3PJ9A 4NYPA 2OSRA 5KFUA 1MMLA 4M5NA 1IKYB 3H98A 4FKXA 3MUMP 1JJCB 4PXDA 3PCOB 4UQTA 2AYGA 3G9CA 1HMVB 2NS1B 3KK1A 3H5YA 1F9HA 1LW0B 3FJ2A 2C2ZB 3PYEA 2RVJA 4NMXA 4K4WA 3UPFA 2MZJA 1UWBA 3CC4S 1HNWF 4L73A 3GB0A 3PRBA 4C3LA 1VQ6S 4OYOA 3MUVP 2ZOFA 3DGPA 3T1YJ 1T7PA 5T14A 1NDKA 1Y4ZB 4V19X 2DD8S 2EFQA 5LXRA 3KUEA 3ILJA 1Z2ZA 3DRSA 4O3SA 4F26A 5A8RB 3OJUA 4QBUA 1X9MA 4KFBA 2ZC3A 4RBUA 1TL5A 4DR3J 1BD6A 3EDQB 4HHJA 2GJ2A 2BE9B 4ZA1A 4DCOB 3MUTP 1VIOA 2RE1A 4HDHA 3N28A 2IDEA 2PDAA 4RZRA 4NXNF 4B08A 1TKTB 4X62J 2RQCA 3OR1A 3DLLQ 3D6TB 2ZBIA 3E51A 5AXLA 3OSPA 3W5XA 3SCKE 1HBOB 1O8BA 4LSNA 2BJ3A 3BKTA 4F50A 4NRTA 2K3IA 3M8PB 3J7YI 1I5OB 3FQLA 3V81A 4PPDA 1LWXA 2LDIA 1W25A 2OI2A 3DI6B 2Q43A 1REVA 2LCWA 3GSIA 3W7BA 1FA0A 1YWXA 5FD1A 5K14A 2BQ3A 4G3IA 4QOTA 1GNKA 3PHEA 1G3OA 1N5SA 1RAEB 1Y9OA 4I4BA 4R8UA 1BY9A 5ETOA 2CYYA 3BGRB 1JLBB 1VQPS 3D3BJ 3UQSA 1VISA 2MKHA 2DPJA 3DDIA 4B9NA 1RT1B 2KKHA 2ZUAA 2A1BA 4C2MA 2ZDPA 3IS9B 1QAXA 4WZMA 2D3OR 2DXDA 2Y1LB 4ECRA 1FK9A 4C0HA 1TMMA 3FSXA 3OTDA 1P8GA 1Q78A 2JDJA 2ZVSA 3BYPA 1MN7A 3IS9A 3JQMA 3P8BB 4M5HA 4PG5A 1X9SA 2WB4A 2KTQA 2X1BA 2IA0A 3MECA 2FVRA 3BN4A 1FJGF 3CO0P 4LT6A 4A46A 3ADAC 3R5DA 5HANA 4ID5B 9ATCB 1AW0A 1N8RT 1ULRA 2OPSA 4RUCA 4ZVOB 5LSLA 3TYTA 4WKRA 3MMBA 3NG8A 4CT9A 1C0UB 1GXLA 3N6MA 5KFGA 4HACB 4YR0A 4LBHA 2ZFHA 3E2EA 2XYPB 5LMNJ 1KFDA 3R5CA 1WEYA 4NEZA 1T3OA 1NDLA 1C0TA 3M7VA 1NKBA 1WWHA 2XEXA 3HT3A 1SXLA 1HD1A 4DSEA 2G1HA 1IR0A 5KG7A 4DSFA 2CQ4A 1JLFA 1EP4B 5ETPA 2F7VA 4UF4A 3SDEA 3EICA 5F8LA 4XPEA 1KLMA 3EWGA 2DCLA 1RA6A 1T9YA 3NGSA 2VOPA 1T9UA 4ICLB 2IVFB 2CG8A 3OR1B 2E1RA 3C8YA 3K5OA 2FJWA 1PBUA 4D3HA 1LV5A 1X4FA 1KR4A 2J7KA 3N79A 1WG5A 2AWZA 1UA0A 4OYXA 4DS4A 3LP2B 1TK5A 3BR8A 3G8QA 1PYSB 2XMWA 1LWFA 3NLCA 3M6VA 5D0RA 1RKJA 2MPUA 3MR5A 4W92B 3DLGA 4QQBA 3PEJA 3DMJA 3UR0A 2IRXA 5L46A 1RTIA 1RT2A 4DV6F 5H1SV 3ETMA 5F8GA 2HHSA 3AT1B 2HYIB 3P5BP 4LSLA 4F3QA 3US5A 4RW8B 4N77A 5H9EJ 1VQNS 1H73A 8RUCA 2Y0SD 3CCSS 3AA8A 2XB2D 2OPRB 4WKYA 5EWFA 1DURA 4KHPF 2HIYA 4MJWA 2BSQE 2ZE2B 3GIJA 1S7IA 2YPYA 2K8GA 4NOHA 1S72S 4PWDB 3D68A 2WVBA 1F2HA 1Z1ZA 2GGPA 2YNIA 4M5GA 1NK0A 1AT1B 4C8ZA 1XMQJ 2Q2KA 2IC3B 3DOLB 1TL1A 1RZMA 4H4KA 3VVTA 1Q8LA 2LYVA 4EFAC 1HI8A 2XWYA 4J9NA 3NNCA 1V3RA 1WTFA 4J9SA 2AW0A 2GGPB 2HNYA 4Y34A 2KYZA 1HPZB 1HNWJ 2IC3A 1CJTA 4TXSA 5JXSA 2ZH8A 2E1CA 3KXDA 4TQRA 4DL5A 3GJRB 1QAIA 4GVBB 3OBIA 4ILLA 2FJAB 1FNOA 4KE5A 4PYAA 5T41A 4MK7A 3N01A 1SPBP 1RABB 5CYMB 3ZTSA 5KFQA 1OQ3A 2AP6A 2HLUA 3LGNA 2MLXA 2RDDA 3T1AA 3S01A 4IFYB 3OLAA 5GVQA 5F8MA 1S1UB 3GV8B 2R7WA 1IVZA 1B99A 1YK9A 3F56A 3PDNA 3MM8A 1MMNA 3ZNJ1 5HJYA 1JJ4A 4L3NA 1Q8IA 3KTQA 3HCXA 4AT1B 4JV5F 1F5BA 1FRXA 1RAGB 1WACA 2FHJA 4KBIA 4ECVA 4J90A 3CMQA 4OV6A 5D4LA 4YR2A 3TNVA 1UFKA 4IG0B 5KFCA 3M6WA 2VJVA 1OY9A 1GEHA 2A18A 1HR0J 1Q5VA 2BNWA 2FQQB 3CB4A 3AFGA 3UVJA 2SXLA 1SIZA 1WHWA 4KJIA 1FEHA 3PHTA 2CZVC 4KGVB 3HFZB 3W5YA 3QLHB 1MROA 4WP3A 2W2PP 2V8VA 1N5YA 3UW1A 1NU4A 2DO0A 1KVJA 2LXFA 2GNKA 2ZUGA 2HMIA 1AZSB 2DKOB 1WSVA 2RKIB 3LH2S 3OT9A 2VFVA 2MKSA 4TY8B 4X2BA 2KN4A 4OLOA 4F8RA 2C3YA 3KLIA 5EDWA 3T1HF 2HAIA 1X5TA 2BACA 2DRDA 2HPUA 2GPEA 3TVZA 2RAQA 2H4WB 3CGIA 2V4QA 1MWYA 3CDUA 4NCGA 2ZDOA 3SSSA 5KFZA 3PR5B 2ZH5A 4DS5A 4CLWA 3MI7X 3CDAA 2H3AA 2W25A 3DDKA 4ALZA 1RT5A 3MR7A 3R5AA 2AEFA 1RYSA 4JI5F 2Y9HA 1PC5A 3M6UA 4KSEB 1B0VA 3S8SA 4OZLA 4DFKA 2Z30B 4KPYA 2I9SA 4LF5J 1WEZA 3ZZUA 4J9QA 2HBYB 1RB0A 4DR5F 2UUTA 1U02A 2RQ4A 2CJKA 1ARRA 1WDDA 1F9EB 1WG1A 2WVFA 3GYXB 4YY3J 4AXIA 2E9TA 1KFSA 1CJUA 1QY7A 1UKUA 2NCKL 1RKIA 4ELVA 3FEZA 1QTNB 3THTA 4JI5J 4ZPVR 1OWXA 2F9JA 3HLUA 3CXCR 3AY0A 3G82A 1MLAA 2FLOA 2H1OE 2EFNA 1X4HA 3IAS9 3W2WB 2FYXA 2KHDA 2ZOGA 1QVGR 3CD6S 4DF8A 2VFTA 1N48A 5HAOA 2HQ3A 1XNQJ 4QIGA 1RSCA 4AXJA 2H1YA 2OMLA 1BHNA 2PIIA 2RNEA 2BJDA 4N41A 5JVGQ 2MQLA 5JVHQ 3NBPA 3KNAA 4D8JA 3AOCA 5KOXA 3MF5A 5J2MA 1QLNA 4B3OA 4IG3B 3MAHA 1ZAWA 4XDCA 1LFPA 1QAJA 4RW6B 1DFDA 2H65B 3R7SB 5K9FA 3GFXA 2FB0A 3UDLA 1RAJA 4F25A 5L1IA 2Z4PA 1HL6A 3KWMA 2R3VA 3GIKA 3HHEA 2GZOA 4N47A 2OAUA 2BJ1A 3M2VA 3NGRA 2KO1A 2BA9A 3LA0A 3TVKA 2F1FA 1RBAA 3CJ0A 3IR7A 4X4TA 2ACYA 3ZZ0A 3ENVA 2VG7B 3BBBA 1BUXA 3D28A 4CH0S 2EG2A 2KG0A 4TY8A 3LP1B 1LWEA 4ZN1A 3OR2B 2QO3A 1KLNA 2DNOA 3EVOA 5F41A 2HHQA 4N56A 3OUYA 1RQ0A 2JBVA 1NK6A 2GMJA 4I6YA 1N6QB 3L7PA 2ATLA 1WF0A 2DR6A 3M30A 3MTJA 2ACMA 3B4DA 2B9WA 3VF0B 3J81U 5D8HB 2HNZB 1FFSB 2QA4G 2BDPA 1NSKL 4B9VA 1RTZA 3HF5A 3DC2A 1O0PA 3L9ZA 4FF3A 3IFEA 4J9PA 4ECQA 2FHKA 4HHUA 5KFFA 3A8KA 5E7OB 1VRTB 1EIYB 1N32F 3U7JA 4ZMMA 2K29A 3P96A 3J7Z5 2HS4A 3GIIA 4LF7F 3KMQA 3ITHA 3ZZOA 2KFNA 3M8SA 1JB0C 5GAHI 3ITHB 2QV6A 3ZZTA 4ILRA 3L7OA 4NMLA 3SZ2A 4DPWA 2Q3PA 4F04B 1VRQC 3IR6B 1HW9A 2QYGA 5DG9A 2D7SA 1TKDA 3H8YA 5K8PA 2VG6A 1R0CB 3H40A 3BN7A 1EB0A 4WJBA 1NK8A 4O3QA 3ZNUA 4JI4J 2A3JA 3SQGA 4CYUA 2OPRA 2JXGA 1SJ1A 1VLOA 4IQMA 4TYBA 4CM2A 3EYZA 2J9DE 5E3CA 1KS2A 2HWIA 2CA9A 2A6OA 4HEA9 2GFFA 1CBKA 1S57A 3T6BA 2YKQA 1OY6A 2YNIB 3QSIA 3LOUA 4YUDA 3CCZA 2GVZA 2YKOA 2MXYA 1REGX 3KHLA 3DOLA 3T6JA 2YWKA 5L1KA 9RUBA 1M1KT 3ISND 3I0RB 3QO9A 3KLGB 4ZLLA 1SH3A 3QPIA 1ZTTA 2HURA 1XIQA 2J0XA 3I0SA 2Z2YB 4X4RA 3MFIA 3RB4A 2FC9A 2FY1A 3HP6A 1IQZA 2B9YA 2I0XA 4G1QA 3GFZA 4ZHRB 2MB0B 2J6TA 4W98A 2AMCB 2I38A 1Y3KA 2YX7A 1N5QA 1P1LA 1W7WA 1EETB 1T11A 2V8HA 2W1BA 4EO8A 5KT2A 2ZJQQ 1U1PA 1VQKS 2EK1A 3BQ2A 1VR6A 4EMDA 4IOBA 2LLZA 1RYRA 1KQSR 3Q8YA 1KN6A 4OZNA 3T5HA 3W66A 4USJC 4DDFA 5AJ3F 5KFSA 1RHRB 1FFWB 1IR2A 5AT1B 3T3FA 1KC8T 1LQ9A 3PY8A 1G1XA 4USUA 2R8HA 3KUHA 4HL9A 1VBXA 4Q8FA 4J9MA 3H2VE 1NPRA 1W2IA 4UZBA 4DUYF 5K8MA 4DV2F 1IM4A 2I1RA 2HQDA 4ICLA 4ZP7A 2HGMA 2XHCA 1CULB 2E1AA 3A8IA 1NCLA 1U0HB 1TVRA 2NXCA 5C24A 2Y8YA 2WBRA 4FYDA 4FXVA 5KTQA 1R3NA 3FNNA 3GZ7A 3N9UC 5DM6Q 5CAAA 7AT1B 1JX4A 4K7QA 4LF6J 3BDPA 5HBMB 2AYMA 2QIFA 1M5VC 1D1UA 4DV5J 2W2MP 1N0UA 2GCFA 1TQLA 2LVWA 3QGGA 1JLCB 3G4SS 5I42A 2VG6B 3BZQA 3LALA 5DETA 2KZZA 1WF2A 5LMUF 2XG8A 3BSOA 1PJ6A 2AEMA 4PAAA 3TVYA 4CO5A 1M90T 3SQGB 2UU9J 1P94A 4LF9F 1WOOA 2RDIA 3D5MA 3LW5C 1FKPB 4HTJA 5I42B 1S77D 1KWMA 1WG4A 2J0WA 3AOAA 1IBCB 3E01A 1FRMA 5KFVA 2OH2A 1T94A 4DG1B 4P74A 2XGQA 3P4UB 4ED0A 3A4TA 4A8FA 2NR0A 3R27A 3C6TA 4ZVTB 2CQ1A 1VRUA 5KFWA 4HTIA 2OEKA 3MMAA 5C2GA 3QWPA 2YY3A 3FSYA 4AAIA 4RW7A 2U1AA 1WC1A 2QLWA 4Y2KA 2YWHA 1U1QA 2HNYB 3A13A 4DV0F 3H59A 3R1LA 3QRQA 2V8GA 1OJ4A 4DPYA 2YH0A 3T19A 3QAUA 2G1DA 1P1TA 1EETA 1HQ2A 2ZVIA 2CVIA 2DISA 4LSZB 5IC6B 3OHAA 3KOAA 1KRPA 1DLOA 1S9FA 3JSRA 1SC6A 1R0AA 1IRQA 4R25A 4U9RA 1S1WB 5KG6A 1D9DA 4B3MF 4F3OA 5HO4A 1EARA 4LREA 4F0HA 2O01C 3PW4A 2JEIA 5AJ3J 3KUGA 2XNQA 5IZHA 3HSGA 4HKQA 2LXUA 4DV1J 1YITS 1UJ4A 1MROB 2NZCA 3I32A 3M8WA 2ILYA 5F3TA 1N5YB 3CCQS 4CCHA 3DGVA 1OY8A 2CPHA 1FD8A 1BQNA 2G0CA 4E98A 4MKAA 2BKOA 1LW0A 4ES2A 2W24A 5ETQA 3ZZPA 1HYSB 2CQ3A 3OXFA 2MGZB 2J76E 2W4CA 2XQCA 5HL7Q 5B0EA 5A2QU 3RB3A 4ERDA 1RT6A 2CFXA 2LA4A 4C11B 3PX6A 4O3RA 1YZ6A 5HATA 5CCMA 1FRHA 2BUNA 1NO8A 2RRBA 5EX3A 1UVJA 4A47A 5AXKA 4F4XA 3MURP 3MPYA 2H5JB 5KFJA 4CLLA 4F3MA 2K3KA 3HZEA 2DY9A 2GAHC 2IFXA 2Z2ZA 1HIYA 1IWAA 1ZYQA 2HQIA 2FVPA 3G8TA 3RJMB 5KFKA 2M3DA 4WFBQ 1JLQA 1DARA 1MWQA 1XK8A 2OKQA 1N36J 1K44A 2EW9A 1AYEA 3OL9A 4P2XA 5HVFA 2QG9B 1RHKB 1RT5B 2W2NP 3NOGA 4I64A 4NL5A 4DFPA 1JNZB 3TAMA 1DTQB 1VK3A 4Z7YA 2J0SD 1CS4B 2GJIA 3BO4A 3J81j 2P9CA 2ZH7A 4E8UA 2HHWA 2XI3A 3HX9A 3PNIA 4C8YA 2KRRA 1ROFA 2AY0A 3SI8A 4DR2F 2NSCA 5B0FA 1ZM9A 3DXBA 3C19A 3Q83A 4PEOA 4ID8A 4KHMA 2DRAA 3CC2S 3PW2A 2EVZA 4RNNA 4Q0BA 2P9GA 2KL8A 3DRRA 1FX4A 4DXLA 1F3FA 2XLJA 1WTBA 2HNDB 1Q5YA 1NSPA 4DV4F 2YVSA 2ZKTA 1QUPA 2JC1A 4PG8A 5JUMA 4RNOA 4DR7F 4OI1A 4QWAA 1H7XA 3WBZA 2LQ9A 4OIXA 1F5AA 1M1GA 1YGYA 2HS0A 2JH3A 2RILA 3C6UB 5C25A 2EXUA 4BCAA 4CNZA 3QZ8A 1BQMB 1L3UA 1DRZA 2KT5A 3JS9A 3R1HA 2RF2B 1S10A 2ZH3A 1T95A 3ZZRA 1VBYA 2D3O1 4OZ1A 3IR7B 3LWMA 4X4OA 1HWLA 4P6QA 5D77A 4AD6A 5C7PA 3OD2A 3CW2C 2KXNB 3RR8A 4QIEA 1HA1A 1S1VA 1G7CB 3KHGA 4CDIA 4D3GA 1QVFR 2OO4A 2MJNA 3MM7A 1X5OA 4RLEA 4B17A 4URQU 1PJ5A 4A8SA 3SV4A 5B0DA 7FD1A 2HQCA 4DV7J 4Z7CA 2M70A 2HFUA 4L72B 3CJKB 2D9OA 3QT7A 1DQAA 4OYIA 3BO2A 3ENQA 1BDTA 3FVYA 4Q2LA 2ERRA 1U1RA 3OTCA 4KHPJ 1JLFB 2RSQA 1P9YA 1RT7A 1WORA 3L95X 4IH5A 1UL3A 5MLCV 1FJGJ 5F8NA 3RBDA 1SJFA 2V34A 1IKVB 2R7UA 5EN1A 3K0JA 3MWBA 3VVUA 1H6KX 1VHFA 3CCTA 1JLQB 2G13A 2P6SA 4GO7X 4AE5A 3CEDA 3T1YF 2YH1A 4L3KA 1ACMB 5GAGI 5LT5A 2BE2A 2OD6A 3HHLA 1BE4A 5CH7B 1DQ9A 1Q1KA 3ENAA 4KV8B 1S6QB 3I4HX 1B64A 3KLVA 4FXWA 1HNXJ 4C9DA 1F3VA 