2WVBA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
130
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTAIAMDEHNSLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 36
structure length 130
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvbA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvbA02
2K9IA 3BKUA 1BAZA 4HV0A 4FXEA 4ME7E 2BSQE 1U9PA 2H1OE 2F1FA 2BJ8A 2K5JA 2BA3A 2CA9A 2BNWA 3PHTA 2BJ3A 2CAJA 2HZAA 1BDVA 1ARRA 3H87C 1MNTA 2BJ9A 2WVEA 1Q5YA 3QSIA 2HZVA 3BKFA 3VW4A 2CPGA 1MYLA 2WVDA 2K1OA 2Y3YA 3VEBA 2BJ1A 1MYKA 2BNZA 3OD2A 2JXIA 2JXHA 1IRQA 3FMTA 2NZCA 2AY0A 2CAXA 2KELA 1NLAA 1BDTA 3BKTA 3VEAA 2WVCA 1EA4A 2BJ7A 3GXQA 3QOQA 2RBFA 2GPEA 1P94A 1PARA 1B28A 1X93A 2WVBA 2PC6A 2K29A 3LGHA 1B01A 2JXGA 1QTGA 1Q5VA 4D8JA 2CADA 1ARQA 2K6LA 2FGCA 3FT7A 2WVFA
chains in the Genus database with same CATH superfamily
5KT5A 1K1QA 1UW4A 1RWUA 3H2LA 4TY8A 3QRPA 2UUAJ 4RBTA 4FPIA 3NCPA 1U1MA 2FHJD 2FDNA 3PHTA 1VQ4S 1JXVA 3CMQA 1DARA 4I2QA 1A6LA 4ED3A 2V4JB 4Q2LA 1JLGA 2W25A 3TJAA 2ALYB 5A8KB 5F0UA 4PQUA 2D3UA 4K4SA 2R4FA 4ED5A 2YWGA 4FXWA 3BBCA 1S1UA 1RWOB 3K5PA 4GVBB 4PG4A 1RABB 2M8HA 3MFIA 2HGNA 1HBUA 1U24A 4F2RA 1D1UA 2DEJA 1AZSA 2G1HA 3NGTA 4MYUA 5I42B 4KGXB 2E1MC 1NHUA 1S79A 2KB2A 3KFWX 2ZBQA 4ZCLA 2YPYA 5CH7B 1PJ6A 3OFHA 3ADAC 3OR2B 5LL6d 1NUEA 5MAOA 1REVB 3GYXB 3FCVA 3ILLA 1T03B 1NU4A 4PUOB 3CJ8A 2Y0SD 1IVZA 4ZVHA 3DRXA 2MLZA 1I5OB 1JJ4A 1Y3KA 2FHJA 3M8YA 4HACB 1KVJA 1ITPA 5HK4A 1ZZFA 2QL5B 3ZTQA 2HHVA 1HQUB 4N47A 4CO5A 2WB1D 1XK8A 3CIZA 5DRKA 2QMXA 5F9NA 1FDAA 4LBPA 2ZH9A 4V19J 2N3LA 3GV8B 2HFNA 1RB0A 2EWHA 4R0EA 3OL6A 1B01A 1N0UA 2UVUA 2MKHA 1AXQA 2H5JB 3W62A 2RQ4A 4Y2IA 3BM7A 3OLBA 3PX4A 1P1LA 4NLVA 5J1EB 1N36F 2X1FA 4B9UA 4IRDA 3T5KA 5AXNA 2WONB 3H40A 1SC1B 4ECVA 1IKYA 2DTJA 2ZHBA 4I4BA 2R2SA 2PMHA 3CVKA 2QEXS 5IC4B 2Y8YA 4RUBA 1TAQA 4YFUA 1VR6A 3HD1A 4GC6A 2ZE2B 3DMJA 1NMEB 1YJ9S 1RTHA 1AYEA 4ATNA 1M90T 3KK3B 4ZPTR 3IN5A 2IDEA 5BR8J 4IG0A 2YX4A 3RU0A 3ENQA 4C98A 3FMWA 3D54A 1VK8A 4PYDA 1Q79A 3BKTA 4PXCA 1R8AA 3I0RB 1DBDA 3IRXA 4NLPA 3PX0A 4H4KC 2P2CB 1TKXA 3P96A 3I55S 1YJWS 3M9OB 4WBFA 5KFDA 2H54B 1RT2A 4USWA 4JI3F 4QPTA 3TAPA 3QGHA 1VQMS 2B51A 3KHGA 4UT4A 1P9YA 2KOEA 2AGOA 4UZCA 1UW9A 3A8IA 3G8SA 1S1XB 4BHQA 4N41A 4RUAA 1PBUA 4ZP9A 3DXSX 4AUKA 4D3GA 3DRRB 4NLYA 4UOHA 1BDVA 3FNNA 1FRIA 3B54A 4HVZA 3C16A 2F63A 3WX4A 4DR1F 3A8KA 3T1YF 4K4YA 1IR2A 4CLKA 1FVSA 4X4SA 1IBLF 1XJWB 1X4BA 1FKAF 1D09B 2Y1JA 3T6JA 5C25A 2YKPA 3PVXA 3BV8A 2RIJA 4DF8A 2J0XA 1REGX 1SKWA 1Z2LA 2V2VA 2C2MB 1HMVB 3FRYA 1KEKA 4DR4F 4ZVQB 5KT3A 2DR7A 5KG5A 2JXGA 2XSFA 4OZJA 1EJ7L 2XCPA 2ZH1A 4QU6A 2RQMA 1TK8A 4MTPA 4XIUA 3Q8SB 2LXFA 1O0PA 4X2BA 2XS7A 2MLYA 1ZPVA 1HWIA 5L1IA 3ET6B 2DRDA 2GVZA 1VBYA 1F5CA 3HFKA 4RNOA 4R8UA 4EEYA 4HT5A 1QUPA 5M2RA 4I2PA 2CRLA 1ROFA 1OY9A 1UAWA 2H5IB 4Q7AA 4DX6A 5A2QU 4N56A 3HZEA 1HW8A 1SH0A 3NS7B 2G2OA 1C0TB 1XTZA 1RSCA 3GFYA 1VC6A 4B3RF 2VASA 4LF7J 2CJ9A 3MCOA 4GRSA 4EWTA 1OY8A 2DNOA 2CPJA 1MSWD 4OYXA 2GS8A 1OYEA 2K06A 1R6YA 1IJFB 2L3MA 5IV4A 2FYXA 1LFPA 2MHEA 5GMDA 3CCES 2H65B 4NZ6A 1MWZA 2YKMB 3DLEA 3MHYA 4TXSA 1NK5A 2M5YA 1NAQA 4LF1A 4ALZA 2B0GA 1PAUB 1S0MA 2GQCA 1T05B 1SCJB 2RAQA 