4WFXA 1T9TA 2ROGA 4CH1A 2KT3A 2CJ9A 5KFRA 3J7YU 1S9GA 2PA3A 1GXUA 4NI2B 3R2DJ 4TQSA 2DJWA 3BQ1A 1S7HA 1X4AA 4RU9A 3V81B 4DSLA 1CQNA 2J7WA 1REVB 4RPFA 1UFLA 3TA2A 3B6BA 4X4QA 2XY7A 2HRUA 3PO4A 2FVSA 2X1FA 3KNGA 3QATA 2NPFA 1RWXB 2C1EB 4DQPA 1X5SA 5LM7E 2FD2A 2QSFA 1T9XA 3BSCA 4IO9Q 1HNXF 5E2QA 3D1OA 1N33F 3GILA 4YDXA 4C8LA 2OTJS 2ZH1A 4K8RA 3JSMA 4GC7A 3KLEA 1WF1A 2PGCA 5L38A 1LKZA 2GMHA 2YWWA 4L6V3 2HGLA 2RF2A 3CPWR 4ECTA 2WVEA 2EFVA 3EZUA 3GWCA 4NXMF 1M5OC 1TUGB 4XK8C 1RT4A 1F9FA 4U7UD 4OYWA 4OHYA 3V5RA 4LQ9A 2UVWA 3UD5A 4KAIA 1PILA 3H2UB 4OHVA 3U1LA 3G71S 4KGXB 5GMDA 2LU2A 5J1PA 1FDDA 3TZZA 2EC2A 4RJVA 3X3UA 3EPGA 2HZCA 1NPPA 5L8RC 3TWZA 1QSLA 1R6VA 2OPSB 4W4MA 2DNPA 4NYOA 4USTA 3OXLA 1SKRA 4I7FA 3OR2A 1RBOB 4B9MA 2RUSA 1FHTA 4J9OA 5D15A 2KFZA 1RE1B 2JRSA 4C3KA 1HFEL 4A8YA 1KLMB 1I6JA 2F63A 3R5BA 5D0HA 2ABYA 4DOZA 2IVYA 4ZP6A 2MZ1A 3FGVA 3M6XA 2NUHA 1XMQF 2MZRA 2E5GA 5KG1A 2W7OA 3RTVA 4A8QA 2M4MA 4B02A 2VKRA 3JTOA 4C48A 2W8LA 2FLNA 3HJVA 4AL5A 3QBCA 2ATCB 1RBLA 3KJNB 2AX1A 1RHUB 4JV1A 2N7YA 2Q6BA 4R5PA 2JXIA 2ASJA 4LF1A 4IRKA 2F9DA 1DY3A 2Y3YA 5DJBA 3VR1A 2DGTA 4YB1P 4AQYJ 2QLXA 2N4DA 4F4AA 2DNRA 4KV8A 4XTTA 5A8KA 3H4DA 3CUNA 3IBWA 1C1BB 2P2CB 2VU5A 3FUYA 1RXOB 4BWMA 5LXYA 2N3OA 3BGLA 4ECUA 2CVEA 3GG0A 4FPIA 2JEFA 3DLEA 3AA9A 1HWIA 5E5NA 1F1BB 5DQGA 2O67A 2W2OP 2XMKA 3NCRA 4FN5A 4HH0A 1Y3JA 4OJ1A 4OJ3A 4TY9A 4ES1A 4UTGA 2EPIA 3AXKA 4CWBA 5KFOA 1H2UX 4GC6A 4EBCA 1R89A 1RT1A 5B08A 3H5XA 4QWDA 3BGOP 1SQFA 2K06A 1RTIB 2F65A 2HHUA 3KLIB 5DO2A 5KFNA 1UVNA 4OFZA 1SV5B 5DDQC 1HW8A 3S1TA 3LTOA 2ZKUA 3J80Y 3AJ2A 1L3KA 5KFXA 1X4EA 4ECWA 2HAFA 1S48A 2DCUB 3I6PA 3UDVA 3KHHA 1TAUA 1YRXA 4RW4A 4OZ5A 2JC0A 3POTB 3S6EA 1RT3B 2PMZD 4C0OC 3ET6A 4L74A 1YJ7A 3DOKA 2FVCA 3N5BA 3DN9A 3TX0A 1J2VA 5GMEA 3EUNA 4I2QA 4ZLNA 4Q43A 3TARA 1LEOA 4ZVQB 3MFHA 3KLGA 4B9SA 3C15A 4X4NA 2CG4A 2GO9A 3LQVA 1UVMA 3TZWA 4LRFA 2EBEA 3M2RA 3KYLA 5EX0A 1LXNA 1WC5A 4F02A 3JTPA 3ZTQA 3DLHA 3HPOA 2OSQA 1ZAXA 4MAKA 3AOBA 4C8MA 3GJTB 3U27A 4A8KA 2XY5A 1FJ7A 2DYAA 3MPDA 3QQCD 2F40A 4KIAA 1YIJS 2DBBA 1AUDA 4HI2A 3ISNC 2B4UA 5SZTA 4LIWA 1KOHA 1VJWA 5F9NA 1J5EF 3GIRA 2BEFA 3WX8A 4O3OA 2YNGB 1TP7A 4DN0A 2UXDJ 3KKFA 4OJGA 5CA5A 2R8KA 4PRFA 2VF3A 3CJ8A 2Y0BB 1MYLA 1V5VA 2L41A 2CZ9A 3QGHA 1NSAA 1Y11A 2G0JA 3MM8B 3W9JA 4ATNA 2W01A 2ZH2A 2C3UA 1S0MA 3CTRA 4B3RF 4WCEQ 4F4YA 4DSIA 3BDEA 3HO1A 2A2DA 4I2PB 2C2RA 4M1KA 2MMYA 5D4OA 3Q2SC 3QOQA 4N8OA 1N34F 2C2KB 4LRBA 2EKNA 4YP3A 2XM3A 2HFNA 1RUSA 4ZCKA 3WHIA 5GADU 2IAJB 4RW9A 4EK2A 3TJAA 3EPIA 4NYZA 4K50A 2W4DA 4F7VA 1UPPA 1MG7A 2OIHA 5HBMA 1CG2A 2IYIA 3PM9A 4YMEA 1GXTA 4M5MA 3K5LA 1TV6A 2DITA 1BQNB 4Q5VA 1QSSA 1S0VA 1X9WA 3K8WA 4X4UA 1FNXH 1OG7A 1ZAVA 2YKNA 4HYKA 2NZ4A 2BKNA 2FZCB 2B7CB 1WELA 1S1XB 1RU2A 3ILOA 3MR2A 2HKEA 2ZWPA 3EGVA 4LRCA 4YR3A 1FI4A 4QWEA 2VC0A 1PCAA 3CJ3A 2FVQA 1MNTA 3ILIA 2ADLA 3M30B 4HVZA 4U67Q 2ILZA 2CQGA 1VQ4S 2QA2A 3PVXA 4IH7A 4NLVA 3OFFA 2CJQA 1U45A 4WXOA 3RRHA 1JJHA 2YQ0A 5ETNA 1ITPA 4ZLPA 2DEJA 4WYLA 3VZIA 5KFHA 3HKZD 1HBOA 4LSNB 5KFPA 2DIUA 1HD0A 3KLHB 3GV5B 2C2NA 3TW0A 3TZXA 2RQKA 4JI2J 2QMWA 4H4OA 3WC0A 5LJ5Y 5HMZA 3K89A 1B0PA 4KT0C 3UE2A 2IM3A 1NJIT 4C8OA 2PSZA 2XMVA 2XSJB 3IO1A 2WW4A 2OLWA 2RS2A 4MYTA 4FYWB 4MMOA 1NUEA 4RUBA 1UAWA 3HVTA 3ELHA 4PPZA 5E33A 2R2TA 2FLPA 3IWLA 3UR3C 1M0SA 4DX7A 2HNDA 2LQJA 3QGIA 3W9HA 5LSOA 3OW2R 2BW2A 1XMOJ 3NNEA 1N56A 1FXLA 4YHHJ 3MEGA 2ZJRQ 2CPZA 4HDGA 1UZHA 2HVZA 4IG3A 5K8OA 3C6UA 3KDOA 3FRZA 1DJ0A 4RW6A 3Q8SB 4BDPA 5ADZA 2UZAA 4NXNJ 3FBBA 1N52B 3PRDA 1FRKA 2VH7A 2Z0GA 3CCWA 1WHVA 5IT4A 1KVKA 1W26A 4OX6A 2AIRB 4OHXA 4DI6A 1HMVA 2QX0A 4RNMA 1ZBTA 4CTAB 4UQGA 2GVZB 4M94A 2VQFF 2JVOA 3NWRA 2QFJA 2OFHX 1AB8A 2FTRA 3C3LA 2EBGA 3P6YC 2V69A 3I55S 2VPZB 1Y5NB 4J9VA 4P7TA 2DHSA 1S59A 1VI7A 3RW6A 4A8WA 1IKYA 3UO0A 4B3MJ 1HYSA 1RWMB 1NHVA 5HI7A 4Q8EA 2BYCA 1T9WA 1U9PA 3TQ1A 1S0OA 2JEGA 1E6YB 1RLCL 2QMUB 3HSJA 3W60A 4A8MP 2AV5A 2DGSA 4UT4A 2C28A 5DG7A 4NLOA 1IJFB 4RO0A 2PI5A 4DR4J 5IC4B 3PX0A 2BMBA 2X1GA 2W7AA 3ULHA 4NZ7A 1MU2A 5KFMA 1VC0A 3UN2A 4ZVGA 3GXQA 1KKHA 2YBVA 5J1EB 1CQMA 1HNIA 3W2VA 1PAUB 5F8HA 2CRLA 2QL5B 3NO7A 1CLFA 1H98A 4P71A 1N6QA 1R43A 3M8PA 3MCOA 5M2PA 4RWXA 5I3UB 3DI6A 3QNWB 1XMBA 2IJRA 3IGVA 5G0RB 3JQJA 2LFVA 3RBXA 2WOMA 4DV0J 3C46A 4WBFA 1B4SA 1BQXA 3DNCA 4ZPWR 1TFWA 2Y8WA 2VV5A 2NREA 3MOJB 1Y5LB 4LRAA 5CZVA 5JMNA 2QLFB 2ZWOA 2GHVC 3HHLC 1OPIA 1FRJA 1UJ6A 2V94A 4LMZA 1YLXA 1FRLA 2CNOB 2LMIA 2J8SA 5DDPC 3L3CA 3WC2A 1VDHA 2R8IA 2W2QP 2DGQA 3DM2A 3EGNA 1IBMF 1N0VC 4LBPA 3BJYA 2H51B 3N5FA 1RT2B 4NLTA 4W90B 1EAYC 2GW8A 1Y7PA 4ZOSA 2KI2A 3TX8A 2HSEB 3J80U 4B9UA 3UN5A 4R8UB 2FPHX 5C42B 5IWAF 1AFIA 4FYYB 1DTTA 3TEGA 2KELA 1RWPB 1FKOA 1OSDA 2BOAA 3D1QA 4DV4J 1HNVB 3NAIA 5J2MB 4DQQA 4B3OB 2HHPA 3PKMA 1WC6A 4DG1A 2ZC4A 2UXDF 3D0HE 2L9NA 4DF4A 2DNYA 1RCXB 3WIVA 2JVRA 2LQBA 2LQ8A 3LP0B 4KY3A 3LO3A 3M32B 3JSBA 4RBVA 1O5JA 4AUKA 1KP6A 2W9CA 1NJZA 4NLWA 3PJWA 1TK0A 1M1HA 2MY8A 4K4UA 3HHKA 4HT5A 4UW2A 4B9LA 1VFJA 1SKWA 3IBCB 3KLFA 3DLKA 1HI0P 4M5IA 4DR6J 4NLPA 1H7WA 3C16B 3EVMA 3DOMB 3VEBA 3GR1A 1SJ3P 5BJRA 4NXMJ 1XR7A 1RJJA 1HQUB 2XTJP 4CNYA 2D9PA 2IDLA 2RIJA 1NZ8A 4HACA 5J2NB 1SVDA 3E8OA 2ADBA 1NKEA 1UVKA 2RDJA 2HHHF 2DGOA 3PW0A 1TU0B 2H5IB 3KHRA 5J2NA 1PSDA 3CJTA 3GP9A 3EX7B 4DQRA 1JXVA 1M5SA 4MFBB 2HHVA 3PIOQ 2GMLA 3I5CA 5J2PB 2GIQA 2XZTB 2CQ2A 2MQPA 1YJNS 2JSXA 2I5JA 4ED2A 1UA1A 2X3GA 2CXEA 3QFWA 3V4MA 1U6ZA 2V50A 2W9AA 2VICA 4C8KA 2UXCF 3ZC4A 3EGWB 5KFDA 4OYMA 1WI6A 1MYKA 3ZTRA 4NRUA 1U1LA 2QFIA 1UEUA 4H4MA 4P72A 2XNRA 2QN6B 5K14B 3N6NA 3OL8A 3R3TA 3EE3A 3DLJA 3T41A 1GMUA 5IXUA 5HQMA 1CPZA 4X66J 5GAEU 2A6MA 4ER8A 4AQYF 3VCDA 1LWFB 1UCNA 4MYUA 4NPOA 4PYDA 4YB7A 2QJ3A 5ETVA 4LFBF 3IA0A 3DLGB 4O4GB 1VCTA 3IXQA 2BABA 3QRPA 1UMJA 2V4JA 2HLTA 1XNQF 3DRYA 2K2PA 1FKOB 4JI4F 2Q79A 2KHCA 3BREA 4IFVA 1NSQA 5IWAJ 3ET6B 4BC7A 5L9NA 3T9ZA 4I2QB 2QLBB 3CJSA 1F0XA 4I1TA 4ANEA 3Q23A 3NL0A 2K7KA 2XMTA 3HSZA 3NMAA 3R97A 4CLTA 1ZH5A 1WC3A 3M2RB 1G6BA 3I0RA 2R2RA 1EZZB 1HBUB 1RT4B 2HFZA 2CQHA 1B28A 2OEJA 2V9KA 1WI8A 2AKWB 2VPXB 3BEGB 4O44A 5KOWA 4KKOA 4Q44A 2HHHJ 4RNHA 2IMWP 4EYIB 1I51B 4FBUA 4OL8A 1T02A 2MLYA 1XQIA 4ITSA 4ECSA 1KQFB 2HIQA 3VGUA 2DGVA 3FT7A 1PARA 4KC5A 4UOCA 2ZM6F 4G65A 2EK6A 5HQLA 1RTDA 2IMOA 3WX4A 3D9BA 1S1UA 3CE8A 1KBRA 4CT8A 1N4LA 3R7NB 1X4DA 3J7AN 1HQUA 2CQDA 6FD1A 1CSJA 2JFKA 1MN9A 2MKCA 2W7PA 1V3ZA 2EKYA 3MMCA 2VG5B 2YNFB 4OX9F 5E3AA 1SL1A 1WNEA 1GQEA 1UP1A 2CQPA 1WKKA 4PWUA 2BA3A 5DZ6A 1PG5B 5ETSA 5KG2A 3G6ES 1HLWA 2BW7A 2K5JA 3CJ2A 3NEKA 4FYVB 2ZNYA 2E44A 2QRRA 1Q7YT 2XO7A 3KJVA 4WK1A 4C7QA 2BRKA 2JJ4D 4P52A 4YDDB 4JP8A 4QU6A 1K0VA 2UUCJ 1HWKA 3OLBA 2IHR1 2JHEA 2AJFE 4JV5J 1S9EA 2IAJA 4RW9B 4BWJA 4FZVA 4RUAA 5C24B 1JQGA 3MEEB 4TLQA 4J9LA 1WUUA 3DKDA 4OMFG 1N54B 5ETTA 3U1MA 4DPTA 4I2PA 2RKIA 2K1RB 3M9OB 4QCLA 2PEHA 3H90A 5E3PA 1VBKA 3OHBA 3UD3P 4C4WA 5E3RA 1WDTA 1YDLA 1X31C 4P9SA 3QLHA 5CYQB 3W8PA 2DGXA 4CLFA 2VQEF 2XMJA 2CJBA 1Q86T 1Y00A 2R7VA 1UZDA 4QYZJ 1GH8A 4ELUA 5A8WB 2AGQA 1D0EA 2V4RA 1FVQA 1IKXA 4JOUA 3MXHP 4CLKA 4FBTA 4QW9A 2B4OA 1R8PA 1EJ7L 2DNNA 3NCPA 3POTA 3T1HJ 3DOKB 3KJFB 4ZVPB 1NK5A 2DNHA 3UFCX 2RH3A 3ENWA 4ZN3A 4ZPDA 3IGNA 1ZTWA 1WC0A 3IR5B 2V68A 2R7SA 4TNOA 1SIWB 4MH8A 2HHXA 3DYAB 1U47A 3G82B 5IT9U 1RCOB 2HQGA 3KK3B 1KD1T 2XCAA 3RB6A 2KRBA 2NPIA 5B7WA 3H4BA 1B0TA 2CQBA 2XO6A 2MEWA 1TKXB 2B6AB 1DTQA 1RA7A 3GTYX 3TP2A 4H4OB 2BQUA 2BJ8A 1ZZFA 4MKVA 5E3QA 3I56S 4F4WA 2NLWA 2FGCA 1MNEA 2YTCA 4JUZA 1U48A 2DNZA 4PWWA 3W65A 3I5BA 5ETRA 5A0YA 1BAZA 4B3SJ 3K5MA 3U02A 2WZ1A 1YBUA 2BQRA 3M2UB 3MM6B 2EFPA 4USVA 2CQ0A 2ZD1A 3UNYA 1YSJA 1S97A 3V6DA 3KFWX 3AD8C 2J6UA 2FLLA 2DB1A 2VB6A 3IM8A 2APOA 3MECB 4EGLA 3JYTB 2ZD1B 5L1JA 4N5SA 4IRCA 4C6AA 5H9FK 1TZ0A 4ZCMA 1K47A 2V2KA 2Y1IA 1YVFA 2M7SA 3D7SB 4CTAA 5AE2A 1BGXT 1E6YA 4WPAA 3I5AA 4H4KC 5T7LA 3KLFB 2D1CA 4IDKB 4Y2CA 2J8AA 3FZ2A 4OYZA 2C2OB 1FDBA 2LA6A 4CRJA 3M8QB 1KHWA 4NLYA 4ZVUB 2R2UA 4Y28C 5DGBA 2AYBA 3FMTA 1NZAA 1YJVA 1URRA 2WCXA 4KYZA 4OI0A 3QJPA 2C42A 4NASA 1WC4A 1NB7A 2RBFA 4CO2A 3K8VA 4QIWD 1TAQA 3QIDA 3LAKA 2K7JA 2OD4A 1FNMA 3UNGC 5L39A 3CIMA 3J7ZT 3VQSA 1E6VA 3CDBA 4OX8A 2UVVA 3HKWA 2AX0A 4DL4A 2FHMA 2M8HA 5C2CA 1TMJA 2F8HA 4U8VA 3K58A 2XY6A 2XCPA 1UVIA 4DWIA 1E6VB 3KLHA 1JLGB 4OZJA 4IR9A 1SIWA 5I4MA 2ZZMA 4YEAA 4ED1A 3WQPA 1XR6A 3FFIB 4LFAJ 4F0MA 4J9RA 2PFFB 4H4MB 4JI0F 2HWTA 2E1MC 1NNDA 1T8EA 2HHTA 4TN2A 4WFAQ 3CWJA 3K7RA 4PCQA 3FMWA 4LVOP 4C3MA 5H9EK 1SUQB 4FYXB 2VOOA 2POKA 3BKFA 4IR1A 4N8NA 4ETXA 2YWEA 4ZJQA 2EC0A 1U7LA 1IBMJ 4MKYA 2F4VF 2GQCA 2WSFC 1XC9A 2BV3A 2KU7A 4DCJB 2HW3A 4ENOA 2BZ2A 4ANCA 2V8DA 1M5HA 2DO4A 4X66F 3VAMA 3H5UA 4EO6A 1R8AA 2PEBA 5DLGA 4K4ZA 1I3OB 4IOCQ 2J0QD 2GS8A 3Q22A 3CC7S 5ETKA 3VAGA 2HZVA 4GVBA 2IBOA 1YG0A 4ZPCA 4FF1A 2E5JA 1B01A 1B7YB 4BS2A 1BLUA 3GIMA 2ROEA 1EQMA 1FCAA 3R8YA 1KEKA 4FNHA 2RD5C 4DX6A 1KONA 4TU8A 4ZPTR 4J5OA 1JLAB 1FEEA 5K5MA 4R5PB 2HNZA 4K5RA 5HMYA 2NYHA 5KFYA 3QSYB 3QAEA 4ED5A 3EXCX 1ZM2A 1S6PB 1WEXA 4YB5A 2VBWA 3G86A 5HJXA 1VRTA 2V63A 5A6WA 5L9XA 1FTCA 4ZVFA 1FESA 5AE1A 3UVJB 4JI6J 1RAHB 4QYZK 2ZHBA 4KPCA 4DFJA 2QMXA 1IQTA 2X7IA 3SMZA 1K1QA 3M8YA 2CPYA 3KMSA 1YJWS 4DL2A 4C98A 4DZ6A 7FDRA 2MDAA 3R5JB 4F4ZA 2BXJA 3DU5A 2X51A 4DR2J 4Q7AA 5IS2A 5HK4A 3NGUA 3U1NA 5HROB 1YQHA 1U2CA 1G4CA 1TV6B 3K5NA 2FY8A 2N3LA 1SV5A 4P73A 2IRUA 3C14A 1IJEB 1SKSA 1S1TA 4U96A 2ZH6A 2VD3A 1HBNB 2OPQB 1CJVA 1FRIA 1SC4B 3HM9A 2IM1A 3IWNC 3IRXB 2AGOA 2DPIA 2C2MB 3CJQA 2AQ4A 3NNAA 4CLSA 3NWGA 3HZGA 4FVMA