3K5LA 3EM1A 3MM6B 3MMJA 1FJGJ 4OJ3A 2FGOA 4BC9A 3K57A 1Q7YT 4OV6A 4FZVA 4B08A 1Q95G 2GVDB 3F44A 2YKNA 1SV5B 2M8DB 3H98A 4EO8A 2CZ4A 4RNMA 5ETTA 4DJBA 1T3OA 4NLRA 2XYGB 4TU8A 4KHPJ 1X4AA 2LU2A 4ENOA 3TZXA 4JV2A 5EGYA 3GE9A 1UJ5A 3QSIA 1J2VA 2FLNA 3NAHA 2WRMA 3KJQB 2QGFB 1PCAA 1HNIB 4L73A 2RVJA 4TLRA 4RWWA 1IKWA 4B9TA 3NBPB 1NKBA 3IG1A 4C6AA 2ZFHA 2HQIA 4FYDA 4DSLA 4NWBA 2VPZB 3KTQA 3DLGB 2NYIA 2QSFA 5J2QB 4DUYJ 5KFTA 2OMOA 2HZCA 2ZJPQ 2VU5A 2K6LA 5L8RC 3M6VA 3R27A 1LKZA 2KKEA 1S1TA 4WU3A 4GMKA 2OPQA 2ZH2A 1O8BA 4HR2A 1KR4A 2FZGB 1TV6B 5KT4A 1HNVB 3OBIA 2V34A 2RQCA 4QIFA 2GJ2A 1L3TA 4ETZA 2W2OP 2R8JA 2QMWA 4LR7A 5KFNA 1LWFB 3IAS9 3PJ9A 1U2RA 3AB2B 3NGUA 2DHXA 2RHSB 3D0IE 2EK1A 3JTNA 2RUSA 3ICLA 2IMWP 5E3CA 3RJMB 3CO0P 2M70A 2U1AA 5KFSA 2IAJB 4OI1A 4LF8F 4RWXA 4CH0S 4UOCA 4K5SA 1LXJA 4USTA 2BJ7A 3J7YI 1N4LA 3BSNA 1GQEA 4F50A 2HHHF 3CJ5A 4ILRA 2XY6A 4XTTA 4BCAA 4RW8B 4EUVA 4WP3A 2FVSA 3MPWA 4IH6A 3G8TA 2RDJA 4DR2F 1X5PA 5H9EK 1VISA 2LLZA 5GMKa 2RNEA 3KUGA 3POTB 4I56A 3FGVA 4AXIA 4C8KA 1VS3A 1Y10A 3WIVA 4WU2A 1UP1A 4X62J 3W61A 1HQUA 2FTRA 2IRYA 2DXDA 3GJSB 5JUMA 1Q5YA 3H2UB 5BYRA 3S01A 4OYAA 2CWXA 1WOPA 1YTYA 2XMAA 3PG9A 4ZJLA 3SCJE 1T02A 4O0NA 3TX0A 3FBBA 1X60A 3Q22A 5D15A 3N01A 1Y5NB 5THWA 6AT1B 4NXNJ 4ZLJA 1V3SA 3SCIE 3EMTA 2DIVA 5J1EA 3DFEA 3FSYA 1WG5A 1HNZF 3PY8A 3OFEA 5HQ8A 3RB6A 1SJFA 2RDIA 1V5VA 1YKWA 5E3QA 2N7YA 4WFBQ 2KM8B 1EQ0A 4QWCA 3TZWA 2DEIA 1FX4A 1CJTB 1DQ9A 2PT0A 5LSOA 2B5JB 5D4NA 4A8KA 2HAFA 2BXJA 4BS2A 1DTTA 1VHIA 2RUGA 3VAHA 2OFGX 4OX7A 1OQ6A 3UWTA 5CZXA 3CD7A 3MCNA 4NLWA 1OWXA 3OVAA 1YZ7A 1HBMB 4JYAJ 2FC9A 3O5TB 1RBOB 4DCOB 4G1QB 3PFEA 3SI8A 2KXNB 3MECA 4M95A 4LRFA 2HVHA 3RYLA 3SZ2A 5H9FJ 2HFSA 5L1JA 3SDEB 4DR3J 5HBMB 3ZO7A 3TWZA 3HHLC 3FBEA 2YWFA 1QAXA 1D9FA 4NYZA 2VPYB 3RB4A 3QT5A 2DO4A 2G0IA 1YBAA 3GONA 4O44B 3SFUA 2WVCA 1RTIA 3GQCA 3NNCA 1TMMA 3MM9B 2BE7D 1S1XA 3GFXA 3D5MA 3C14B 5HROA 2XMMA 4ZCIA 1SI9A 3CTRA 1FO1A 5ETVA 4USHA 1ARQA 3JQJA 1TKTB 1WTFA 3LQVA 3H5YA 3QAEA 4PRFA 3MM5B 3PACA 3SQGA 3AOBA 2E7XA 3IXQA 1QLNA 2KFNA 4Y2MA 3M2RA 2WOMB 2XGQA 3NG8A 4DXLA 4YN3B 3MCMA 1LK7A 1TL1A 4MYTA 4FF3A 3R2CJ 3MR6A 4IH7A 1TELA 2B9WA 3CJ4A 3NOCA 4CIOA 2KFYA 4AL7A 4B9SA 2XI3A 3TUZC 3I4HX 3DI6A 3IBCB 4C7QA 3LJPA 1NK4A 3PEHA 3UW1A 3BJYA 2E5LF 3VGVA 2J8SA 5D4OA 1WOOA 2AY0A 2MZTA 5KFMA 4JV0A 3NMAA 3N6NA 2LKZA 3C6TA 1EETA 1VK3A 3IWXA 2JVOA 1T3NA 2VPWB 1S12A 1TMJA 3ET6A 4KKOA 3OVBA 3QAUA 1AUSL 5J1NA 2QJ3A 4MJKA 4F0HA 1SIZA 4G65A 1JIHA 1N5SA 2VG5A 2B4OA 1X7VA 2HNYA 1X5TA 1DZ5A 2BE2B 1RT3A 2BYCA 1HI0P 3K8VA 2IHR1 1SC3B 4N76A 4YEAA 1C0TA 4FS2A 4WFNQ 2CYYA 3MR3A 4F3MA 5DG9A 3CJKA 2F8MA 4OFZA 2BM1A 2MSTA 3T41A 1VBZA 2IBKA 4OYOA 4DUZJ 4DFKA 1H6KX 1XNRF 2KH9A 3QLHA 2AV5A 3O6QA 2V69A 2B4VA 4FBTA 5ETKA 1MU2A 2ZKTA 3NEKA 1MYKA 3MMAB 3G6VA 3TJ8A 4A48A 2F9JA 3EGWB 1LWCA 3MUVP 3V6JA 3DOKB 3AD7C 4WWSA 2XS2A 3TOQA 1DLOB 2BEFA 3SEOA 8ATCB 3HVWA 4JI5F 4LVNP 2F5GA 1QUVA 2ZBIA 4Q0BA 3X1LB 3QRQA 2EC2A 4F25A 1RE1B 3AH6A 3TO8A 3R1HA 1X4GA 4QWBA 1NJXA 3FSIA 2VBWA 3PW2A 3J7YU 2V8GA 3MFHA 3KLEA 5G4DA 1HNIA 1KVIA 2MZQA 3M8SA 1IKXA 4Y2CA 3MD1A 3R5AA 2GAGC 2HHHJ 4QIGA 1Q82T 2KI2A 3LPYA 2Y0BB 1I94F 2OKQA 4CRJA 2RDDA 4DUTA 5KFPA 1JLAB 4G3IA 2XHCA 3DGVA 3C6UA 3W2VB 4Y34A 2JEIA 2FUG9 3LP1B 2QTWA 4CLWA 3AXKA 2AN7A 1RKJA 4A8FA 1FRXA 5KG1A 4ZLLA 1PYTA 4F02A 1YG0A 3RUBL 5GAGI 4YY3J 1N5YB 3ENAA 3D0HE 3FZ2A 1HBNA 3B4DA 1TV6A 3GSDA 3K89A 1JQGA 2IVFB 3PJWA 2EKNA 1FNMA 3DOMB 4B9LA 1FRLA 2ZC4A 4G1IA 1MROB 5KG0A 4DV4J 5HLFB 1K0TA 1K47A 2FB0A 1A9NB 1RT1B 5CCMA 4WK3A 4ZPWR 1QTMA 2LP4A 2A2BA 1GTHA 3AY0A 1WSVA 2CPEA 2A6OA 3QT6A 5CQGA 3IR6B 3KOAA 2C3OA 1K1SA 5F0WA 1WEZA 1PGZA 4N7TA 4O3NA 1PYOB 4EBEA 2ROGA 3BREA 3OQ2A 3CJQA 3VW4A 3QRRA 1YBUA 1S9EB 3IMQJ 1UVNA 2LQ9A 3LPEA 3M4XA 1WC6A 4RW8A 5F3ZA 4KO0B 2JXHA 1S9FA 4DL3A 4P2FA 3KLGB 2AJFE 2VB6A 4WK1A 3HF5A 3I5BA 1HNWF 5F8LA 2RE1A 2RH3A 4QIEA 2BOAA 4PPDA 5B09A 4IDKA 3W7BA 4IFYB 4B3SJ 3CC4S 1RI7A 5FLXY 3RAXA 1XWLA 1B0TA 2J5AA 4OI6A 3FZBA 3PR5B 4N8NA 1EIYB 2G0JA 2NSBA 2RSQA 3CCRS 3BDPA 4JI0J 1WG4A 3OSPA 4G1PA 4Y3CA 1GTEA 1KQSR 2W8LA 2KRRA 8AT1B 3ISZA 1J5EF 5FD1A 2PDAA 2P6TA 3MZIA 2BJ8A 1BHNA 4FN5A 4H4MB 1RLCL 4PWDA 4UUXA 2GMJA 2Q6BA 2L9WA 2MXYA 3EVMA 2NSCA 2HWTA 1JX4A 2MMYA 3D6FB 1R0CB 2HS3A 5DQGA 3GJRB 2QFJA 2OTLS 1T95A 1SPBP 3CE8A 5EWEA 1K8AT 1SC4B 3H7HB 2BDPA 2HVEA 3NY0A 4I68A 4Y65A 1KLMB 2V2ZA 3JAMU 3AFGA 3IR7B 1R43A 3VV2B 5A8RB 3OL9A 3BR8A 2UXDJ 3V6KA 1BC6A 2CIMA 3VGUA 1Y4ZB 1NPKA 3EXYA 4WFYA 1NK9A 4NEZA 2VFSA 2CG8A 2OPRB 4NE9C 1Y3JA 4HL9A 3TUIC 4RBUA 3CO9A 4OHVA 2CKWA 1FK9B 1EHWA 2W9CA 4U96A 3RRKA 5L1LA 2VDHA 1SH2A 4UOGA 3MAHA 4P72A 4FXEA 3VAGA 2W8KA 4LRAA 4FP9A 4V1Ak 2BW7A 4NI2B 1LOUA 2DVIA 2Z2MA 4FDFA 1OSCA 2E1AA 3Q8PB 1O5JA 1S49A 3BYRA 2BW2A 4LIWA 1KBRA 2K3KA 1UWAA 2WW4A 4DV0J 4EYIB 3TAMB 1JKHB 1QJHA 2UV8G 1FXRA 4CDIA 1O6XA 3CDUA 1PIEA 3RB3A 3HPOA 1N8RT 1GEHA 2NS1B 3L4BC 7FDRA 2RB7A 3H4BA 4EMDA 3I32A 3CULA 2YPZA 3CDEA 4DEZA 2YNIB 2CJKA 4J9OA 2EFVA 1JJHA 5FJ4A 1X9MA 3AXMA 4DPWA 1QE1B 4ZCMA 2CVIA 1R31A 3IR5B 2XLIA 5MLCV 4LF6F 1M0SA 3BKUA 5L38A 3PIPQ 1FRJA 3HHEA 4Q44A 3OR1A 1DURA 1VJWA 4KTQA 2QX0A 3NCQA 3GV7B 2XQCA 3HKZD 2B6AB 3WC2A 2ASYA 3KLHB 3GIKA 4URSA 2MKKA 3G87A 5HANA 2UUBJ 1GXUA 5F8NA 2ASJA 1H0HB 3D28A 1NJIT 4PABA 2CPYA 1OMSA 4WP8A 1GH8A 1NH7A 4KGZB 4DR6F 2ZEJA 4DV2J 4WXOA 4L76A 4KBIA 3N4WA 3GYGA 4USIA 5F8MA 2DGTA 3GTYX 2HK3A 2OEKA 3CW2C 2VL1A 4M5HA 3D1QA 4HI2A 3M1VA 3TANA 3MDFA 4F3QA 3SV3A 1N56A 4DV1J 2QLWA 2K7JA 2CADA 3BQ1A 1TFWA 2GZOA 3Q2SC 4CT9A 3G96A 3U1MA 4ZPVR 1WNEA 3JSMA 2C2ZB 4PWWA 4Z7CA 2ZM6J 3ZZOA 4DL7A 1WI8A 4YDDB 1HL6A 4M5NA 2PA8D 1Q0NA 5GAGU 3BO2A 2R7WA 4A47A 4F4AA 3W64A 1KDNA 2BANB 3PO5A 4J9SA 2CA9A 2YWEA 3CCJS 2FQQB 1RAOA 4C2MA 2QE5A 4RW7B 1RTDB 4PCQA 2Z30B 1DLOA 2OELA 1TP7A 2CNKB 1RKIA 1H7WA 1SKUB 3GCXP 1HBOA 1C1BA 5KFXA 5HP1B 1VRUB 2FJVA 1TVRA 2JHEA 4L3NA 2AJ2A 2AJQA 4I6YA 2ZHOA 5CAAA 2C22A 4UZBA 2NLWA 4ELTA 4KFBB 4PPZA 1F9EB 2HIQA 2M7SA 4C3LA 1RWMB 2ATCB 3QWPA 3ITHA 5BYSA 1AUDA 1YWXA 2WVBA 2XB2D 1N5TA 3Q8VA 4R5PA 3CWJA 4GKKJ 1X5OA 3QO9B 2XO7A 4PKDB 2UU9F 2YH0A 4PQAA 1LWEB 2AQ4A 3THTA 3BGRB 1X4CA 3DRPA 2VZ9A 3NOGA 5KFAA 4KGVB 4YHHJ 3W2VA 5J2NB 4X84A 5DGBA 3RZAA 1FE0A 2L41A 4ZCKA 2R7UA 1UA1A 3MPVA 1T7PA 2HHSA 3M6WA 4X4OA 4IR9A 2AW0A 5HO4A 2NREA 2HVZA 1FX2A 1RK8A 4QPXA 4YB1P 1RAJA 3GP9A 4WYWA 2AJ4A 4RW6B 2BNZA 3SMZA 4DI6A 5T7LB 3RRGA 4KH0B 2DR5A 2C3PA 2EFQA 4G6VB 4EBCA 2J6TA 4M63A 1KQFB 