chains in the Genus database with same CATH topology
2K5JA 2BJ8A 4FXEA 2H1OE 2JXIA 1IRQA 2WVBA 2Y3YA 3BKFA 2HZAA 1U9PA 1QTGA 2FGCA 2PC6A 1MYLA 1EA4A 2GPEA 1MYKA 1MNTA 3FMTA 3LGHA 2WVCA 2HZVA 1B28A 1Q5YA 1BAZA 2NZCA 1BDTA 1Q5VA 3VEBA 4D8JA 2RBFA 1B01A 2BNWA 2BNZA 2BJ7A 1ARQA 2K6LA 1NLAA 3H87C 3QOQA 3GXQA 2CAXA 3PHTA 2KELA 3FT7A 1PARA 3BKUA 2BJ9A 2CADA 2CAJA 2CPGA 2JXGA 3VEAA 3VW4A 1ARRA 2CA9A 1BDVA 2WVFA 1P94A 2K9IA 3OD2A 2JXHA 4HV0A 1X93A 2BJ3A 3BKTA 2F1FA 2BJ1A 2K29A 3QSIA 2WVEA 2AY0A 2BA3A 2BSQE 2WVDA 4ME7E 2K1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5J A;  2BJ8 A;  4FXE A;  2H1O E;  2JXI A;  1IRQ A;  2WVB A;  2Y3Y A;  3BKF A;  2HZA A;  1U9P A;  1QTG A;  2FGC A;  2PC6 A;  1MYL A;  1EA4 A;  2GPE A;  1MYK A;  1MNT A;  3FMT A;  3LGH A;  2WVC A;  2HZV A;  1B28 A;  1Q5Y A;  1BAZ A;  2NZC A;  1BDT A;  1Q5V A;  3VEB A;  4D8J A;  2RBF A;  1B01 A;  2BNW A;  2BNZ A;  2BJ7 A;  1ARQ A;  2K6L A;  1NLA A;  3H87 C;  3QOQ A;  3GXQ A;  2CAX A;  3PHT A;  2KEL A;  3FT7 A;  1PAR A;  3BKU A;  2BJ9 A;  2CAD A;  2CAJ A;  2CPG A;  2JXG A;  3VEA A;  3VW4 A;  1ARR A;  2CA9 A;  1BDV A;  2WVF A;  1P94 A;  2K9I A;  3OD2 A;  2JXH A;  4HV0 A;  1X93 A;  2BJ3 A;  3BKT A;  2F1F A;  2BJ1 A;  2K29 A;  3QSI A;  2WVE A;  2AY0 A;  2BA3 A;  2BSQ E;  2WVD A;  4ME7 E;  2K1O A; 
#chains in the Genus database with same CATH topology
 2HVI A;  4M8L A;  2W4P A;  3KK2 B;  2B43 A;  4JI1 F;  2ZNZ A;  1RAF B;  2JLE A;  3L4B C;  3P45 B;  3RG6 A;  4FF4 A;  4MTP A;  2VBX A;  2VL1 A;  5EUH A;  5HQ8 A;  3THV A;  1IBK J;  2CWX A;  1OMS A;  5HMW A;  4QPT A;  3MD3 A;  3N4W A;  4ID5 A;  4ILM A;  2F4F A;  1WSR A;  3UDC A;  1VRU B;  4RU2 A;  1X4G A;  2KOE A;  3K57 A;  2OJ3 A;  4DX5 A;  5GMK a;  1URN A;  3DOM A;  2MYF A;  4OZ0 A;  2VG5 A;  2YNF A;  1WKL A;  3VEA A;  3QYY A;  4FPR A;  4ZVH A;  2YKM B;  2Z56 B;  1R8H A;  4F0K A;  3KG4 A;  4AL6 A;  3MZI A;  3RZA A;  1VQO S;  3HI9 A;  2QEX S;  2D3Z A;  2CDR B;  4ZJO A;  1YBA A;  1U25 A;  2NXN A;  3GJQ B;  3PXG a;  3MAQ A;  1ELO A;  3VAJ A;  3AQP A;  1VQ7 S;  4DV3 F;  3MEG B;  4ZS6 A;  1SJ4 P;  1NB2 A;  2AD9 A;  3PYF A;  1ZOT A;  2Q6C A;  1JIH A;  1KHV A;  2XBP A;  2KYX A;  3O8W A;  4IO1 A;  1RAI B;  1K73 T;  2M9K A;  2COL A;  2ADC A;  1Q82 T;  1IKW A;  3A3N B;  3QFH A;  4UUX A;  4DU7 A;  4KGM A;  3FC9 A;  3MOZ A;  4TYA A;  3RBE A;  3MM5 A;  1AXQ A;  1C1C B;  3CF5 Q;  1XTZ A;  4PUO A;  3V2U C;  4RR5 A;  2GIR A;  2VDI A;  2EI5 A;  1K9M T;  1S4E A;  1XEZ A;  4DV1 F;  4WK3 A;  2DR9 A;  4OJH A;  1IN0 A;  2ZHO A;  1NPK A;  2VBY A;  1OYE A;  1SBR A;  5K8N A;  4V19 J;  3NNH A;  4WFN Q;  1ZS6 A;  2HBZ B;  2DIV A;  3EM1 A;  4LR7 A;  4RBT A;  1LNQ A;  1FWP A;  4KHR A;  4J37 A;  4F36 A;  1XWL A;  3FCH A;  4KGZ B;  3CJR A;  1KTV A;  2JL9 A;  2HS3 A;  4Z2X A;  3GMG A;  1DAX A;  1LWE B;  3AH6 A;  3M8Q A;  8AT1 B;  5IT0 A;  3DGP B;  4Y2M A;  1TL4 A;  4FS2 A;  1TEL A;  4B3S F;  1OSC A;  2DEI A;  2G4B A;  3FZB A;  4LF8 J;  4GMK A;  4ED3 A;  3IG1 A;  4ZVS B;  3VGS A;  4DPO A;  5LOQ A;  3G6V A;  1IM6 A;  1S6O A;  2CPF A;  2ZBR A;  3HHD A;  1YRT A;  2DY1 A;  4NLX A;  5SUH A;  3RW7 A;  5A8W A;  1T03 B;  2Q1L A;  3UCZ P;  3PEH A;  1RIS A;  1VBZ A;  1QE1 B;  4O4R A;  2K6L A;  2CAX A;  1FE0 A;  3R2C J;  2XC9 A;  4ZKA A;  5GAE I;  1CJU B;  2CAD A;  5A6P A;  2KXF A;  1PYO B;  4DQS A;  1GTH A;  1GX6 A;  3CMA S;  2YWG A;  2CUY A;  2B9E A;  4Q45 A;  4JYA F;  4RX6 A;  4XDD A;  1NH8 A;  4DN9 A;  4NLG A;  4OZ3 A;  2LQ5 A;  2B8P A;  1CS4 A;  5F0U A;  4FXE A;  1P27 B;  2ASL A;  3UN3 A;  1UJ5 A;  3D66 A;  3DXS X;  4PKD B;  3RU0 A;  2BM0 A;  5E41 A;  3QZ7 A;  1SUQ A;  2FGO A;  3F0N A;  4HH1 A;  3CCU S;  3RB0 A;  3G5O A;  3MM6 A;  1U6B A;  4K4V A;  3I87 A;  3W2W A;  1Q16 B;  2CNL B;  3IP0 A;  2IY5 B;  1MW7 A;  5A2Q Y;  4OZ2 A;  4NEY A;  1FK9 B;  1QSY A;  1FFG B;  2IRY A;  5BYQ A;  4LRV A;  3B78 A;  2E7X A;  3VQT A;  1X0P A;  2DT9 A;  4LBI A;  2M88 A;  3ISZ A;  4OHW A;  5F0W A;  3BO3 A;  2GX8 A;  2MZQ A;  2ZHA A;  2ZEJ A;  5F8J A;  3T9N A;  2BJ9 A;  4MIB A;  2E9R X;  3CT9 A;  1S1V B;  3M2U A;  3VW4 A;  4I6W A;  3RAM A;  4ZLJ A;  2AF6 A;  2MHN A;  4KO0 B;  3LPE A;  2QA4 S;  2GIF A;  3KDN A;  3PFO A;  4F4K A;  1EKR A;  1TL7 A;  6FDR A;  2IJF A;  4EBE A;  2HEK A;  4Y00 A;  1UFW A;  2E5L F;  3EDR B;  1TFY A;  3OSN A;  2MQM A;  2P9E A;  2YX4 A;  4RKU C;  5D4N A;  1X60 A;  2XS7 A;  2PO4 A;  2FZG B;  1S0N A;  4ZHR A;  1L3V A;  1D8Y A;  3OUY B;  2YWF A;  1FJC A;  3H7H B;  3MM7 B;  3DRS B;  3T5K A;  3CD5 A;  1OYD A;  4GO5 X;  2Y1R I;  1GK8 A;  1TR0 A;  2IVM A;  3MPW A;  2CPE A;  4IRD A;  1KQG B;  2ZH9 A;  3MED B;  1U26 A;  3GCW P;  3WDO A;  5IV4 A;  2WAQ D;  3AD7 C;  4GKK F;  2AYE A;  1TKT A;  2XMM A;  3N0V A;  4B9T A;  1FE4 A;  3F73 A;  1ICE B;  3MED A;  2MST A;  3IRW P;  4EU0 A;  2CAJ A;  2WOM B;  3BF4 A;  1PYT A;  1K1S A;  2V2V A;  4JV0 A;  3H25 A;  2VQE J;  5K20 B;  3TAN A;  2MTL A;  1I1G A;  3VGV A;  1KSP A;  3SFG A;  3HVR A;  4ELT A;  4QR1 A;  3PV8 A;  5FJ4 A;  4OQJ A;  3FK4 A;  2QGF B;  1RTJ A;  4DV7 F;  2J9E A;  5HLF A;  2ZBQ A;  3D3C J;  4ZVR B;  1ZZN A;  3BM7 A;  1LWC A;  2E7W A;  5B0C A;  1S49 A;  1NME B;  2QA1 A;  2MKI A;  1IXK A;  3GR0 A;  4K2X A;  4OX7 A;  3W9I A;  2AJ2 A;  4NX9 A;  1JWW A;  2NXU A;  4BLG A;  1S5Z A;  1U09 A;  4RL1 A;  1GTE A;  3Q24 A;  4YY3 F;  3NS7 B;  2UUW A;  2YQ3 A;  4USH A;  3OV7 A;  3PW5 A;  2PA8 D;  3PFE A;  4TLR A;  2UUA F;  3K17 A;  3ETO A;  3PYG A;  1N5T A;  4N76 A;  1Y5I B;  1GT8 A;  2E5H A;  4KQZ A;  2C2D A;  2C2E A;  3UCU P;  2GJF A;  2XZD B;  3CCJ S;  3HT0 A;  1Y0H A;  3IRX A;  3DHW C;  3FRY A;  4KGK A;  1RWN B;  3RGI A;  3M9M B;  4ED6 A;  1C2P A;  1RAC B;  2BOP A;  2LEB A;  3IC1 A;  4DV5 F;  3O3L A;  4F67 A;  1GAO A;  4Q2M A;  2MJU A;  4E0D A;  4ZIT A;  4EEY A;  3Q8Q B;  2M52 A;  2K1O A;  5D6G A;  3AJD A;  3PRV A;  4YOE A;  1NK7 A;  4FXD A;  4DFM A;  2CJY B;  1FVS A;  1HNZ J;  2GAG C;  3M9N B;  1X8D A;  2G2Y A;  1V3S A;  2RU9 A;  2NYI A;  2I8E A;  4I7F B;  5MAO A;  3I96 A;  2W9C B;  3KJQ B;  4M5D A;  2HFO A;  3RRK A;  4QR0 A;  4DLE A;  4DSK A;  3ZO7 A;  1AA1 B;  4WFY A;  1RTH A;  4C8N A;  3LP1 A;  1CC8 A;  2GQQ A;  1CJK B;  1NM2 A;  5H9F J;  3TZY A;  3H5S A;  2A2C A;  2CNK B;  4G1Q B;  4FKY A;  5D78 A;  2W9B B;  1H0H B;  1RTH B;  1UVL A;  1S76 D;  2FHO B;  1NHK L;  4K0K J;  1CJK A;  3HMJ G;  1XNR F;  1VS3 A;  1RK8 A;  4M5J A;  3LPY A;  4OLP A;  5J1E A;  2B5J A;  1RAO A;  1U6F A;  3C66 A;  4LRD A;  1FER A;  3CVK A;  3VTI A;  5GAD I;  1U2F A;  2C3P A;  4LFC F;  2IM2 A;  1OPZ A;  4WP8 A;  3CCV S;  2GQ2 A;  1RGV A;  3TA0 A;  5IOL A;  5G0R A;  2U2F A;  3GU0 A;  3TEH B;  5J2Q B;  2UUB F;  2ZBP A;  1YKW A;  2L9D A;  1Q81 T;  1J5O B;  2KKE A;  3A8E A;  1VQL S;  4X4V A;  1S9E B;  4EI2 A;  4AFF A;  4YS2 A;  5LSR A;  2E29 A;  2PFD A;  4DR1 F;  4A8X A;  4ECY A;  1RU1 A;  4EZ6 A;  5CZX A;  4NLD A;  2CZ4 A;  5CAB A;  1NLK L;  3DRX A;  5M2R A;  3Q86 A;  4NLS A;  3UI3 A;  3NRB A;  1C1B A;  5D3G A;  1QUV A;  1VGY A;  2XS5 A;  2J9C A;  1NRK A;  2B51 A;  3HJF A;  2WON A;  3FCW A;  2DNK A;  2MGZ A;  1FO1 A;  2OEM A;  3F41 A;  1XBW A;  1FKP A;  1AFJ A;  4PAB A;  4WU3 A;  3IWX A;  5DRK A;  2HRT A;  1C4C A;  4DV2 J;  3T5L A;  2RU3 A;  1XMO F;  4LF2 A;  2UUC F;  4LF7 J;  4M95 A;  3ZZY A;  2XI2 A;  5IQ6 A;  3OTO J;  2OGU A;  4ZPB A;  3QJJ A;  4I69 A;  3OVS A;  3C6T B;  