3MM8A 2GIRA 1RT1A 1U0SA 3HHKA 3MEGB 3D7SB 1NB7A 4K4TA 3DLKA 2XSJB 1PJ7A 1N34J 4QW9A 2ZH6A 1NDCA 1KTVA 3BQ0A 2PN6A 2RU9A 1S6OA 2AF6A 1OJ4A 3KK2A 1S9EA 3VHQA 4OYIA 4OX6A 2IYGA 2OHDA 5ETRA 5I3UA 1P6TA 2VHGA 3QIPA 5I3QA 4ED4A 4KO0A 4DV6J 4X4VA 4KAIA 3SBMA 4WXWA 2WK4A 3KJVA 4DQIA 1ZS6A 5LT5A 4XK8C 4EZ6A 2LU1A 2ADLA 1HR0F 2F4VF 1WELA 3N28A 1UJ6A 3M8ZA 2HKEA 3G6YA 2FLOA 4B17A 2NZCA 1SUQA 1KD1T 1FFWB 1KNZA 4JV1A 2H1YA 2V8DA 4CYUA 2Q66A 5KG4A 4ED0A 3NAIA 3W3SA 2ROPA 2KYXA 2ASDA 2Y9HA 4C4WA 3OTOJ 2CXEA 2K1RA 1OY6A 4OYPA 3EX7B 2H5EA 2MSSA 1TUVA 5IM0B 1UWBB 3PYEA 1UETA 2CWKA 1QTNB 2FGCA 2DIUA 1JLQB 2FD2A 5L46A 1AB8A 2ASLA 1F9HA 1P9QC 1N33J 2WBMA 1N6QA 4B3MF 1FDNA 3MOZA 2VQEF 4QW8A 1CS4A 5CYQB 4WIIA 4JB8B 3U1LA 3LWMA 4JI8J 5C42B 5C5JA 4GO7X 3IR7A 4DR5J 1S6PB 1TKDA 3WX8A 2AD9A 4DDFA 3ZNJ1 1Y11A 4O3RA 2KZMA 4C8LA 2Y1LB 2K1OA 1K9MT 4ZK7M 1PAEX 4P2MA 1LW0A 3TEHB 2B9YA 3GIRA 2EI5A 4CLZA 5IFMA 4FXVA 2KG1A 1RT4B 2FPHX 1RYSA 2COLA 4LSLB 2PI5A 2CPZA 3NGDA 4USKA 2B43A 5AE3A 3PO4A 2IC3B 4EGLA 1C2PA 5HN0A 1UFLA 1E6YA 3J81Y 2W01A 4YQWA 1VBXA 2A0FB 4LF2A 2ADBA 3VZIA 2MEWA 4CO4A 3FUYA 2J9EA 3I9ZA 4ZP8A 3I4PA 4LMZA 3TZZA 3M30A 2LEAA 3SSSA 2KHCA 5EHHA 1X0FA 2RF2B 2QLXA 4ZP6A 3DRSA 1FI4A 2F8EX 1R0AA 2HGLA 1IKVA 4JI4J 2WSEC 4U7UD 3CJ0A 4LFAF 1TL7B 2M2BA 4P10A 2W9AA 1NNDA 2VV5A 1FWLA 4NLDA 5DETA 2AYBA 2R2UA 1UPPA 2PC6A 2MQNA 5E41A 3EGVA 2OPSB 4DZ6A 3H5XA 3PW7A 1RGVA 3TVYA 4D8JA 3FEZA 5DG8A 2JFKA 3OTDA 1H72C 5KFKA 5KFHA 1JLFA 3OTEA 1M1HA 2V8HA 2QT7A 3KWMA 1B7YB 4DF4A 2GA7A 4DS5A 4BC7A 5CA5A 3ZTOA 5E3RA 4HT7A 3CMES 5KFEA 3HJFA 2DNLA 1EQMA 3FBCA 4P2XA 4CLTA 4TY8B 4DN9A 1FD8A 2BNWA 2JZ5A 4WP9A 4FBUA 3LTOA 4OHZA 4KIAA 3NGSA 1YZ6A 4I2QB 2BQRA 2J0SD 4LFCF 3KJNB 3OD2A 3L7UA 3GB0A 4BWMA 1JLGB 2KL8A 3ILIA 4U7CA 1NSQA 4PQUB 4A8YA 4P7TA 5JVHQ 5GAHI 1SJRA 1FESA 1Y5IB 1S1UB 1SKRA 4NCGA 4H4OA 4WF9Q 1LNQA 1ZAXA 1HBUB 3RBEA 3FEXB 3GIMA 2HVDA 4K0KF 2AYEA 4K7QA 1AZSB 2F4FA 2Q6CA 5IWAJ 2A1BA 1KFDA 5D77A 4MJWA 3EYZA 1S7IA 1S0NA 5DG7A 1UVKA 3MEKA 1SH3A 4JV5F 1F1BB 1WOSA 2I5JA 4CQ1A 3OPKA 4OX9F 1RWNB 3W2WA 1X9SA 2JWNA 1FA0A 4LF5F 4X65F 2Y1RI 3IBFB 1H2VZ 5HL7Q 1DY3A 2CQ2A 4ECXA 5AJ3F 5HJXA 3HKWA 5C2GA 1YGYA 4X4RA 4LR9A 2H3AA 1S57A 3B4MA 1TL4A 1WHVA 4FKXA 2FLLA 2NXCA 2FVPA 2CPGA 1BQNA 2VQFJ 1URNA 5KG2A 4P73A 4RL1A 4ED1A 1UFKA 2V8VA 4TNOA 1F6TA 3QWUA 4DMZA 1F3VA 5HQMA 1RISA 3DDKA 1FCAA 1B3TA 3Q8RB 2A10A 3MF5A 2BKOA 4DR7F 3GXQA 2P8IA 4NLUA 3RG6A 2ZKUA 2DR6A 2VUGA 4AFFA 4M5IA 2DT9A 1RZMA 2V2KA 2PEBA 4KHMA 2MTLA 4K4WA 3N5FA 3AAWB 3LW5C 2KTQA 4CT8A 4KC5A 1IKYB 4TU7A 1ZA1B 4QOTA 4RW6A 4I67A 2MZJA 4K2JA 2IRXA 3AD9C 4JI1F 1XMQJ 1CJUA 4WPAA 4C48A 3US5A 3J80Y 4ED2A 3G6ES 4F26A 4ZVSB 3DMJB 3G2XA 2NXNA 2WVDA 3OHAA 3MMBB 2DHGA 4CI0B 1RTHB 3RTVA 1JXEA 1WSRA 2XG8A 4IG0B 3UI3A 5HI7A 2W2QP 3V6DA 3VGTA 3HM9A 4B3TJ 1HWUA 3MURP 4ZDNA 3CCZA 4DOZA 5I4MA 3ZTSA 1I1GA 3M2UA 4ZLNA 1QD1A 2LA6A 4MT1A 4YR2A 3EZ5A 4YMEA 4J9KA 3H5SA 3IFEA 2R7XA 4IUFA 3IRXB 1LFWA 2YTCA 1TKXB 3AQOA 4OJGA 2YKOA 4DU7A 3JXOA 3V6HA 2NCKL 2OSQA 1XNQF 4ZJOA 1PBAA 5KFRA 2HK2A 5EWGA 1HFEL 4JI7J 1RT5A 1S0OA 1RT2B 5KFYA 2R7QA 1WTBA 1CEZA 5IOLA 3G8QA 2ZC3A 2B8QA 4WZQA 2Q2KA 1B70B 4OQJA 2NPIA 4USVA 1YJ7A 5L39A 4DU8A 5HJYA 