3W5Z A;  2R7O A;  4EUV A;  4K4Y A;  4K2J A;  1TL3 A;  3O6Q A;  3R5G A;  3D6F B;  4G1P A;  1R8C A;  1HHQ A;  4NCG B;  5BYS A;  2VJU A;  4JI3 F;  1HPZ A;  1VYA A;  3LF0 A;  4KKO B;  1U1O A;  3E01 B;  5KG0 A;  4NWB A;  1F60 B;  4UY8 5;  2IJN A;  3H20 A;  4DBQ A;  3RYL A;  3PZP A;  3THP A;  3FCV A;  2KXH A;  3DCA A;  2D69 A;  1BC6 A;  3QT5 A;  2FUG 9;  3MAA A;  2B0G A;  5IM0 B;  2EFG A;  2WSE C;  5AE3 A;  1JLE B;  5JJB A;  3F44 A;  1O6X A;  2DH8 A;  3D0G E;  2B3T B;  3CSK A;  3MM9 A;  1PKU A;  3FSI A;  2LP4 A;  2AGP A;  1B3T A;  4XAK A;  1RTD B;  3R9L A;  3GG1 A;  4HV0 A;  1YRU A;  3RAX A;  2MSS A;  4IUF A;  3GQC A;  1JMT A;  1VJQ A;  2R4F A;  4CQ1 A;  5KFA A;  1JNR B;  2QZ8 A;  2Z58 B;  4ZDN A;  2X3D A;  1YJU A;  2DVI A;  4PZV A;  3GON A;  4J9K A;  3Q8R B;  4QJV A;  1IBL F;  4PUO B;  5IFM A;  5HVH A;  1S6P A;  3D4J A;  4NLQ A;  1R0A B;  2I5J B;  3W61 A;  1HKA A;  1SH2 A;  4TU9 A;  4UUW A;  2CQC A;  1PBA A;  2JX2 A;  2ZH4 A;  4IG0 A;  4JYA J;  2FIU A;  1TL7 B;  3CD0 A;  4CLP A;  4DU8 A;  4OI2 A;  2L3M A;  3TAP A;  3R6L B;  4WTY A;  2PE8 A;  1IBL J;  2YKN B;  5DDR C;  4QU7 A;  2HQF A;  2WBM A;  1S1X A;  3AB4 B;  2XUL A;  4K5S A;  3KG1 A;  4O4G A;  1RAA B;  2YKA A;  1J27 A;  4DUT A;  4LF5 F;  4UZC A;  2VHG A;  3J7A 1;  1N36 F;  4O23 A;  5RUB A;  3J81 Y;  3JAM Y;  4I68 A;  1BWE A;  5B0G A;  2KDO A;  2MY7 A;  3HXM A;  3H2L A;  3D6M B;  3HVW A;  2DNM A;  1RWU A;  1MU2 B;  1PO6 A;  1H3D A;  2B56 A;  2H4Y B;  1RWO B;  2ROP A;  4LR8 A;  2D74 B;  4X4S A;  2E9Z A;  2NUU G;  2RRN A;  3HHL D;  2F3J A;  4EYH B;  1IKV A;  3MCM A;  4HR2 A;  1WKJ A;  2F4V J;  4NZ6 A;  1P9Q C;  2EFO A;  2QTW A;  3CCM S;  1RDR A;  2AJQ A;  4ZPA A;  4FF2 A;  3JAM U;  1SL2 A;  2KJW A;  4DR4 F;  1NXI A;  1RTJ B;  1DBD A;  2VIH A;  1RWV B;  1UW9 A;  3JXO A;  3TJ8 A;  1BXN A;  2B6A A;  1TKX A;  4ZIV A;  3EZ5 A;  3CCR S;  1LWC B;  2QT7 A;  5DGA A;  3HFK A;  4F2R A;  1KVI A;  2KG1 A;  3Q8V A;  3D2W A;  3FEY B;  3UDE A;  1KDN A;  4WP9 A;  2LXI A;  4DQI A;  5FDL B;  2CPI A;  5BR8 F;  1U8W A;  2FC8 A;  2M5Y A;  2MQN A;  2XWX A;  3PAC A;  4NA3 A;  5EWG A;  2JLG A;  4EBD A;  1I94 J;  3HVT B;  1DLO B;  2CPD A;  2YKP A;  3M1V B;  2YNG A;  1EHW A;  1DTT B;  1OO0 B;  2FZK B;  1ZA1 B;  2MKY A;  5EGY A;  1IR1 A;  1ZPV A;  1BQM A;  1LXJ A;  3TQE A;  1HHT P;  3SBM A;  2VBZ A;  1CC7 A;  2JZ5 A;  1FF2 A;  4UOF A;  2NQP A;  1EQ0 A;  3NOC A;  2DGU A;  4DSJ A;  4OX9 J;  1C1C A;  4S0M A;  1QJH A;  3ZZZ A;  2F5G A;  4K0K F;  2ASD A;  2AZ1 A;  3W63 A;  1NAQ A;  4ED4 A;  1ZET A;  3WIU A;  4PQU B;  1B7F A;  2ZZN A;  3NKY A;  1KOO A;  4K4T A;  2HK2 A;  4PG4 A;  2WK4 A;  2K1R A;  2VG7 A;  5KFL A;  4DR5 J;  4KTQ A;  3SYZ A;  2KM8 B;  1VK8 A;  2WVD A;  1HQE A;  1SC1 B;  2FJB B;  2CNN B;  2PD1 A;  5B09 A;  1H72 C;  3BH7 B;  5CYQ A;  3K5P A;  3UWT A;  3JB9 k;  1ZPW X;  2ZBC A;  3AHP A;  1X0F A;  1F2G A;  4J9U E;  3GCX P;  1PAE X;  5A8R A;  3GPA A;  4P7V A;  1XJW B;  2AT1 B;  5T7L B;  5KT5 A;  3JTN A;  2VQF J;  1NK9 A;  2XSF A;  4LF8 F;  3HD1 A;  3DRP B;  1ZM4 A;  4KH1 B;  4LVN P;  2HFS A;  1JLA A;  3AOD A;  2DK2 A;  2XYH B;  2UVR A;  3BKU A;  2BE7 D;  4DR6 F;  1VQM S;  3HHL B;  2DTJ A;  4PXE A;  4XPC A;  3C2P A;  3MR3 A;  3VHQ A;  4CI0 B;  4K59 A;  5HLF B;  2QL7 B;  4O3N A;  2KVI A;  3IN5 A;  1S9G B;  2I2Y A;  2OPP B;  4DV6 J;  1J5O A;  1SJR A;  3SQO P;  2O1P A;  4LF6 F;  3DDN A;  3HUL A;  2GA7 A;  2CWK A;  3N6L A;  4OI4 A;  3W64 A;  3OL6 A;  1DQ8 A;  3MGJ A;  3MPV A;  1U1N A;  2UV8 G;  5CCL A;  2BE2 B;  3ICL A;  3Q8P B;  1YJ9 S;  4CIO A;  1AUS L;  4KR0 B;  3NY0 A;  4WU2 A;  5DZ7 A;  5C42 A;  3DMJ B;  3TUZ C;  1OHN A;  3PTW A;  5DLF A;  3M4X A;  1GFW B;  1K8A T;  1FT8 A;  1S6U A;  2AJ0 A;  2R7Q A;  3PO5 A;  1NLA A;  3LUY A;  4LSL B;  3BBC A;  1HBM B;  1JLB A;  3BV8 A;  2R42 A;  2VA3 A;  2KZM A;  4NLU A;  3CJ4 A;  4CO0 A;  2R9L A;  5CD4 H;  1R8B A;  1RHQ B;  3AD9 C;  3RUB L;  3CDW A;  3LP0 A;  4I56 A;  4ES3 A;  4NCA A;  1JJ2 R;  2EEY A;  2OHD A;  2V2Q A;  2VPY B;  2KT2 A;  5C25 B;  2GC8 A;  2K9I A;  4NZ0 A;  1C4A A;  3CJ5 A;  3G87 A;  3VV2 B;  4JI0 J;  2CIM A;  2XLK A;  5EHH A;  1WJ9 A;  2DNG A;  2L48 A;  3G6X A;  2CDQ A;  3D6H B;  4K4S A;  4PQU A;  4NLR A;  2MQO A;  3LAN A;  1QD1 A;  1FDA A;  4IKA A;  5HVG A;  4PXB A;  4ECX A;  3M2V B;  1G2E A;  4V1A k;  3VWS A;  4Y2I A;  3B8H A;  4JV2 A;  2XS2 A;  4YFU A;  4RW7 B;  4DLG A;  1C0T B;  4I67 A;  4IDK A;  3LGH A;  5KG4 A;  4AYB D;  4IH6 A;  1JLE A;  1NBE B;  3E3X A;  3KG0 A;  3DLB A;  4BC9 A;  1UEK A;  4JI7 F;  2WRM A;  1TUW A;  3SXL A;  3I4P A;  1V5I B;  2IYG A;  2JOQ A;  1W2B R;  5CYM A;  2H5E A;  5ITH A;  1XN9 A;  3NGD A;  4WFZ A;  5KT7 A;  2L9W A;  4USI A;  4USK A;  1D8Z A;  3OFG A;  5FLX Y;  1U0S A;  2NXE A;  4J91 A;  1UWA A;  4FP9 A;  3PX4 A;  4F2S A;  1ZA2 B;  4Z37 A;  4ZP9 A;  1SB6 A;  4ZCL A;  1PC4 A;  3EZO A;  4Y6I A;  1FX2 A;  1HNI B;  1YBT A;  2OFG X;  3L09 A;  4CO1 A;  1D9A A;  1R7I A;  2P6T A;  2QE5 A;  1FWL A;  1VQY A;  2YNH B;  3SCL E;  5A8K B;  3KJV B;  5THW A;  3IAM 9;  1BMQ B;  4JI7 J;  3OFE A;  5D0E A;  3GV7 B;  5I3U A;  3EGZ A;  3SDE B;  4KB7 A;  2JFD A;  2HVH A;  2LKZ A;  4OYA A;  5DQH A;  3NP5 A;  2UU9 F;  2D41 A;  3I82 A;  1WOS A;  2AHO B;  5J2P A;  1S6Q A;  1FJE B;  1RHM B;  3DLE B;  3P5T L;  4OI3 A;  5J1N A;  4UOH A;  2QL9 B;  1XER A;  1NKC A;  5KFE A;  3FBE A;  3TOQ A;  2PI4 A;  3MEK A;  2DNL A;  5AXM A;  1U0H A;  3S7R A;  5DDO C;  5KAK A;  4PQA A;  1H38 A;  4WIQ A;  2HBR B;  1BWV A;  1D9F A;  3CNQ P;  2HBQ B;  1AZS A;  4WTO B;  2DXE A;  3PR4 A;  2VAS A;  4DR1 J;  4JI6 F;  2DHA A;  2BRL A;  5CHC B;  4YHH F;  2ZE2 A;  5I3P A;  4QIV A;  5HRO A;  1TK8 A;  2UXC J;  2WON B;  5CD4 A;  2XGP A;  1NEE A;  5BR8 J;  5M2U A;  3FEX B;  2OEL A;  1SH0 A;  4P2S A;  1TL1 B;  4RW8 A;  2QSW A;  4ME7 E;  1HBN A;  2OPQ A;  4OV1 A;  1RLD A;  2EG1 A;  2JNJ A;  3C15 B;  3W8G A;  2VFS A;  3BBF A;  3M32 A;  2KH9 A;  2B8Q A;  2C3O A;  2LEP A;  3ONQ A;  2HRY A;  2HFV A;  3FBC A;  2MLZ A;  4RW4 B;  5KG5 A;  1L5U A;  3ZTO A;  4Y0F A;  1QTM A;  4O0I A;  1VQ9 S;  2O3D A;  3OXG A;  1RAD B;  2DHX A;  1SQE A;  3DYA A;  4M5D B;  5FII A;  4FNI A;  3TAM B;  4O44 B;  2ZJP Q;  2Z2L A;  2VDH A;  3BS9 A;  2HWH A;  4JI8 F;  2JEJ A;  5F9L A;  1T0T V;  5I3Q A;  2FJV A;  3TUI C;  4MIW A;  5IM0 A;  1P6T A;  2HK3 A;  2W9B A;  2ZOM A;  4L75 A;  2OMO A;  1S1W A;  2GVD A;  1T05 B;  2G9O A;  3MM9 B;  3P3D A;  4GKK J;  1EP4 A;  2BBE A;  1QAY A;  3I9Z A;  4LF4 F;  1H74 A;  1YTY A;  1NJY A;  3AXM A;  2PN6 A;  3BPS P;  3NMR A;  4QZV B;  2FJX A;  1OQ6 A;  4MFB A;  1GMW A;  2RML A;  2NSB A;  1FTR A;  3PG9 A;  4MK9 A;  1PGZ A;  3MD1 A;  2BR0 A;  3WZ0 A;  5F8I A;  2HGN A;  5L1L A;  1M5K C;  2P8I A;  4U8Y A;  2IIH A;  4J7C A;  1YZ7 A;  4O0N A;  5LMU J;  1K0T A;  4A8O A;  2DRB A;  2R7X A;  2FJD B;  4WYW A;  1TKZ B;  1JKH A;  3HD2 A;  4CO4 A;  3TUP A;  2CKW A;  1HWU A;  1IKW B;  3H87 C;  3BSN A;  1RI7 A;  3QMQ A;  4URS A;  3JYT A;  4LF4 J;  2P5V A;  2VON A;  4URG A;  2ASY A;  3GSD A;  1Z4U A;  2RS8 A;  3M05 A;  1O51 A;  3QT6 A;  2RUG A;  4DL3 A;  1YI2 S;  1SCJ B;  1KTQ A;  5DS7 A;  2DHG A;  3MEE A;  2RB7 A;  2YX1 A;  3ZFV A;  4TVA B;  2UV8 A;  2F8M A;  4C11 A;  1HQE B;  4RNF A;  2N82 B;  2B7B B;  5EWE A;  4TU7 A;  2MKK A;  4IOA Q;  2JXH A;  1JLC A;  2G0I A;  3SSQ A;  4MKB A;  2QLJ B;  2A10 A;  3OVB A;  2IM0 A;  4ZP8 A;  3L7U A;  1NJX A;  2AEJ A;  3O5T B;  3CIZ A;  5G4D A;  1T03 A;  2W8K A;  4LR9 A;  1RT6 B;  4DUZ J;  3NS5 A;  4HHH A;  4B3T J;  3DRP A;  3KK2 A;  1SI9 A;  3G2X A;  2G2O A;  1CEZ A;  1Q95 G;  2CQI A;  3VAF A;  3RBZ A;  1NDC A;  4ZVE A;  3JQK A;  3NS6 A;  2B9X A;  3G96 A;  1NJW A;  1HBU A;  2XMU A;  3OVA A;  1PIE A;  3SV3 A;  5C5J A;  1T9V A;  3KK3 A;  1L3T A;  2CPG A;  4P2M A;  1QE1 A;  2H9Z A;  4BHQ A;  3D0I E;  3PKY A;  2PT0 A;  3MMJ A;  4WWS A;  2WW8 A;  2MQ8 A;  3BPD A;  5KFI A;  4U6P A;  3RAQ A;  4JBC A;  4O3P A;  1WHY A;  3V6K A;  3CO9 A;  1VC6 A;  3OPK A;  3MTK A;  2KFY A;  1IWG A;  2BJE A;  1X93 A;  5KFT A;  3A3P B;  3TR5 A;  2E7V A;  4USW A;  2VFR A;  2XMA A;  1APS A;  3TAQ A;  2CPX A;  2AJ4 A;  2PMH A;  4HT7 A;  4LJM A;  4U7U K;  3DM2 B;  3LAM A;  1CVJ A;  3BQ0 A;  2GVD B;  3I9V 9;  4ED8 A;  3NGT A;  4JB8 B;  4DX8 H;  5B0A A;  3EMT A;  4M63 A;  1T05 A;  2VA2 A;  2PC6 A;  4HI1 A;  4ED7 A;  3D67 A;  8ATC B;  1VQ5 S;  5FDL A;  3CD7 A;  3I31 A;  1LFW A;  2B4V A;  4OYP A;  4AND A;  1UET A;  3W62 A;  4UOG A;  2RJZ A;  1RP5 A;  3BSA A;  5DM7 Q;  2WSC C;  1RWK B;  3DRR B;  2BJ7 A;  3M1V A;  5BYR A;  2ALZ A;  2KM8 C;  4JI8 J;  1Q16 A;  3A12 A;  2EWH A;  3MM5 B;  1MMD A;  2N4C A;  3NBP B;  3IMQ J;  1GMW D;  3K2Y A;  6AT1 B;  1T3N A;  2BAN A;  2LEA A;  4NA1 A;  3Q2T C;  1Q53 A;  2Z57 B;  1WHX A;  4LUB A;  1YX2 A;  2RHS B;  5D4P A;  2D3U A;  3D1H A;  4YN3 B;  5U47 A;  3LWL A;  3V4I A;  2DR5 A;  3RRG A;  2WB1 D;  3NCQ A;  2Z2M A;  3QIP B;  3CME S;  3AJ1 A;  4GKJ J;  1JXL A;  1B70 B;  1L3S A;  3SIP B;  3FBF A;  1S99 A;  3MMB B;  4X65 J;  3DLK B;  1RHJ B;  3CJK A;  5FLX U;  2BVZ A;  4G6V B;  5LMN F;  1N32 J;  1N5V A;  4OYB A;  3MHY A;  4ECZ A;  5CXT A;  3CCE S;  3AB2 B;  4A48 A;  4X62 F;  1RT7 B;  1IUJ A;  3W2V B;  4GVL A;  2G2Z A;  2O66 A;  4X4P A;  2YQ1 A;  5KFB A;  4DZD A;  3PW7 A;  4I6A A;  1X4C A;  4CLZ A;  3M8Z A;  3Q0A A;  3CUL A;  3NGK A;  2OUG A;  3OTO F;  2L08 A;  1GMV A;  1NK4 A;  1U2R A;  2YNH A;  1FXR A;  3K59 A;  3GE9 A;  4PG7 A;  4DJB A;  5CQG A;  3TO8 A;  1F6T A;  2IA6 A;  4K4X A;  4WII A;  5J2Q A;  2DR8 A;  1LW2 B;  4KH0 B;  2F8E X;  5D3G B;  1N33 J;  4Y2A A;  4DL6 A;  5KT4 A;  2M8D B;  3DHX A;  3LP2 A;  1NHU A;  1MSW D;  1TVR B;  4OHZ A;  3BGU A;  2A2B A;  4DHV A;  3EVW A;  2I6W A;  1YHQ S;  4A4J A;  4X64 F;  2XSJ A;  2Y1J A;  2GHW A;  1HR0 F;  3V6J A;  3P49 B;  2R7T A;  1HHS A;  1YJT A;  4QWB A;  3FFI A;  3TJ9 A;  4E2F B;  1A7G E;  4IYQ A;  3A3O B;  3VZH A;  5IT9 Y;  3AAW B;  1LK7 A;  4G1I A;  1UTA A;  5LJ3 Y;  4U7C A;  4XO0 A;  5DQI A;  1MWZ A;  2LDY A;  3MDF A;  3HDS A;  4ZJL A;  4LFC J;  2IPO B;  2V5H G;  3GYN A;  1JK9 B;  2OP5 A;  2HVE A;  4L76 A;  5ETM A;  4DV3 J;  3ILL A;  4P2F A;  3TRG A;  4WZQ A;  2MHE A;  2GV1 A;  4QPX A;  1A0O B;  1VIX A;  3W1Y C;  2GHP A;  1VQS A;  1BDV A;  2PMW A;  4MIA A;  1TL3 B;  2HVD A;  4CM0 A;  3HK2 A;  1XR5 A;  3BGF A;  4R0J A;  3QJL A;  3JSM B;  2R8G A;  4WF9 Q;  4CH7 A;  2VFU A;  4NE9 C;  4KO0 A;  3B54 A;  2MZS A;  4QW8 A;  5BXI A;  4DR3 F;  3I0S B;  3M8R A;  4HLB A;  1Z2L A;  2VKZ G;  5A76 A;  4CZC A;  2QYC A;  3MR6 A;  5ETL A;  4QR2 A;  1U49 A;  1DHM A;  1FWK A;  1QTG A;  2MZT A;  1CJT B;  4MK8 A;  2Q66 A;  3MAA B;  5GAH U;  3QO9 B;  1UWB B;  4DUY J;  1JXE A;  3BH6 B;  2YPZ A;  4AL7 A;  3FMB A;  3VAI A;  2V8P A;  3PYD A;  3EJM A;  1VC5 A;  1UEV A;  1R27 B;  4USM A;  1LK5 A;  3CDE A;  2FDN A;  1C0U A;  1ZM3 A;  2NXJ A;  3SCI E;  1VHI A;  3O44 A;  1RWW B;  3A8J A;  2E5L J;  3C16 A;  2R2S A;  3MMC B;  4PXC A;  3G6Y A;  3GYG A;  3UD4 P;  1N88 A;  5GAG U;  2DR7 A;  1EKS A;  4CP5 A;  1NH7 A;  3PJX A;  2AZ3 A;  3CCL S;  1HAR A;  3ZXW A;  3PIP Q;  2V67 A;  2UVU A;  4JI1 J;  4NCB A;  3IBF B;  4R0E A;  2RHQ B;  3VAL A;  2BM1 A;  2JLF A;  2YXL A;  3Q8U A;  1N34 J;  2AU0 A;  4DR7 J;  1CUL A;  3H0P A;  1HI1 A;  3BB5 A;  4LFB J;  2B5J B;  2ZIT A;  2LU1 A;  1H2V Z;  3VGT A;  2X1A A;  2VOD A;  5D0G A;  2OPP A;  1JLG A;  3RR7 A;  3VAK A;  2XLI A;  3TA1 A;  2RT3 A;  1SL0 A;  3HHN B;  3QRR A;  3HFV A;  3JSY A;  1OS5 A;  2CJX B;  2UP1 A;  4IQX A;  2UXB F;  2GO8 A;  2XHW A;  2ZZT A;  4QIF A;  4Y3C A;  2HG4 A;  4QWC A;  2DGW A;  4FDF A;  2V9W A;  5F3Z A;  1S1T B;  2OTL S;  2DNQ A;  3BGR A;  5HMX A;  4DMZ A;  2KJV A;  4M5L A;  1FKA F;  2UUB J;  1CJV B;  2R7R A;  4DPX A;  2MQQ A;  4C0B A;  2DH7 A;  5HSP A;  1H2T Z;  1UW4 A;  2KB2 A;  3Q89 A;  3GJS B;  1I94 F;  1HBM A;  1V9O A;  2RRA A;  1DZ5 A;  3TUJ C;  3FKB A;  3LGM A;  3O2I A;  1RT3 A;  1HNV A;  4NA2 A;  1Q79 A;  1YJR A;  3SCJ E;  3KLE B;  4ETZ A;  3W3S A;  4X84 A;  1A6L A;  2UUA J;  4KRW A;  4I0W A;  3GFH A;  4IFV B;  1Q4R A;  2V0N A;  4GRS A;  4N7T A;  2AN7 A;  2V6A A;  3MMA B;  4TKT A;  4JI2 F;  5LL6 d;  3R7B B;  1Y10 A;  1V6H A;  2FHJ D;  3OTE A;  1KNZ A;  1U8S A;  3MCN A;  5AXN A;  3BR9 A;  3QWU A;  1R0B G;  2J7U A;  3SSR A;  4X65 F;  2Z8Q A;  3A1Y G;  2BKP A;  3NXZ A;  2RQM A;  2B4P A;  2H54 B;  4WXW A;  2M2B A;  4ZIW A;  3EXY A;  3OL7 A;  2DXF A;  3UCG A;  3MCS A;  4IFY A;  2C22 A;  1GX5 A;  3OJS A;  4DUZ F;  1X4B A;  4B3T F;  1VLY A;  1WOP A;  2QC3 A;  3IM9 A;  4Y65 A;  1HNZ F;  2VUG A;  4FS1 A;  3T5J A;  2WTF A;  1SJQ A;  3GLJ A;  1UPM B;  5CYJ A;  2M0G B;  5HN0 A;  3MPU B;  4RWW A;  4YQW A;  1VQ8 S;  5A0Y B;  3TI0 A;  1VMB A;  2IBK A;  5KT6 A;  4P75 A;  1JKH B;  3QT8 A;  1FXD A;  5E0O A;  4LF9 J;  4ZK7 M;  3SFU A;  4UY8 T;  2BX6 A;  2CPJ A;  2VC1 A;  1XNR J;  2C3M A;  1TTH B;  1NDP A;  1EX8 A;  2BNZ A;  4P10 A;  4X64 J;  1ARQ A;  4EZ9 A;  5DG8 A;  4GKJ F;  1Q0N A;  1S4F A;  2BAN B;  4LFA F;  3V4I B;  3AQO A;  1TKZ A;  2H3E B;  4DL0 C;  2N7C A;  3V6H A;  4MT1 A;  2WHO A;  3H42 A;  3QGP A;  2H48 B;  1S79 A;  2DH9 A;  2JWN A;  2E1P A;  1X7V A;  1U1M A;  1IKX B;  3C14 B;  1U24 A;  2VPW B;  3B82 A;  3IG1 B;  2V4J B;  5IV3 A;  3LJP A;  4PR6 A;  2O5D A;  4WE1 A;  1SQG A;  1OIA A;  3OQ2 A;  5IQQ A;  3ZTP A;  1HWJ A;  2HMI B;  1M5P C;  1J5E J;  2FJE B;  2HZA A;  2V2Z A;  1ARO P;  2CJA A;  1WD6 A;  4LIR A;  4WE1 B;  1F5C A;  4KFB B;  5B0B A;  3NAH A;  4PWD A;  4XIU A;  2E66 A;  2WVC A;  4EWT A;  2ZM6 J;  4JI3 J;  3R6G B;  1D3W A;  4DL7 A;  1U1K A;  4DCP B;  3BYR A;  4U95 A;  2MKJ A;  4FVC A;  4H54 A;  1SC3 B;  2A0F B;  2LEC A;  2J9D A;  3GFY A;  4DEZ A;  2KVQ E;  3HSD A;  2J5A A;  1LW2 A;  3DU6 A;  1R31 A;  1S12 A;  1U4B A;  1IBK F;  1QM9 A;  1Q8K A;  2DHH A;  3DFE A;  1D09 B;  1X5P A;  1TUV A;  3OTB A;  4CLY A;  1R6Y A;  1QDU B;  4NI2 A;  4M5K A;  4PG6 A;  2VZ9 A;  2YKM A;  4OI6 A;  3G8S A;  3VAH A;  2J6S A;  4LQ3 A;  4Q0B B;  4CO3 A;  3B4M A;  4DPU A;  2ALY B;  1VOM A;  2XZW A;  2AJ1 A;  1Q7L B;  1PJ7 A;  4MJK A;  5KG3 A;  4CLU A;  5KT3 A;  2R8J A;  4ZCI A;  3FDS A;  1Q8B A;  1EA4 A;  2E5I A;  3OFH A;  3SEO A;  3X1L B;  1A9N B;  3V6D B;  3D54 A;  4C97 A;  4RUH A;  3FQK A;  4CYU B;  5HP1 B;  4B3R J;  1FDN A;  1SKU B;  3O1L A;  3HVA A;  1LOU A;  4BBY A;  4QYR A;  5HP1 A;  1KQK A;  2UXB J;  1FD2 A;  3QIP A;  4YB6 A;  3KK1 B;  2XYG B;  3PJ9 A;  4NYP A;  2OSR A;  5KFU A;  1MML A;  4M5N A;  1IKY B;  3H98 A;  4FKX A;  3MUM P;  1JJC B;  4PXD A;  3PCO B;  4UQT A;  2AYG A;  3G9C A;  1HMV B;  2NS1 B;  3KK1 A;  3H5Y A;  1F9H A;  1LW0 B;  3FJ2 A;  2C2Z B;  3PYE A;  2RVJ A;  4NMX A;  4K4W A;  3UPF A;  2MZJ A;  1UWB A;  3CC4 S;  1HNW F;  4L73 A;  3GB0 A;  3PRB A;  4C3L A;  1VQ6 S;  4OYO A;  3MUV P;  2ZOF A;  3DGP A;  3T1Y J;  1T7P A;  5T14 A;  1NDK A;  1Y4Z B;  4V19 X;  2DD8 S;  2EFQ A;  5LXR A;  3KUE A;  3ILJ A;  1Z2Z A;  3DRS A;  4O3S A;  4F26 A;  5A8R B;  3OJU A;  4QBU A;  1X9M A;  4KFB A;  2ZC3 A;  4RBU A;  1TL5 A;  4DR3 J;  1BD6 A;  3EDQ B;  4HHJ A;  2GJ2 A;  2BE9 B;  4ZA1 A;  4DCO B;  3MUT P;  1VIO A;  2RE1 A;  4HDH A;  3N28 A;  2IDE A;  2PDA A;  4RZR A;  4NXN F;  4B08 A;  1TKT B;  4X62 J;  2RQC A;  3OR1 A;  3DLL Q;  3D6T B;  2ZBI A;  3E51 A;  5AXL A;  3OSP A;  3W5X A;  3SCK E;  1HBO B;  1O8B A;  4LSN A;  2BJ3 A;  3BKT A;  4F50 A;  4NRT A;  2K3I A;  3M8P B;  3J7Y I;  1I5O B;  3FQL A;  3V81 A;  4PPD A;  1LWX A;  2LDI A;  1W25 A;  2OI2 A;  3DI6 B;  2Q43 A;  1REV A;  2LCW A;  3GSI A;  3W7B A;  1FA0 A;  1YWX A;  5FD1 A;  5K14 A;  2BQ3 A;  4G3I A;  4QOT A;  1GNK A;  3PHE A;  1G3O A;  1N5S A;  1RAE B;  1Y9O A;  4I4B A;  4R8U A;  1BY9 A;  5ETO A;  2CYY A;  3BGR B;  1JLB B;  1VQP S;  3D3B J;  3UQS A;  1VIS A;  2MKH A;  2DPJ A;  3DDI A;  4B9N A;  1RT1 B;  2KKH A;  2ZUA A;  2A1B A;  4C2M A;  2ZDP A;  3IS9 B;  1QAX A;  4WZM A;  2D3O R;  2DXD A;  2Y1L B;  4ECR A;  1FK9 A;  4C0H A;  1TMM A;  3FSX A;  3OTD A;  1P8G A;  1Q78 A;  2JDJ A;  2ZVS A;  3BYP A;  1MN7 A;  3IS9 A;  3JQM A;  3P8B B;  4M5H A;  4PG5 A;  1X9S A;  2WB4 A;  2KTQ A;  2X1B A;  2IA0 A;  3MEC A;  2FVR A;  3BN4 A;  1FJG F;  3CO0 P;  4LT6 A;  4A46 A;  3ADA C;  3R5D A;  5HAN A;  4ID5 B;  9ATC B;  1AW0 A;  1N8R T;  1ULR A;  2OPS A;  4RUC A;  4ZVO B;  5LSL A;  3TYT A;  4WKR A;  3MMB A;  3NG8 A;  4CT9 A;  1C0U B;  1GXL A;  3N6M A;  5KFG A;  4HAC B;  4YR0 A;  4LBH A;  2ZFH A;  3E2E A;  2XYP B;  5LMN J;  1KFD A;  3R5C A;  1WEY A;  4NEZ A;  1T3O A;  1NDL A;  1C0T A;  3M7V A;  1NKB A;  1WWH A;  2XEX A;  3HT3 A;  1SXL A;  1HD1 A;  4DSE A;  2G1H A;  1IR0 A;  5KG7 A;  4DSF A;  2CQ4 A;  1JLF A;  1EP4 B;  5ETP A;  2F7V A;  4UF4 A;  3SDE A;  3EIC A;  5F8L A;  4XPE A;  1KLM A;  3EWG A;  2DCL A;  1RA6 A;  1T9Y A;  3NGS A;  