4ANCA 2VDIA 2Y1IA 5CABA 4O3PA 1MMDA 1U1PA 3OJSA 4CO3A 3W65A 3U1NA 1VQ9S 3FMBA 2HQCA 3C16B 4QBUA 2BRKA 3BH6B 1SQGA 2QSWA 4L75A 2J9CA 3NXZA 2W2PP 1RTJA 3GILA 4LT6A 2Q43A 1HA1A 3K2YA 1R8PA 4QIVA 2YVSA 2D3ZA 1UWBA 3ZZ0A 4JI2F 4OJ1A 1MLAA 3KLIA 3DLLQ 4TLQA 3O3LA 3N5BA 4NASA 2KVQE 5C25B 1VMBA 3EZOA 3WZ0A 3E2EA 2EBGA 3S8SA 2KFZA 1X4DA 1S6QA 1FKOA 3N9UC 2DH8A 1SQEA 2VFVA 2DCLA 3L7PA 1HPZA 3BSCA 4DLEA 3M9NB 3MR7A 1D3WA 3JSBA 1HWKA 1UVIA 2NXEA 1KC8T 4DV3F 3THPA 2WAQD 1GFWB 4IYQA 2GVZB 1KVKA 4M5MA 2E1RA 4RU9A 1GMVA 4R8UB 3A3PB 2XY5A 4I2PB 4OYBA 3I56S 2I1RA 2MQ8A 5JMNA 2LCWA 4CLPA 4TQRA 3DNCA 1FEEA 1WEYA 5IT9U 2ZH3A 4AQYF 3MTJA 4DFMA 4U7UK 3C19A 5D78A 4URGA 3E51A 1FTCA 4NA1A 1X93A 3PYFA 3HSGA 3GJQB 2QN6B 4X64J 2BACA 4C8NA 4KB7A 1CSJA 1VC5A 3DXBA 2IFXA 2GIQA 1HD0A 1OHNA 5GAHU 3DLEB 3PYDA 2FJDB 2WB4A 4I6AA 5LMUF 4WZMA 1U49A 4ZVRB 3B78A 4OI2A 1CJVA 3EICA 2J8AA 2W4PA 3F41A 4CCHA 3K5MA 1XIQA 4O3SA 5H9EJ 3R7SB 1RAIB 2BOPA 5D0GA 5FDLA 1RJJA 2YKNB 3M8WA 2DCUB 5SUHA 2GJIA 3MMCB 1VQ6S 4HDGA 3VZHA 2GW8A 2EK6A 1LXNA 1G4CA 4OX9J 2KHDA 4M94A 4WE1B 5IZHA 1HWJA 4X65J 1CC8A 1IKWB 2I2YA 3P5BP 2M9KA 1R89A 1YDLA 3HFZB 3IG1B 2IYIA 1NK7A 4XDDA 2DH7A 2E66A 1LWXA 3LP0A 4OX8A 4UY85 1GT8A 4IG3A 2RILA 5KFCA 2I9SA 1XBWA 1GMUA 1N88A 3ONQA 2CJYB 3PTWA 1NJWA 3F56A 3QIDA 3H42A 3TQEA 5ETPA 3IWNC 1S9GA 1S1TB 3ELHA 4NCAA 2GGPA 1QVFR 1R27B 1XMOJ 2QA4S 5B0CA 2X51A 5E5NA 2GMLA 2DNQA 3I0SA 2OPQB 5IV3A 3HVAA 2DHAA 1U47A 3HSDA 2WBRA 1U1KA 1V9OA 3P8BB 2B9EA 1AA1B 3BGLA 3C3LA 4ZVGA 3SV4A 1HI1A 3MD3A 4DL0C 1EX8A 1NPPA 3A3NB 2XBPA 1M1KT 2MZSA 2QYGA 2XZWA 2ZZMA 3W9HA 3DHWC 5HVGA 1GX5A 2FVRA 1EB0A 3Q89A 3QNWB 3AQPA 4H4KA 3H0PA 3VTIA 2QLBB 1B28A 5D8HB 4PR6A 4DV5J 5HMXA 5IXUA 1IJEB 3GV5B 2CQ0A 4NMLA 2HHQA 3UN3A 4KY3A 1FRHA 2YNHA 3Q8YA 3TX8A 1U09A 2A3JA 2K5JA 5D4LA 5LSRA 4IH5A 2ATLA 2V5HG 2IM3A 1SL1A 3UNYA 3A8EA 3MPYA 3SSRA 3QSYB 1RADB 4GVLA 1SJQA 2OFHX 4FPRA 1RQ0A 2XS5A 1YRXA 3PHEA 1TQLA 5CZVA 3DM2A 5DDQC 5KT2A 1K44A 2LXUA 1B0PA 2N3OA 3CB4A 5ITHA 1LK5A 1JLCA 5HAOA 5ADZA 1XR6A 1OPIA 2CQ3A 4Q2MA 1QM9A 2JSXA 2A2DA 5SZTA 2VKRA 2HBYB 3NL0A 1DRZA 3MAAA 2CNOB 4X4UA 1FVQA 2EC0A 1X5SA 2VD3A 2LXIA 2D3OR 2CNNB 2ZBCA 5B08A 4F7VA 4GKJF 4X4PA 1ULRA 2DXEA 4WKYA 2MKIA 1P1TA 1DTTB 4LF4F 1C0UA 3MMBA 3K0JA 1IBKF 2F8HA 3JS9A 5A0YA 3IAM9 2XO6A 1RAGB 1GNKA 3PR4A 3KDNA 3EZUA 1FEHA 1KS2A 5LSLA 4J9LA 3OXFA 3OHBA 3Q23A 1X8DA 2JH3A 3DDNA 3MECB 1R6VA 2YXLA 2AZ3A 4L74A 3IP0A 2BE9B 2DJWA 5DGAA 3AA8A 1XC9A 1L3UA 4CO2A 3W5XA 2CG4A 1T9YA 2PI4A 2CPFA 1X31C 1WC4A 4NXMF 3OUYA 1RTIB 4ED7A 3ILJA 4KV8A 3L7OA 1NK6A 3OTBA 3NRBA 3HSZA 5FIIA 4LJMA 5DLFA 5HROB 2E1CA 2GHVC 5CHCB 3OFGA 3NP5A 2UXCF 2L08A 2G13A 3D68A 2K9IA 3DGPA 3AA9A 1GAOA 2O67A 1BQXA 3HCXA 2HURA 1RU2A 3FKBA 4KYZA 3SQGB 1X4EA 1TKZA 3M2RB 2W1BA 4J91A 4Z37A 1C4AA 4E2FB 2Z2YB 1TL1B 1B7FA 3FCHA 1IBMJ 5D6GA 1CBKA 1YBTA 3LAMA 3RW6A 3PEJA 1U4BA 1FRMA 3NNAA 2DGQA 4OZLA 4MKYA 1VC0A 3AHPA 3SYZA 4DN0A 1UEVA 2ZZNA 1URRA 3DI6B 3VALA 3JQKA 1SL0A 7AT1B 4DL5A 1DJ0A 5F8JA 1IRQA 2IA6A 2XNQA 3VCDA 2DNKA 2G9OA 3L9ZA 3H2VE 3TYTA 1RLDA 4IOBA 3RBDA 3WHIA 3C6TB 1EETB 3IGVA 4LBIA 2R7TA 4ZIWA 3TA2A 1S48A 5KG6A 2DHSA 4OV1A 3K5OA 1H38A 3KHHA 3KHRA 2Z2LA 2Q79A 4KKOB 1JNZB 1N32F 5EUHA 3M8RA 2LA4A 1NXIA 1S6UA 2ZNYA 2VG5B 1HHSA 5KFJA 2HNYB 1U1RA 2MJUA 4MKAA 3HVTA 1RT3B 2H4YB 2Y8WA 4FS1A 2AYMA 1OS5A 3VQSA 4OZ5A 5F8IA 4U8YA 5HATA 3LP2A 4Z7YA 2D74B 3CJKB 2RD5C 2MHNA 4M5DA 1WC5A 4B3OB 1F2GA 3TP2A 3NMRA 5J2MA 4AL6A 2V9WA 3QLHB 4I1TA 2BABA 1RT6A 2AU0A 1MU2B 2X3GA 2NUHA 2CQCA 5K5MA 2L9NA 2VFUA 4RJVA 1W25A 4FYXB 1LWCB 4RO0A 1CULA 2ZBRA 5J1PA 1VRTA 5K20B 4RW9B 1VQLS 3TA0A 2YY3A 2HRTA 2ZH7A 1BQMA 2VBZA 4EI2A 4M5JA 1WF0A 2CFXA 4Q0BB 3UCGA 3I82A 2IBOA 3M2VA 2PD1A 4F0MA 3T9NA 1W2IA 3MMCA 5CYMA 3ENVA 3H59A 4A4JA 4F3OA 3H8YA 2C3UA 4Q45A 1IUJA 2AX0A 2YH1A 3MM7A 1NCLA 4J9PA 4WE1A 3KLEB 2AZ1A 1NKCA 3DKDA 3WBZA 4HH0A 2JEJA 3C66A 1F2HA 1BWEA 2ERRA 1IKXB 1BMQB 2D1CA 2C3MA 2BBEA 3W63A 2OIHA 2MGZA 4ES3A 3C6UB 3E01A 2HYIB 1VQPS 1TR0A 1JJ2R 4DV7F 4W90B 1NLAA 2CQBA 4QYZK 2RHQB 1B0VA 4C8ZA 2QL9B 2NZ4A 5KTQA 4ILMA 3W60A 2BVZA 4LUBA 4I6WA 3UN2A 2AEFA 2J6SA 1X4HA 1V5IB 1PYSB 2D69A 2PO4A 1HBNB 2UUAF 1UVLA 2ABYA 2J6UA 3EDRB 5EN1A 4NMXA 1F0XA 1Q81T 2JC0A 1N36J 4O3QA 3JTPA 3M6XA 3RR8A 4YS2A 3FFIA 2RKIA 3HP6A 1VQ8S 3JYTA 2QO3A 2HZVA 1SXLA 1PSDA 2EXUA 4WFXA 1S10A 1ZETA 3JB9k 5B7WA 3RAQA 5JJBA 1NHKL 4ES1A 1Q7LB 1HD1A 1S1WA 4F4KA 1WWHA 1GXLA 1IBKJ 5KG3A 1R3NA 4ZKAA 2V68A 2VBXA 3LO3A 3GMGA 1D8ZA 3QJJA 2MQPA 4IDKB 3VVTA 3VF0B 2K3IA 3SSQA 2JNJA 2K2PA 2B4UA 4N77A 2XMVA 5T41A 1D0EA 5A76A 2WVFA 4C11A 2AT1B 4ID5A 1D9AA 2FJAB 2R7RA 4ICLB 2VC0A 1EZZB 1RWXB 3Q86A 3KYLA 1RT7A 4ZPCA 1KKHA 4JI3J 2ZWOA 1KSPA 4ZVTB 1DQ8A 1U6ZA 1RCXB 4GC7A 1H74A 1S76D 2P9EA 3CJ2A 4PWDB 1JB0C 4OI3A 1IQZA 3ZC4A 2IM1A 3ETOA 3GCWP 1YJTA 3FCWA 1N0VC 3THVA 2YX7A 2ALZA 2PEHA 4OZ0A 1CJKA 2J9DA 2C2KB 2V94A 1C4CA 2G2YA 1N48A 3K58A 4DR1J 3T1YJ 4MFBB 4M5KA 2ZHAA 3BN4A 4TYAA 3EDQB 1IBLJ 5KOWA 4A8MP 2RBFA 3TA1A 5DLGA 3LGHA 3KK1A 2HNDB 2AX1A 3U7JA 2BQUA 3FT7A 3GLJA 4TN2A 4DR4J 2W9CB 1UEUA 1NSKL 5A6WA 3R5CA 3MR5A 3QGPA 3KUHA 3BPSP 1U2CA 1QSLA 1YX2A 2C3YA 3S1TA 5BR8F 3Q2TC 2YQ0A 4HHHA 5GVQA 3BGFA 4HKQA 3PW0A 5A2QY 2JVRA 4NOHA 3GZ7A 3TI0A 3VQTA 3I6PA 5B0DA 4OZ2A 3HFVA 3KHLA 1CLFA 3OT9A 4MIBA 2OO4A 4AYBD 1X4FA 5LMNF 5IS2A 1FTRA 3EUNA 2AGPA 3HSJA 1UVJA 1U6FA 3R97A 2IM0A 3TUPA 4B3RJ 2AWZA 2Z0GA 5HVFA 1TK0A 2VONA 2HHUA 2IJNA 1QSSA 1RAFB 2KT5A 1Y5LB 1J5OB 3MEDA 2CJAA 3KG4A 5K9FA 3J81j 4CO0A 1WHXA 2J7UA 4PEOA 1YI2S 5I3PA 3CDAA 4XO0A 2ZITA 3OR1B 2IJRA 1YJNS 4Q8FA 2O1PA 5J2PA 4KR0B 3W5ZA 1HQ2A 2HGMA 2JJ4D 1YHQS 2VICA 5DQIA 2KN4A 4A8QA 3QPIA 1Q86T 2R2RA 1T0TV 1NK8A 2E5GA 3R5JB 3OV7A 1MMNA 2L48A 4HTJA 5LXYA 3VGSA 2MLXA 2OI2A 3G5OA 4EO6A 3M1VB 1NLKL 1NHVA 2KO1A 5K8PA 4B3OA 4USMA 2VG7A 3MEEA 4I7FA 2IA0A 3JSMB 4HV0A 1G2EA 5KT7A 1M5SA 2AYGA 2JEGA 4W98A 1VCTA 4TU9A 3P45B 2HFOA 4O4GA 3T1AA 2ZVIA 2FJWA 1RDRA 1KRPA 2PIIA 1VJQA 1S99A 2GNKA 4BDPA 3Q8UA 1HW9A 1QAJA 3O2IA 2GO9A 2ZJQQ 1NM2A 2D9PA 3Q8QB 1T9VA 3VAIA 5B0FA 2HNZA 4RW9A 4LF7F 2D9OA 3C46A 3DRYA 2NXUA 3ZXWA 4RLEA 5KFGA 8RUCA 1VOMA 2G2ZA 3TRGA 1HBOB 1C1BB 2IY5B 1CQNA 1TVRB 3T5JA 1DTQA 3QFWA 3TNVA 3P4UB 3MUTP 3LUYA 3EE3A 5EX0A 2LFVA 4K4UA 4M1KA 4CZCA 4K4VA 5KFQA 1TUWA 4PG5A 2LMIA 4LF8J 1WORA 1YJRA 3ITHB 2IJFA 5F41A 4ZOSA 3N79A 1RBAA 2LDYA 4R5PB 1FJGF 4PXBA 4RUHA 1FJEB 3W8GA 2D41A 3R5BA 2QA2A 2BMBA 4B9NA 1MWYA 2H51B 3IS9A 1WD6A 