2VOP A;  1T9U A;  4ICL B;  2IVF B;  2CG8 A;  3OR1 B;  2E1R A;  3C8Y A;  3K5O A;  2FJW A;  1PBU A;  4D3H A;  1LV5 A;  1X4F A;  1KR4 A;  2J7K A;  3N79 A;  1WG5 A;  2AWZ A;  1UA0 A;  4OYX A;  4DS4 A;  3LP2 B;  1TK5 A;  3BR8 A;  3G8Q A;  1PYS B;  2XMW A;  1LWF A;  3NLC A;  3M6V A;  5D0R A;  1RKJ A;  2MPU A;  3MR5 A;  4W92 B;  3DLG A;  4QQB A;  3PEJ A;  3DMJ A;  3UR0 A;  2IRX A;  5L46 A;  1RTI A;  1RT2 A;  4DV6 F;  5H1S V;  3ETM A;  5F8G A;  2HHS A;  3AT1 B;  2HYI B;  3P5B P;  4LSL A;  4F3Q A;  3US5 A;  4RW8 B;  4N77 A;  5H9E J;  1VQN S;  1H73 A;  8RUC A;  2Y0S D;  3CCS S;  3AA8 A;  2XB2 D;  2OPR B;  4WKY A;  5EWF A;  1DUR A;  4KHP F;  2HIY A;  4MJW A;  2BSQ E;  2ZE2 B;  3GIJ A;  1S7I A;  2YPY A;  2K8G A;  4NOH A;  1S72 S;  4PWD B;  3D68 A;  2WVB A;  1F2H A;  1Z1Z A;  2GGP A;  2YNI A;  4M5G A;  1NK0 A;  1AT1 B;  4C8Z A;  1XMQ J;  2Q2K A;  2IC3 B;  3DOL B;  1TL1 A;  1RZM A;  4H4K A;  3VVT A;  1Q8L A;  2LYV A;  4EFA C;  1HI8 A;  2XWY A;  4J9N A;  3NNC A;  1V3R A;  1WTF A;  4J9S A;  2AW0 A;  2GGP B;  2HNY A;  4Y34 A;  2KYZ A;  1HPZ B;  1HNW J;  2IC3 A;  1CJT A;  4TXS A;  5JXS A;  2ZH8 A;  2E1C A;  3KXD A;  4TQR A;  4DL5 A;  3GJR B;  1QAI A;  4GVB B;  3OBI A;  4ILL A;  2FJA B;  1FNO A;  4KE5 A;  4PYA A;  5T41 A;  4MK7 A;  3N01 A;  1SPB P;  1RAB B;  5CYM B;  3ZTS A;  5KFQ A;  1OQ3 A;  2AP6 A;  2HLU A;  3LGN A;  2MLX A;  2RDD A;  3T1A A;  3S01 A;  4IFY B;  3OLA A;  5GVQ A;  5F8M A;  1S1U B;  3GV8 B;  2R7W A;  1IVZ A;  1B99 A;  1YK9 A;  3F56 A;  3PDN A;  3MM8 A;  1MMN A;  3ZNJ 1;  5HJY A;  1JJ4 A;  4L3N A;  1Q8I A;  3KTQ A;  3HCX A;  4AT1 B;  4JV5 F;  1F5B A;  1FRX A;  1RAG B;  1WAC A;  2FHJ A;  4KBI A;  4ECV A;  4J90 A;  3CMQ A;  4OV6 A;  5D4L A;  4YR2 A;  3TNV A;  1UFK A;  4IG0 B;  5KFC A;  3M6W A;  2VJV A;  1OY9 A;  1GEH A;  2A18 A;  1HR0 J;  1Q5V A;  2BNW A;  2FQQ B;  3CB4 A;  3AFG A;  3UVJ A;  2SXL A;  1SIZ A;  1WHW A;  4KJI A;  1FEH A;  3PHT A;  2CZV C;  4KGV B;  3HFZ B;  3W5Y A;  3QLH B;  1MRO A;  4WP3 A;  2W2P P;  2V8V A;  1N5Y A;  3UW1 A;  1NU4 A;  2DO0 A;  1KVJ A;  2LXF A;  2GNK A;  2ZUG A;  2HMI A;  1AZS B;  2DKO B;  1WSV A;  2RKI B;  3LH2 S;  3OT9 A;  2VFV A;  2MKS A;  4TY8 B;  4X2B A;  2KN4 A;  4OLO A;  4F8R A;  2C3Y A;  3KLI A;  5EDW A;  3T1H F;  2HAI A;  1X5T A;  2BAC A;  2DRD A;  2HPU A;  2GPE A;  3TVZ A;  2RAQ A;  2H4W B;  3CGI A;  2V4Q A;  1MWY A;  3CDU A;  4NCG A;  2ZDO A;  3SSS A;  5KFZ A;  3PR5 B;  2ZH5 A;  4DS5 A;  4CLW A;  3MI7 X;  3CDA A;  2H3A A;  2W25 A;  3DDK A;  4ALZ A;  1RT5 A;  3MR7 A;  3R5A A;  2AEF A;  1RYS A;  4JI5 F;  2Y9H A;  1PC5 A;  3M6U A;  4KSE B;  1B0V A;  3S8S A;  4OZL A;  4DFK A;  2Z30 B;  4KPY A;  2I9S A;  4LF5 J;  1WEZ A;  3ZZU A;  4J9Q A;  2HBY B;  1RB0 A;  4DR5 F;  2UUT A;  1U02 A;  2RQ4 A;  2CJK A;  1ARR A;  1WDD A;  1F9E B;  1WG1 A;  2WVF A;  3GYX B;  4YY3 J;  4AXI A;  2E9T A;  1KFS A;  1CJU A;  1QY7 A;  1UKU A;  2NCK L;  1RKI A;  4ELV A;  3FEZ A;  1QTN B;  3THT A;  4JI5 J;  4ZPV R;  1OWX A;  2F9J A;  3HLU A;  3CXC R;  3AY0 A;  3G82 A;  1MLA A;  2FLO A;  2H1O E;  2EFN A;  1X4H A;  3IAS 9;  3W2W B;  2FYX A;  2KHD A;  2ZOG A;  1QVG R;  3CD6 S;  4DF8 A;  2VFT A;  1N48 A;  5HAO A;  2HQ3 A;  1XNQ J;  4QIG A;  1RSC A;  4AXJ A;  2H1Y A;  2OML A;  1BHN A;  2PII A;  2RNE A;  2BJD A;  4N41 A;  5JVG Q;  2MQL A;  5JVH Q;  3NBP A;  3KNA A;  4D8J A;  3AOC A;  5KOX A;  3MF5 A;  5J2M A;  1QLN A;  4B3O A;  4IG3 B;  3MAH A;  1ZAW A;  4XDC A;  1LFP A;  1QAJ A;  4RW6 B;  1DFD A;  2H65 B;  3R7S B;  5K9F A;  3GFX A;  2FB0 A;  3UDL A;  1RAJ A;  4F25 A;  5L1I A;  2Z4P A;  1HL6 A;  3KWM A;  2R3V A;  3GIK A;  3HHE A;  2GZO A;  4N47 A;  2OAU A;  2BJ1 A;  3M2V A;  3NGR A;  2KO1 A;  2BA9 A;  3LA0 A;  3TVK A;  2F1F A;  1RBA A;  3CJ0 A;  3IR7 A;  4X4T A;  2ACY A;  3ZZ0 A;  3ENV A;  2VG7 B;  3BBB A;  1BUX A;  3D28 A;  4CH0 S;  2EG2 A;  2KG0 A;  4TY8 A;  3LP1 B;  1LWE A;  4ZN1 A;  3OR2 B;  2QO3 A;  1KLN A;  2DNO A;  3EVO A;  5F41 A;  2HHQ A;  4N56 A;  3OUY A;  1RQ0 A;  2JBV A;  1NK6 A;  2GMJ A;  4I6Y A;  1N6Q B;  3L7P A;  2ATL A;  1WF0 A;  2DR6 A;  3M30 A;  3MTJ A;  2ACM A;  3B4D A;  2B9W A;  3VF0 B;  3J81 U;  5D8H B;  2HNZ B;  1FFS B;  2QA4 G;  2BDP A;  1NSK L;  4B9V A;  1RTZ A;  3HF5 A;  3DC2 A;  1O0P A;  3L9Z A;  4FF3 A;  3IFE A;  4J9P A;  4ECQ A;  2FHK A;  4HHU A;  5KFF A;  3A8K A;  5E7O B;  1VRT B;  1EIY B;  1N32 F;  3U7J A;  4ZMM A;  2K29 A;  3P96 A;  3J7Z 5;  2HS4 A;  3GII A;  4LF7 F;  3KMQ A;  3ITH A;  3ZZO A;  2KFN A;  3M8S A;  1JB0 C;  5GAH I;  3ITH B;  2QV6 A;  3ZZT A;  4ILR A;  3L7O A;  4NML A;  3SZ2 A;  4DPW A;  2Q3P A;  4F04 B;  1VRQ C;  3IR6 B;  1HW9 A;  2QYG A;  5DG9 A;  2D7S A;  1TKD A;  3H8Y A;  5K8P A;  2VG6 A;  1R0C B;  3H40 A;  3BN7 A;  1EB0 A;  4WJB A;  1NK8 A;  4O3Q A;  3ZNU A;  4JI4 J;  2A3J A;  3SQG A;  4CYU A;  2OPR A;  2JXG A;  1SJ1 A;  1VLO A;  4IQM A;  4TYB A;  4CM2 A;  3EYZ A;  2J9D E;  5E3C A;  1KS2 A;  2HWI A;  2CA9 A;  2A6O A;  4HEA 9;  2GFF A;  1CBK A;  1S57 A;  3T6B A;  2YKQ A;  1OY6 A;  2YNI B;  3QSI A;  3LOU A;  4YUD A;  3CCZ A;  2GVZ A;  2YKO A;  2MXY A;  1REG X;  3KHL A;  3DOL A;  3T6J A;  2YWK A;  5L1K A;  9RUB A;  1M1K T;  3ISN D;  3I0R B;  3QO9 A;  3KLG B;  4ZLL A;  1SH3 A;  3QPI A;  1ZTT A;  2HUR A;  1XIQ A;  2J0X A;  3I0S A;  2Z2Y B;  4X4R A;  3MFI A;  3RB4 A;  2FC9 A;  2FY1 A;  3HP6 A;  1IQZ A;  2B9Y A;  2I0X A;  4G1Q A;  3GFZ A;  4ZHR B;  2MB0 B;  2J6T A;  4W98 A;  2AMC B;  2I38 A;  1Y3K A;  2YX7 A;  1N5Q A;  1P1L A;  1W7W A;  1EET B;  1T11 A;  2V8H A;  2W1B A;  4EO8 A;  5KT2 A;  2ZJQ Q;  1U1P A;  1VQK S;  2EK1 A;  3BQ2 A;  1VR6 A;  4EMD A;  4IOB A;  2LLZ A;  1RYR A;  1KQS R;  3Q8Y A;  1KN6 A;  4OZN A;  3T5H A;  3W66 A;  4USJ C;  4DDF A;  5AJ3 F;  5KFS A;  1RHR B;  1FFW B;  1IR2 A;  5AT1 B;  3T3F A;  1KC8 T;  1LQ9 A;  3PY8 A;  1G1X A;  4USU A;  2R8H A;  3KUH A;  4HL9 A;  1VBX A;  4Q8F A;  4J9M A;  3H2V E;  1NPR A;  1W2I A;  4UZB A;  4DUY F;  5K8M A;  4DV2 F;  1IM4 A;  2I1R A;  2HQD A;  4ICL A;  4ZP7 A;  2HGM A;  2XHC A;  1CUL B;  2E1A A;  3A8I A;  1NCL A;  1U0H B;  1TVR A;  2NXC A;  5C24 A;  2Y8Y A;  2WBR A;  4FYD A;  4FXV A;  5KTQ A;  1R3N A;  3FNN A;  3GZ7 A;  3N9U C;  5DM6 Q;  5CAA A;  7AT1 B;  1JX4 A;  4K7Q A;  4LF6 J;  3BDP A;  5HBM B;  2AYM A;  2QIF A;  1M5V C;  1D1U A;  4DV5 J;  2W2M P;  1N0U A;  2GCF A;  1TQL A;  2LVW A;  3QGG A;  1JLC B;  3G4S S;  5I42 A;  2VG6 B;  3BZQ A;  3LAL A;  5DET A;  2KZZ A;  1WF2 A;  5LMU F;  2XG8 A;  3BSO A;  1PJ6 A;  2AEM A;  4PAA A;  3TVY A;  4CO5 A;  1M90 T;  3SQG B;  2UU9 J;  1P94 A;  4LF9 F;  1WOO A;  2RDI A;  3D5M A;  3LW5 C;  1FKP B;  4HTJ A;  5I42 B;  1S77 D;  1KWM A;  1WG4 A;  2J0W A;  3AOA A;  1IBC B;  3E01 A;  1FRM A;  5KFV A;  2OH2 A;  1T94 A;  4DG1 B;  4P74 A;  2XGQ A;  3P4U B;  4ED0 A;  3A4T A;  4A8F A;  2NR0 A;  3R27 A;  3C6T A;  4ZVT B;  2CQ1 A;  1VRU A;  5KFW A;  4HTI A;  2OEK A;  3MMA A;  5C2G A;  3QWP A;  2YY3 A;  3FSY A;  4AAI A;  4RW7 A;  2U1A A;  1WC1 A;  2QLW A;  4Y2K A;  2YWH A;  1U1Q A;  2HNY B;  3A13 A;  4DV0 F;  3H59 A;  3R1L A;  3QRQ A;  2V8G A;  1OJ4 A;  4DPY A;  2YH0 A;  3T19 A;  3QAU A;  2G1D A;  1P1T A;  1EET A;  1HQ2 A;  2ZVI A;  2CVI A;  2DIS A;  4LSZ B;  5IC6 B;  3OHA A;  3KOA A;  1KRP A;  1DLO A;  1S9F A;  3JSR A;  1SC6 A;  1R0A A;  1IRQ A;  4R25 A;  4U9R A;  1S1W B;  5KG6 A;  1D9D A;  4B3M F;  4F3O A;  5HO4 A;  1EAR A;  4LRE A;  4F0H A;  2O01 C;  3PW4 A;  2JEI A;  5AJ3 J;  3KUG A;  2XNQ A;  5IZH A;  3HSG A;  4HKQ A;  2LXU A;  4DV1 J;  1YIT S;  1UJ4 A;  1MRO B;  2NZC A;  3I32 A;  3M8W A;  2ILY A;  5F3T A;  1N5Y B;  3CCQ S;  4CCH A;  3DGV A;  1OY8 A;  2CPH A;  1FD8 A;  1BQN A;  2G0C A;  4E98 A;  4MKA A;  2BKO A;  1LW0 A;  4ES2 A;  2W24 A;  5ETQ A;  3ZZP A;  1HYS B;  2CQ3 A;  3OXF A;  2MGZ B;  2J76 E;  2W4C A;  2XQC A;  5HL7 Q;  5B0E A;  5A2Q U;  3RB3 A;  4ERD A;  1RT6 A;  2CFX A;  2LA4 A;  4C11 B;  3PX6 A;  4O3R A;  1YZ6 A;  5HAT A;  5CCM A;  1FRH A;  2BUN A;  1NO8 A;  2RRB A;  5EX3 A;  1UVJ A;  4A47 A;  5AXK A;  4F4X A;  3MUR P;  3MPY A;  2H5J B;  5KFJ A;  4CLL A;  4F3M A;  2K3K A;  3HZE A;  2DY9 A;  2GAH C;  2IFX A;  2Z2Z A;  1HIY A;  1IWA A;  1ZYQ A;  2HQI A;  2FVP A;  3G8T A;  3RJM B;  5KFK A;  2M3D A;  4WFB Q;  1JLQ A;  1DAR A;  1MWQ A;  1XK8 A;  2OKQ A;  1N36 J;  1K44 A;  2EW9 A;  1AYE A;  3OL9 A;  4P2X A;  5HVF A;  2QG9 B;  1RHK B;  1RT5 B;  2W2N P;  3NOG A;  4I64 A;  4NL5 A;  4DFP A;  1JNZ B;  3TAM A;  1DTQ B;  1VK3 A;  4Z7Y A;  2J0S D;  1CS4 B;  2GJI A;  3BO4 A;  3J81 j;  2P9C A;  2ZH7 A;  4E8U A;  2HHW A;  2XI3 A;  3HX9 A;  3PNI A;  4C8Y A;  2KRR A;  1ROF A;  2AY0 A;  3SI8 A;  4DR2 F;  2NSC A;  5B0F A;  1ZM9 A;  3DXB A;  3C19 A;  3Q83 A;  4PEO A;  4ID8 A;  4KHM A;  2DRA A;  3CC2 S;  3PW2 A;  2EVZ A;  4RNN A;  4Q0B A;  2P9G A;  2KL8 A;  3DRR A;  1FX4 A;  4DXL A;  1F3F A;  2XLJ A;  1WTB A;  2HND B;  1Q5Y A;  1NSP A;  4DV4 F;  2YVS A;  2ZKT A;  1QUP A;  2JC1 A;  4PG8 A;  5JUM A;  4RNO A;  4DR7 F;  4OI1 A;  4QWA A;  1H7X A;  3WBZ A;  2LQ9 A;  4OIX A;  1F5A A;  1M1G A;  1YGY A;  2HS0 A;  2JH3 A;  2RIL A;  3C6U B;  5C25 A;  2EXU A;  4BCA A;  4CNZ A;  3QZ8 A;  1BQM B;  1L3U A;  1DRZ A;  2KT5 A;  3JS9 A;  3R1H A;  2RF2 B;  1S10 A;  2ZH3 A;  1T95 A;  3ZZR A;  1VBY A;  2D3O 1;  4OZ1 A;  3IR7 B;  3LWM A;  4X4O A;  1HWL A;  4P6Q A;  5D77 A;  4AD6 A;  5C7P A;  3OD2 A;  3CW2 C;  2KXN B;  3RR8 A;  4QIE A;  1HA1 A;  1S1V A;  1G7C B;  3KHG A;  4CDI A;  4D3G A;  1QVF R;  2OO4 A;  2MJN A;  3MM7 A;  1X5O A;  4RLE A;  4B17 A;  4URQ U;  1PJ5 A;  4A8S A;  3SV4 A;  5B0D A;  7FD1 A;  2HQC A;  4DV7 J;  4Z7C A;  2M70 A;  2HFU A;  4L72 B;  3CJK B;  2D9O A;  3QT7 A;  1DQA A;  4OYI A;  3BO2 A;  3ENQ A;  1BDT A;  3FVY A;  4Q2L A;  2ERR A;  1U1R A;  3OTC A;  4KHP J;  1JLF B;  2RSQ A;  1P9Y A;  1RT7 A;  1WOR A;  3L95 X;  4IH5 A;  1UL3 A;  5MLC V;  1FJG J;  5F8N A;  3RBD A;  1SJF A;  2V34 A;  1IKV B;  2R7U A;  5EN1 A;  3K0J A;  3MWB A;  3VVU A;  1H6K X;  1VHF A;  3CCT A;  1JLQ B;  2G13 A;  2P6S A;  4GO7 X;  4AE5 A;  3CED A;  3T1Y F;  2YH1 A;  4L3K A;  1ACM B;  5GAG I;  5LT5 A;  2BE2 A;  2OD6 A;  3HHL A;  1BE4 A;  5CH7 B;  1DQ9 A;  1Q1K A;  3ENA A;  4KV8 B;  1S6Q B;  3I4H X;  1B64 A;  3KLV A;  4FXW A;  1HNX J;  4C9D A;  1F3V A;  4WFX A;  1T9T A;  2ROG A;  4CH1 A;  2KT3 A;  2CJ9 A;  5KFR A;  3J7Y U;  1S9G A;  2PA3 A;  1GXU A;  4NI2 B;  3R2D J;  4TQS A;  2DJW A;  3BQ1 A;  1S7H A;  1X4A A;  4RU9 A;  3V81 B;  4DSL A;  1CQN A;  2J7W A;  1REV B;  4RPF A;  1UFL A;  3TA2 A;  3B6B A;  4X4Q A;  2XY7 A;  2HRU A;  3PO4 A;  2FVS A;  2X1F A;  3KNG A;  3QAT A;  2NPF A;  1RWX B;  2C1E B;  4DQP A;  1X5S A;  5LM7 E;  2FD2 A;  2QSF A;  1T9X A;  3BSC A;  4IO9 Q;  1HNX F;  5E2Q A;  3D1O A;  1N33 F;  3GIL A;  4YDX A;  4C8L A;  2OTJ S;  2ZH1 A;  4K8R A;  3JSM A;  4GC7 A;  3KLE A;  1WF1 A;  2PGC A;  5L38 A;  1LKZ A;  2GMH A;  2YWW A;  4L6V 3;  2HGL A;  2RF2 A;  3CPW R;  4ECT A;  2WVE A;  2EFV A;  3EZU A;  3GWC A;  4NXM F;  1M5O C;  1TUG B;  4XK8 C;  1RT4 A;  1F9F A;  4U7U D;  4OYW A;  4OHY A;  3V5R A;  4LQ9 A;  2UVW A;  3UD5 A;  4KAI A;  1PIL A;  3H2U B;  4OHV A;  3U1L A;  3G71 S;  4KGX B;  5GMD A;  2LU2 A;  5J1P A;  1FDD A;  3TZZ A;  2EC2 A;  4RJV A;  3X3U A;  3EPG A;  2HZC A;  1NPP A;  5L8R C;  3TWZ A;  1QSL A;  1R6V A;  2OPS B;  4W4M A;  2DNP A;  4NYO A;  4UST A;  3OXL A;  1SKR A;  4I7F A;  3OR2 A;  1RBO B;  4B9M A;  2RUS A;  1FHT A;  4J9O A;  5D15 A;  2KFZ A;  1RE1 B;  2JRS A;  4C3K A;  1HFE L;  4A8Y A;  1KLM B;  1I6J A;  2F63 A;  3R5B A;  5D0H A;  2ABY A;  4DOZ A;  2IVY A;  4ZP6 A;  2MZ1 A;  3FGV A;  3M6X A;  2NUH A;  1XMQ F;  2MZR A;  2E5G A;  5KG1 A;  2W7O A;  3RTV A;  4A8Q A;  2M4M A;  4B02 A;  2VKR A;  3JTO A;  4C48 A;  2W8L A;  2FLN A;  3HJV A;  4AL5 A;  3QBC A;  2ATC B;  1RBL A;  3KJN B;  2AX1 A;  1RHU B;  4JV1 A;  2N7Y A;  2Q6B A;  4R5P A;  2JXI A;  2ASJ A;  4LF1 A;  4IRK A;  2F9D A;  1DY3 A;  2Y3Y A;  5DJB A;  3VR1 A;  2DGT A;  4YB1 P;  4AQY J;  2QLX A;  2N4D A;  4F4A A;  2DNR A;  4KV8 A;  4XTT A;  5A8K A;  3H4D A;  3CUN A;  3IBW A;  1C1B B;  2P2C B;  2VU5 A;  3FUY A;  1RXO B;  4BWM A;  5LXY A;  2N3O A;  3BGL A;  4ECU A;  2CVE A;  3GG0 A;  4FPI A;  2JEF A;  3DLE A;  3AA9 A;  1HWI A;  5E5N A;  1F1B B;  5DQG A;  2O67 A;  2W2O P;  2XMK A;  3NCR A;  4FN5 A;  4HH0 A;  1Y3J A;  4OJ1 A;  4OJ3 A;  4TY9 A;  4ES1 A;  4UTG A;  2EPI A;  3AXK A;  4CWB A;  5KFO A;  1H2U X;  4GC6 A;  4EBC A;  1R89 A;  1RT1 A;  5B08 A;  3H5X A;  4QWD A;  3BGO P;  1SQF A;  2K06 A;  1RTI B;  2F65 A;  2HHU A;  3KLI B;  5DO2 A;  5KFN A;  1UVN A;  4OFZ A;  1SV5 B;  5DDQ C;  1HW8 A;  3S1T A;  3LTO A;  2ZKU A;  3J80 Y;  3AJ2 A;  1L3K A;  5KFX A;  1X4E A;  4ECW A;  2HAF A;  1S48 A;  2DCU B;  3I6P A;  3UDV A;  3KHH A;  1TAU A;  1YRX A;  4RW4 A;  4OZ5 A;  2JC0 A;  3POT B;  3S6E A;  1RT3 B;  2PMZ D;  4C0O C;  3ET6 A;  4L74 A;  1YJ7 A;  3DOK A;  2FVC A;  3N5B A;  3DN9 A;  3TX0 A;  1J2V A;  5GME A;  3EUN A;  4I2Q A;  4ZLN A;  4Q43 A;  3TAR A;  1LEO A;  4ZVQ B;  3MFH A;  3KLG A;  4B9S A;  3C15 A;  4X4N A;  2CG4 A;  2GO9 A;  3LQV A;  1UVM A;  3TZW A;  4LRF A;  2EBE A;  3M2R A;  3KYL A;  5EX0 A;  1LXN A;  1WC5 A;  4F02 A;  3JTP A;  3ZTQ A;  3DLH A;  3HPO A;  2OSQ A;  1ZAX A;  4MAK A;  3AOB A;  4C8M A;  3GJT B;  3U27 A;  4A8K A;  2XY5 A;  1FJ7 A;  2DYA A;  3MPD A;  3QQC D;  2F40 A;  4KIA A;  1YIJ S;  2DBB A;  1AUD A;  4HI2 A;  3ISN C;  2B4U A;  5SZT A;  4LIW A;  1KOH A;  1VJW A;  5F9N A;  1J5E F;  3GIR A;  2BEF A;  3WX8 A;  4O3O A;  2YNG B;  1TP7 A;  4DN0 A;  2UXD J;  3KKF A;  4OJG A;  5CA5 A;  2R8K A;  4PRF A;  2VF3 A;  3CJ8 A;  2Y0B B;  1MYL A;  1V5V A;  2L41 A;  2CZ9 A;  3QGH A;  1NSA A;  1Y11 A;  2G0J A;  3MM8 B;  3W9J A;  4ATN A;  2W01 A;  2ZH2 A;  2C3U A;  1S0M A;  3CTR A;  4B3R F;  4WCE Q;  4F4Y A;  4DSI A;  3BDE A;  3HO1 A;  2A2D A;  4I2P B;  2C2R A;  4M1K A;  2MMY A;  5D4O A;  3Q2S C;  3QOQ A;  4N8O A;  1N34 F;  2C2K B;  4LRB A;  2EKN A;  4YP3 A;  2XM3 A;  2HFN A;  1RUS A;  4ZCK A;  3WHI A;  5GAD U;  2IAJ B;  4RW9 A;  4EK2 A;  3TJA A;  3EPI A;  4NYZ A;  4K50 A;  2W4D A;  4F7V A;  1UPP A;  1MG7 A;  2OIH A;  5HBM A;  1CG2 A;  2IYI A;  3PM9 A;  4YME A;  1GXT A;  4M5M A;  3K5L A;  1TV6 A;  2DIT A;  1BQN B;  4Q5V A;  1QSS A;  1S0V A;  1X9W A;  3K8W A;  4X4U A;  1FNX H;  1OG7 A;  1ZAV A;  2YKN A;  4HYK A;  2NZ4 A;  2BKN A;  2FZC B;  2B7C B;  1WEL A;  1S1X B;  1RU2 A;  3ILO A;  3MR2 A;  2HKE A;  2ZWP A;  3EGV A;  4LRC A;  4YR3 A;  1FI4 A;  4QWE A;  2VC0 A;  1PCA A;  3CJ3 A;  2FVQ A;  1MNT A;  3ILI A;  2ADL A;  3M30 B;  4HVZ A;  4U67 Q;  2ILZ A;  2CQG A;  1VQ4 S;  2QA2 A;  3PVX A;  4IH7 A;  4NLV A;  3OFF A;  2CJQ A;  1U45 A;  4WXO A;  3RRH A;  1JJH A;  2YQ0 A;  5ETN A;  1ITP A;  4ZLP A;  2DEJ A;  4WYL A;  3VZI A;  5KFH A;  3HKZ D;  1HBO A;  4LSN B;  5KFP A;  2DIU A;  1HD0 A;  3KLH B;  3GV5 B;  2C2N A;  3TW0 A;  3TZX A;  2RQK A;  4JI2 J;  2QMW A;  4H4O A;  3WC0 A;  5LJ5 Y;  5HMZ A;  3K89 A;  1B0P A;  4KT0 C;  3UE2 A;  2IM3 A;  1NJI T;  4C8O A;  2PSZ A;  2XMV A;  2XSJ B;  3IO1 A;  2WW4 A;  2OLW A;  2RS2 A;  4MYT A;  4FYW B;  4MMO A;  1NUE A;  4RUB A;  1UAW A;  3HVT A;  3ELH A;  4PPZ A;  5E33 A;  2R2T A;  2FLP A;  3IWL A;  3UR3 C;  1M0S A;  4DX7 A;  2HND A;  2LQJ A;  3QGI A;  3W9H A;  5LSO A;  3OW2 R;  2BW2 A;  1XMO J;  3NNE A;  1N56 A;  1FXL A;  4YHH J;  3MEG A;  2ZJR Q;  2CPZ A;  4HDG A;  1UZH A;  2HVZ A;  4IG3 A;  5K8O A;  3C6U A;  3KDO A;  3FRZ A;  1DJ0 A;  4RW6 A;  3Q8S B;  4BDP A;  5ADZ A;  2UZA A;  4NXN J;  3FBB A;  1N52 B;  3PRD A;  1FRK A;  2VH7 A;  2Z0G A;  3CCW A;  1WHV A;  5IT4 A;  1KVK A;  1W26 A;  4OX6 A;  2AIR B;  4OHX A;  4DI6 A;  1HMV A;  2QX0 A;  4RNM A;  1ZBT A;  4CTA B;  4UQG A;  2GVZ B;  4M94 A;  2VQF F;  2JVO A;  3NWR A;  2QFJ A;  2OFH X;  1AB8 A;  2FTR A;  3C3L A;  2EBG A;  3P6Y C;  2V69 A;  3I55 S;  2VPZ B;  1Y5N B;  4J9V A;  4P7T A;  2DHS A;  1S59 A;  1VI7 A;  3RW6 A;  4A8W A;  1IKY A;  3UO0 A;  4B3M J;  1HYS A;  1RWM B;  1NHV A;  5HI7 A;  4Q8E A;  2BYC A;  1T9W A;  1U9P A;  3TQ1 A;  1S0O A;  2JEG A;  1E6Y B;  1RLC L;  2QMU B;  3HSJ A;  3W60 A;  4A8M P;  2AV5 A;  2DGS A;  4UT4 A;  2C28 A;  5DG7 A;  4NLO A;  1IJF B;  4RO0 A;  2PI5 A;  4DR4 J;  5IC4 B;  3PX0 A;  2BMB A;  2X1G A;  2W7A A;  3ULH A;  4NZ7 A;  1MU2 A;  5KFM A;  1VC0 A;  3UN2 A;  4ZVG A;  3GXQ A;  1KKH A;  2YBV A;  5J1E B;  1CQM A;  1HNI A;  3W2V A;  1PAU B;  5F8H A;  2CRL A;  2QL5 B;  3NO7 A;  1CLF A;  1H98 A;  4P71 A;  1N6Q A;  1R43 A;  3M8P A;  3MCO A;  5M2P A;  4RWX A;  5I3U B;  3DI6 A;  3QNW B;  1XMB A;  2IJR A;  3IGV A;  5G0R B;  3JQJ A;  2LFV A;  3RBX A;  2WOM A;  4DV0 J;  3C46 A;  4WBF A;  1B4S A;  1BQX A;  3DNC A;  4ZPW R;  1TFW A;  2Y8W A;  2VV5 A;  2NRE A;  3MOJ B;  1Y5L B;  4LRA A;  5CZV A;  5JMN A;  2QLF B;  2ZWO A;  2GHV C;  3HHL C;  1OPI A;  1FRJ A;  1UJ6 A;  2V94 A;  4LMZ A;  1YLX A;  1FRL A;  2CNO B;  2LMI A;  2J8S A;  5DDP C;  3L3C A;  3WC2 A;  1VDH A;  2R8I A;  2W2Q P;  2DGQ A;  3DM2 A;  3EGN A;  1IBM F;  1N0V C;  4LBP A;  3BJY A;  2H51 B;  3N5F A;  1RT2 B;  4NLT A;  4W90 B;  1EAY C;  2GW8 A;  1Y7P A;  4ZOS A;  2KI2 A;  3TX8 A;  2HSE B;  3J80 U;  4B9U A;  3UN5 A;  4R8U B;  2FPH X;  5C42 B;  5IWA F;  1AFI A;  4FYY B;  1DTT A;  3TEG A;  2KEL A;  1RWP B;  1FKO A;  1OSD A;  2BOA A;  3D1Q A;  4DV4 J;  1HNV B;  3NAI A;  5J2M B;  4DQQ A;  4B3O B;  2HHP A;  3PKM A;  1WC6 A;  4DG1 A;  2ZC4 A;  2UXD F;  3D0H E;  2L9N A;  4DF4 A;  2DNY A;  1RCX B;  3WIV A;  2JVR A;  2LQB A;  2LQ8 A;  3LP0 B;  4KY3 A;  3LO3 A;  3M32 B;  3JSB A;  4RBV A;  1O5J A;  4AUK A;  1KP6 A;  2W9C A;  1NJZ A;  4NLW A;  3PJW A;  1TK0 A;  1M1H A;  2MY8 A;  4K4U A;  3HHK A;  4HT5 A;  4UW2 A;  4B9L A;  1VFJ A;  1SKW A;  3IBC B;  3KLF A;  3DLK A;  1HI0 P;  4M5I A;  4DR6 J;  4NLP A;  1H7W A;  3C16 B;  3EVM A;  3DOM B;  3VEB A;  3GR1 A;  1SJ3 P;  5BJR A;  4NXM J;  1XR7 A;  1RJJ A;  1HQU B;  2XTJ P;  4CNY A;  2D9P A;  2IDL A;  2RIJ A;  1NZ8 A;  4HAC A;  5J2N B;  1SVD A;  3E8O A;  2ADB A;  1NKE A;  1UVK A;  2RDJ A;  2HHH F;  2DGO A;  3PW0 A;  1TU0 B;  2H5I B;  3KHR A;  5J2N A;  1PSD A;  3CJT A;  3GP9 A;  3EX7 B;  4DQR A;  1JXV A;  1M5S A;  4MFB B;  2HHV A;  3PIO Q;  2GML A;  3I5C A;  5J2P B;  2GIQ A;  2XZT B;  2CQ2 A;  2MQP A;  1YJN S;  2JSX A;  2I5J A;  4ED2 A;  1UA1 A;  2X3G A;  2CXE A;  3QFW A;  3V4M A;  1U6Z A;  2V50 A;  2W9A A;  2VIC A;  4C8K A;  2UXC F;  3ZC4 A;  3EGW B;  5KFD A;  4OYM A;  1WI6 A;  1MYK A;  3ZTR A;  4NRU A;  1U1L A;  2QFI A;  1UEU A;  4H4M A;  4P72 A;  2XNR A;  2QN6 B;  5K14 B;  3N6N A;  3OL8 A;  3R3T A;  3EE3 A;  3DLJ A;  3T41 A;  1GMU A;  5IXU A;  5HQM A;  1CPZ A;  4X66 J;  5GAE U;  2A6M A;  4ER8 A;  4AQY F;  3VCD A;  1LWF B;  1UCN A;  4MYU A;  4NPO A;  4PYD A;  4YB7 A;  2QJ3 A;  5ETV A;  4LFB F;  3IA0 A;  3DLG B;  4O4G B;  1VCT A;  3IXQ A;  2BAB A;  3QRP A;  1UMJ A;  2V4J A;  2HLT A;  1XNQ F;  3DRY A;  2K2P A;  1FKO B;  4JI4 F;  2Q79 A;  2KHC A;  3BRE A;  4IFV A;  1NSQ A;  5IWA J;  3ET6 B;  4BC7 A;  5L9N A;  3T9Z A;  4I2Q B;  2QLB B;  3CJS A;  1F0X A;  4I1T A;  4ANE A;  3Q23 A;  3NL0 A;  2K7K A;  2XMT A;  3HSZ A;  3NMA A;  3R97 A;  4CLT A;  1ZH5 A;  1WC3 A;  3M2R B;  1G6B A;  3I0R A;  2R2R A;  1EZZ B;  1HBU B;  1RT4 B;  2HFZ A;  2CQH A;  1B28 A;  2OEJ A;  2V9K A;  1WI8 A;  2AKW B;  2VPX B;  3BEG B;  4O44 A;  5KOW A;  4KKO A;  4Q44 A;  2HHH J;  4RNH A;  2IMW P;  4EYI B;  1I51 B;  4FBU A;  4OL8 A;  1T02 A;  2MLY A;  1XQI A;  4ITS A;  4ECS A;  1KQF B;  2HIQ A;  3VGU A;  2DGV A;  3FT7 A;  1PAR A;  4KC5 A;  4UOC A;  2ZM6 F;  4G65 A;  2EK6 A;  5HQL A;  1RTD A;  2IMO A;  3WX4 A;  3D9B A;  1S1U A;  3CE8 A;  1KBR A;  4CT8 A;  1N4L A;  3R7N B;  1X4D A;  3J7A N;  1HQU A;  2CQD A;  6FD1 A;  1CSJ A;  2JFK A;  1MN9 A;  2MKC A;  2W7P A;  1V3Z A;  2EKY A;  3MMC A;  2VG5 B;  2YNF B;  4OX9 F;  5E3A A;  1SL1 A;  1WNE A;  1GQE A;  1UP1 A;  2CQP A;  1WKK A;  4PWU A;  2BA3 A;  5DZ6 A;  1PG5 B;  5ETS A;  5KG2 A;  3G6E S;  1HLW A;  2BW7 A;  2K5J A;  3CJ2 A;  3NEK A;  4FYV B;  2ZNY A;  2E44 A;  2QRR A;  1Q7Y T;  2XO7 A;  3KJV A;  4WK1 A;  4C7Q A;  2BRK A;  2JJ4 D;  4P52 A;  4YDD B;  4JP8 A;  4QU6 A;  1K0V A;  2UUC J;  1HWK A;  3OLB A;  2IHR 1;  2JHE A;  2AJF E;  4JV5 J;  1S9E A;  2IAJ A;  4RW9 B;  4BWJ A;  4FZV A;  4RUA A;  5C24 B;  1JQG A;  3MEE B;  4TLQ A;  4J9L A;  1WUU A;  3DKD A;  4OMF G;  1N54 B;  5ETT A;  3U1M A;  4DPT A;  4I2P A;  2RKI A;  2K1R B;  3M9O B;  4QCL A;  2PEH A;  3H90 A;  5E3P A;  1VBK A;  3OHB A;  3UD3 P;  4C4W A;  5E3R A;  1WDT A;  1YDL A;  1X31 C;  4P9S A;  3QLH A;  5CYQ B;  3W8P A;  2DGX A;  4CLF A;  2VQE F;  2XMJ A;  2CJB A;  1Q86 T;  1Y00 A;  2R7V A;  1UZD A;  4QYZ J;  1GH8 A;  4ELU A;  5A8W B;  2AGQ A;  1D0E A;  2V4R A;  1FVQ A;  1IKX A;  4JOU A;  3MXH P;  4CLK A;  4FBT A;  4QW9 A;  2B4O A;  1R8P A;  1EJ7 L;  2DNN A;  3NCP A;  3POT A;  3T1H J;  3DOK B;  3KJF B;  4ZVP B;  1NK5 A;  2DNH A;  3UFC X;  2RH3 A;  3ENW A;  4ZN3 A;  4ZPD A;  3IGN A;  1ZTW A;  1WC0 A;  3IR5 B;  2V68 A;  2R7S A;  4TNO A;  1SIW B;  4MH8 A;  2HHX A;  3DYA B;  1U47 A;  3G82 B;  5IT9 U;  1RCO B;  2HQG A;  3KK3 B;  1KD1 T;  2XCA A;  3RB6 A;  2KRB A;  2NPI A;  5B7W A;  3H4B A;  1B0T A;  2CQB A;  2XO6 A;  2MEW A;  1TKX B;  2B6A B;  1DTQ A;  1RA7 A;  3GTY X;  3TP2 A;  4H4O B;  2BQU A;  2BJ8 A;  1ZZF A;  4MKV A;  5E3Q A;  3I56 S;  4F4W A;  2NLW A;  2FGC A;  1MNE A;  2YTC A;  4JUZ A;  1U48 A;  2DNZ A;  4PWW A;  3W65 A;  3I5B A;  5ETR A;  5A0Y A;  1BAZ A;  4B3S J;  3K5M A;  3U02 A;  2WZ1 A;  1YBU A;  2BQR A;  3M2U B;  3MM6 B;  2EFP A;  4USV A;  2CQ0 A;  2ZD1 A;  3UNY A;  1YSJ A;  1S97 A;  3V6D A;  3KFW X;  3AD8 C;  2J6U A;  2FLL A;  2DB1 A;  2VB6 A;  3IM8 A;  2APO A;  3MEC B;  4EGL A;  3JYT B;  2ZD1 B;  5L1J A;  4N5S A;  4IRC A;  4C6A A;  5H9F K;  1TZ0 A;  4ZCM A;  1K47 A;  2V2K A;  2Y1I A;  1YVF A;  2M7S A;  3D7S B;  4CTA A;  5AE2 A;  1BGX T;  1E6Y A;  4WPA A;  3I5A A;  4H4K C;  5T7L A;  3KLF B;  2D1C A;  4IDK B;  4Y2C A;  2J8A A;  3FZ2 A;  4OYZ A;  2C2O B;  1FDB A;  2LA6 A;  4CRJ A;  3M8Q B;  1KHW A;  4NLY A;  4ZVU B;  2R2U A;  4Y28 C;  5DGB A;  2AYB A;  3FMT A;  1NZA A;  1YJV A;  1URR A;  2WCX A;  4KYZ A;  4OI0 A;  3QJP A;  2C42 A;  4NAS A;  1WC4 A;  1NB7 A;  2RBF A;  4CO2 A;  3K8V A;  4QIW D;  1TAQ A;  3QID A;  3LAK A;  2K7J A;  2OD4 A;  1FNM A;  3UNG C;  5L39 A;  3CIM A;  3J7Z T;  3VQS A;  1E6V A;  3CDB A;  4OX8 A;  2UVV A;  3HKW A;  2AX0 A;  4DL4 A;  2FHM A;  2M8H A;  5C2C A;  1TMJ A;  2F8H A;  4U8V A;  3K58 A;  2XY6 A;  2XCP A;  1UVI A;  4DWI A;  1E6V B;  3KLH A;  1JLG B;  4OZJ A;  4IR9 A;  1SIW A;  5I4M A;  2ZZM A;  4YEA A;  4ED1 A;  3WQP A;  1XR6 A;  3FFI B;  4LFA J;  4F0M A;  4J9R A;  2PFF B;  4H4M B;  4JI0 F;  2HWT A;  2E1M C;  1NND A;  1T8E A;  2HHT A;  4TN2 A;  4WFA Q;  3CWJ A;  3K7R A;  4PCQ A;  3FMW A;  4LVO P;  4C3M A;  5H9E K;  1SUQ B;  4FYX B;  2VOO A;  2POK A;  3BKF A;  4IR1 A;  4N8N A;  4ETX A;  2YWE A;  4ZJQ A;  2EC0 A;  1U7L A;  1IBM J;  4MKY A;  2F4V F;  2GQC A;  2WSF C;  1XC9 A;  2BV3 A;  2KU7 A;  4DCJ B;  2HW3 A;  4ENO A;  2BZ2 A;  4ANC A;  2V8D A;  1M5H A;  2DO4 A;  4X66 F;  3VAM A;  3H5U A;  4EO6 A;  1R8A A;  2PEB A;  5DLG A;  4K4Z A;  1I3O B;  4IOC Q;  2J0Q D;  2GS8 A;  3Q22 A;  3CC7 S;  5ETK A;  3VAG A;  2HZV A;  4GVB A;  2IBO A;  1YG0 A;  4ZPC A;  4FF1 A;  2E5J A;  1B01 A;  1B7Y B;  4BS2 A;  1BLU A;  3GIM A;  2ROE A;  1EQM A;  1FCA A;  3R8Y A;  1KEK A;  4FNH A;  2RD5 C;  4DX6 A;  1KON A;  4TU8 A;  4ZPT R;  4J5O A;  1JLA B;  1FEE A;  5K5M A;  4R5P B;  2HNZ A;  4K5R A;  5HMY A;  2NYH A;  5KFY A;  3QSY B;  3QAE A;  4ED5 A;  3EXC X;  1ZM2 A;  1S6P B;  1WEX A;  4YB5 A;  2VBW A;  3G86 A;  5HJX A;  1VRT A;  2V63 A;  5A6W A;  5L9X A;  1FTC A;  4ZVF A;  1FES A;  5AE1 A;  3UVJ B;  4JI6 J;  1RAH B;  4QYZ K;  2ZHB A;  4KPC A;  4DFJ A;  2QMX A;  1IQT A;  2X7I A;  3SMZ A;  1K1Q A;  3M8Y A;  2CPY A;  3KMS A;  1YJW S;  4DL2 A;  4C98 A;  4DZ6 A;  7FDR A;  2MDA A;  3R5J B;  4F4Z A;  2BXJ A;  3DU5 A;  2X51 A;  4DR2 J;  4Q7A A;  5IS2 A;  5HK4 A;  3NGU A;  3U1N A;  5HRO B;  1YQH A;  1U2C A;  1G4C A;  1TV6 B;  3K5N A;  2FY8 A;  2N3L A;  1SV5 A;  4P73 A;  2IRU A;  3C14 A;  1IJE B;  1SKS A;  1S1T A;  4U96 A;  2ZH6 A;  2VD3 A;  1HBN B;  2OPQ B;  1CJV A;  1FRI A;  1SC4 B;  3HM9 A;  2IM1 A;  3IWN C;  3IRX B;  2AGO A;  2DPI A;  2C2M B;  3CJQ A;  2AQ4 A;  3NNA A;  4CLS A;  3NWG A;  3HZG A;  4FVM A; 
#chains in the Genus database with same CATH homology
 2K5J A;  2BJ8 A;  4FXE A;  2H1O E;  2JXI A;  1IRQ A;  2WVB A;  2Y3Y A;  3BKF A;  2HZA A;  1U9P A;  1QTG A;  2FGC A;  2PC6 A;  1MYL A;  1EA4 A;  2GPE A;  1MYK A;  1MNT A;  3FMT A;  3LGH A;  2WVC A;  2HZV A;  1B28 A;  1Q5Y A;  1BAZ A;  2NZC A;  1BDT A;  1Q5V A;  3VEB A;  4D8J A;  2RBF A;  1B01 A;  2BNW A;  2BNZ A;  2BJ7 A;  1ARQ A;  2K6L A;  1NLA A;  3H87 C;  3QOQ A;  3GXQ A;  2CAX A;  3PHT A;  2KEL A;  3FT7 A;  1PAR A;  3BKU A;  2BJ9 A;  2CAD A;  2CAJ A;  2CPG A;  2JXG A;  3VEA A;  3VW4 A;  1ARR A;  2CA9 A;  1BDV A;  2WVF A;  1P94 A;  2K9I A;  3OD2 A;  2JXH A;  4HV0 A;  1X93 A;  2BJ3 A;  3BKT A;  2F1F A;  2BJ1 A;  2K29 A;  3QSI A;  2WVE A;  2AY0 A;  2BA3 A;  2BSQ E;  2WVD A;  4ME7 E;  2K1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...