4KHPF 1FKPA 1QY7A 2XGPA 4ES2A 3LALA 2RMLA 1Q16A 3DRPB 3G82A 2X1GA 2BJEA 4DR2J 2QA1A 3HULA 4IOCQ 5LXRA 2FHOB 1U1LA 3UVJA 2EPIA 3QZ8A 1YLXA 5GMEA 2B3TB 3C15A 3HD2A 1H2UX 1T9XA 2WCXA 4J9QA 5C24A 1H7XA 2MKJA 2ZUAA 5B0EA 4DUYF 4IKAA 4KH1B 1KQGB 4PG8A 3CJ3A 3FBFA 2AMCB 3TVZA 1FNXH 2W2MP 3MM8B 2I8EA 1YVFA 1JLBA 4M5LA 3NWGA 4FYVB 3GSIA 5M2PA 4NLTA 2V0NA 4K2XA 3I5AA 5K8NA 1Q5VA 4DX8H 1HNZJ 4DQSA 3ENWA 2DGOA 3DLKB 2W4DA 3E3XA 3SCKE 5KG7A 1IR0A 2QC3A 2R3VA 3HMJG 2CQIA 2KJVA 2EW9A 4IO9Q 4ZVPB 4J7CA 3KK2B 3DCAA 3M05A 3QATA 4KJIA 4DBQA 1PILA 5I3UB 3QIPB 5E3PA 3Q83A 1L3KA 5BJRA 2JDJA 4F36A 1JK9B 3KJVB 2NQPA 2HMIA 4L6V3 4PG6A 3K7RA 3CF5Q 2DPIA 3AOAA 2V8PA 1S4EA 5E33A 2W9BA 1Q8IA 1WI6A 2NYHA 4TY9A 2XTJP 1GK8A 1SBRA 2PE8A 4QJVA 3J7AN 4TYBA 1SUQB 3NLCA 1X0PA 4ZPDA 4ICLA 1K0VA 4CYUB 3R7NB 2J0QD 2HHPA 1PARA 4DG1B 3KKFA 1S5ZA 3DLHA 1LW2A 4AXJA 3BBBA 1N54B 2K1RB 5A6PA 2Z4PA 2ACMA 3HT0A 4X62F 3ILOA 3DU5A 4IQMA 3O1LA 5AE1A 4PXEA 2QFIA 4M5GA 4DL6A 3DOLB 2XZTB 3Q24A 4MIAA 3RW7A 1N6QB 4MH8A 2PFFB 2NPFA 5LMNJ 1CS4B 2QL7B 3R3TA 2CPHA 2G1DA 4MFBA 4DPUA 2V4QA 3TW0A 4NXNF 2GC8A 2XMKA 3T1HF 1TZ0A 5T14A 1HI8A 2N82B 5AXLA 4WFAQ 5LJ5Y 3UNGC 4NLGA 4AL5A 1V3RA 2E1PA 2X1AA 2HNDA 2XMJA 4ZVUB 1NSAA 2HHTA 2IMOA 2DXFA 4P71A 1U25A 4CO1A 3UR0A 3A3OB 3CCUS 2WW8A 9RUBA 4DQQA 1LW0B 5GADI 1VLOA 1M1GA 4C97A 3J7A1 4LRCA 3CUNA 4CNZA 2CQDA 2JEFA 4CLUA 2R7VA 4DSJA 4DCPB 2UXBF 2EEYA 2E5LJ 1FDBA 2R8IA 1SVDA 3EGZA 1KTQA 1WEXA 2XZDB 2YNGA 1S59A 3DYAA 2MKCA 3VWSA 1HYSA 2MQMA 4E0DA 1U1OA 2VKZG 4N5SA 1U1NA 3GFHA 4JYAF 2MKSA 3IC1A 3RBXA 2C2EA 1E6YB 2QLFB 1HQEA 3D9BA 3IBWA 5HMYA 1ZM4A 4EZ9A 2ZH4A 2VPXB 2VJVA 2ZD1A 4Q43A 2BM0A 3R1LA 2G0CA 2O5DA 2JLFA 1YJUA 4DR3F 3T5LA 2DNMA 2OGUA 4P6QA 3BGOP 2LQ5A 5D0RA 2VBYA 1VIOA 3MCSA 2DGUA 3LH2S 4UF4A 3NO7A 3M30B 2RU3A 3SXLA 3PKMA 1VI7A 4CTAB 2VOOA 4F2SA 2J7KA 5D0HA 1U0HA 4KGKA 2HWHA 1WKKA 1XNRJ 3DRSB 2C2DA 2OP5A 2ZWPA 1J5OA 3T3FA 1R0AB 3G71S 1SQFA 1IKVB 4X4NA 2A6MA 1FERA 3W66A 1UEKA 2QRRA 4UOFA 2CJBA 2BQ3A 2GMHA 2JL9A 5CCLA 5KT6A 2RT3A 2Z56B 4RUCA 1I3OB 3QQCD 2YX1A 1W26A 2CVEA 4JUZA 4ZLPA 7FD1A 2DB1A 1D9DA 4JI5J 3SFGA 5K8MA 1JLFB 1BAZA 3M8QA 2XULA 4YR3A 4RNFA 3KLFA 5DO2A 3IGNA 1V3ZA 3I96A 3W9JA 2MPUA 1C1CA 3AB4B 3TVKA 3A1YG 2CPIA 3H87C 2HWIA 3D66A 1APSA 3QGGA 3LWLA 1MYLA 4OZ1A 4IO1A 3CIMA 1WC1A 4ERDA 2EVZA 3BB5A 2JRSA 3M32A 3FRZA 3QYYA 1UL3A 1I94J 3R9LA 1TL3A 4NCGB 3S6EA 4DSIA 3T6BA 4H4OB 2JLGA 4J9VA 4QYRA 3RB0A 4DSFA 2VG6A 3M8PA 5D3GA 5C7PA 3OFFA 1TFYA 3KUEA 3C8YA 2I5JB 4XPEA 2VC1A 4DUZF 1DAXA 3CCTA 1B99A 1HARA 2F40A 2QLJB 3W2WB 3O8WA 1RWVB 4HLBA 1MN9A 4I0WA 4PWUA 3JTOA 2BJDA 1J27A 1JLEB 2V4JA 1WDDA 5A8KA 3I31A 3I5CA 2YQ3A 2U2FA 2XMUA 4ITSA 5LM7E 5KFZA 2W7OA 2OD6A 1BQNB 2CDRB 3CMAS 3OL8A 1SIWB 4GVBA 1WUUA 5EX3A 1NZ8A 3FK4A 1A0OB 1UFWA 1KN6A 5KFOA 5M2UA 4A8WA 3MR2A 4ZA1A 5I42A 3BEGB 1CG2A 4QR1A 3BH7B 2DH9A 1GMWD 3P3DA 1RTZA 3UR3C 2HLUA 1HNWJ 2K8GA 4ELVA 2V50A 5AT1B 1AFIA 4ECZA 3CT9A 2ZDPA 3OR2A 1REVA 3UD3P 4ME7E 4HEA9 1T03A 2DNHA 3EPGA 4V19X 4PUOA 4FF1A 3QGIA 3LAKA 3GYNA 3NCRA 2CZ9A 1KOOA 4ZN3A 1CJUB 4HACA 4NRUA 1J5EJ 3K17A 4NA3A 4P74A 3KDOA 3LGNA 1IWGA 1UMJA 4X4TA 1MMLA 3MI7X 4ILLA 1T8EA 2XLJA 2MYFA 4P52A 1NPRA 2KT2A 4YY3F 1S1VB 2H9ZA 2B8PA 3GIIA 2VJUA 3JAMY 1Q4RA 4K59A 1YQHA 1S4FA 1Z1ZA 3I9V9 2XM3A 3NS5A 5CD4A 5U47A 4JI6F 3V6DB 1Y7PA 2ZDOA 4DV4F 3PYGA 2YQ1A 3M2UB 4FYWB 4DZDA 2V9KA 4KHRA 5HMZA 1G6BA 4HDHA 2DNZA 3T1HJ 3PX6A 2WONA 3N6MA 3FSXA 2BZ2A 2E9TA 5GADU 3HHNB 1GMWA 2KRBA 4GO5X 1RT5B 4RU2A 3EPIA 4QWAA 3GIJA 2MB0B 1NDKA 1ZYQA 5E2QA 4NYPA 2O01C 3W1YC 2UXBJ 2ZE2A 4J9NA 3HJVA 2RRNA 1Q8BA 2CQGA 3A12A 3U02A 4KPCA 3LF0A 2J76E 3KK3A 4YR0A 1ICEB 1KONA 1WF2A 4F4ZA 4YP3A 4RNHA 4DG1A 1WACA 2XC9A 4KE5A 1G7CB 3AD8C 2R2TA 3GU0A 2LEPA 1RTJB 5L9NA 4B3SF 2QZ8A 2MQLA 2JX2A 5K14B 3I0RA 1MWQA 3KLIB 2JOQA 2AP6A 3WC0A 1B64A 3DOLA 4JI0F 4C8MA 3DC2A 3S7RA 3T9ZA 5FLXU 2ILYA 2UZAA 1EKRA 4U67Q 4OLPA 5E3AA 2FY8A 1FWKA 3FEYB 4DFJA 2DR9A 1S6QB 2Q1LA 5KFUA 1FKOB 4RKUC 1RHRB 1SKSA 3TEGA 2AEJA 2ZVSA 1RU1A 2GQ2A 2ZZTA 1BGXT 1HPZB 3UDVA 2F7VA 5DDPC 1S0VA 3D6TB 2BSQE 3L3CA 2C2RA 1R8HA 2W7AA 1L3VA 5AE2A 3DRRA 4ZVEA 3G86A 2YKQA 2E9ZA 1VGYA 3VAMA 2CAJA 4LF6J 2DR8A 4WTYA 2B4PA 3D6HB 5F8HA 2V67A 2H4WB 1WHYA 1VQYA 1KHVA 1Y00A 3PKYA 1U2FA 2HRUA 4HI1A 2UXDF 5KFIA 1O51A 1IQTA 3R8YA 4B9MA 1QAIA 2AEMA 4RW4B 3A13A 2E5JA 3ISND 2IVYA 3OSNA 3KLVA 1T9UA 4NYOA 2E5HA 1HMVA 4DPYA 4OL8A 3FDSA 3GR0A 3DDIA 4I69A 4DR6J 4ECSA 3M7VA 1FHTA 2OTJS 4YDXA 1S7HA 1F5BA 4XPCA 1FJ7A 4CM0A 3A8JA 3CCWA 1Z4UA 4KGMA 1WC3A 4O3OA 1AFJA 3JSRA 1BY9A 2JLEA 3EJMA 1NJZA 1NBEB 2M3DA 2OLWA 4CTAA 2XMTA 2FJEB 1CJVB 3PRDA 1OIAA 4LVOP 1VQ5S 4TVAB 2HG4A 3R6GB 3CDWA 4OLOA 4C0OC 4DV0F 1F5AA 4NEYA 3UO0A 4ZITA 3CCQS 1XR7A 5FDLB 4C0HA 1JNRB 3JQMA 2ILZA 4YB5A 1RP5A 4DFPA 2E44A 2QYCA 4A8SA 4P2SA 5ETLA 1BE4A 4FVCA 4EBDA 4NLOA 4ZHRB 2E7VA 4ZN1A 2APOA 4AE5A 4KRWA 2R8GA 1R8BA 1RUSA 5IT0A 1ZPWX 3MGJA 2HFUA 2M88A 4Y28C 2L9DA 3BGUA 4LREA 2FHKA 3UPFA 1U8SA 2N7CA 3P5TL 1WG1A 2YKMA 3HXMA 3LP0B 2LQ8A 4ED6A 1FD2A 4IG3B 1SJ3P 3VVUA 2HHXA 5B0GA 1WKLA 1T05A 4DCJB 4ZP7A 2R9LA 3MM6A 1A7GE 1RWPB 1S9GB 5IC6B 3MTKA 2GGPB 2GVDA 4QZVB 1SV5A 1N5VA 2UU9J 4USJC 2UUBF 3NNEA 3I0SB 3PXGa 3BZQA 2KVIA 3KMSA 4DV2F 5ETNA 2CJQA 2EFPA 4J37A 3JSYA 4J5OA 4EYHB 5GAEI 2KXHA 2HQDA 3NBPA 2JXIA 4Z2XA 5IQQA 4KQZA 4BWJA 3F0NA 1OQ3A 3BR9A 3CCSS 2WSCC 4F67A 4DV1F 3DLGA 1G3OA 3UDEA 3GG0A 1U02A 1RA6A 2ZM6F 5J2QA 5ETQA 2GHPA 4WKRA 1NRKA 4OYZA 4DS4A 3UCZP 2UVRA 5E0OA 2QIFA 2MDAA 2EG1A 3X3UA 4OZNA 3BDEA 2CPDA 1H3DA 4IFVB 1NB2A 2DY9A 1OG7A 2F9DA 3D1OA 1WDTA 4ZPAA 3UFCX 1JLEA 1NZAA 1XMBA 3WQPA 2BR0A 3UE2A 4NZ0A 3CCLS 1PJ5A 1ACMB 1ZTTA 2PMWA 1HNVA 3MXHP 2H1OE 1SIWA 2UUWA 1UZHA 4JI6J 1JJCB 4LFBF 3VAFA 2FY1A 2YNHB 1F60B 3EXCX 2GX8A 3BN7A 3QT8A 2KJWA 4QIWD 3KXDA 1LWFA 5E7OB 2X1BA 1XQIA 3BKFA 4LQ9A 1R0BG 1NKEA 1FFSB 2CQPA 3BF4A 1FXDA 1IR1A 4F4YA 5HMWA 2IAJA 4LSNB 2CQHA 3NGRA 6FDRA 4EU0A 2NXJA 5DQHA 4XAKA 3DM2B 1HR0J 1NEEA 1GX6A 4GKKF 2F4VJ 1L5UA 1RHKB 3VEAA 2UVVA 1EA4A 4LRVA 1VQKS 1JLCB 4FYYB 1LEOA 1TAUA 2F65A 1VHFA 5KAKA 1KOHA 2M4MA 1E6VB 1RHQB 4Y6IA 3DU6A 1U7LA 3OLAA 3PRVA 4CH7A 4EFAC 2CQ1A 2OEJA 4YHHF 3MAAB 2D7SA 1YSJA 1QAYA 2DO0A 2RQKA 2CQ4A 3POTA 1OO0B 2J7WA 4AAIA 1RAHB 1NO8A 3TUJC 1VFJA 2RS8A 4UTGA 3ZZRA 1RAAB 1C0UB 2W7PA 1S1VA 3MAQA 2DGXA 3PRBA 2BJ3A 2VA2A 2I6WA 2X3DA 5A0YB 3MWBA 4TQSA 4B3MJ 4P7VA 2VQEJ 1NJYA 1V6HA 2XYPB 2K7KA 1ZAVA 3GR1A 3BSAA 4A46A 2I0XA 2MY8A 5B0AA 4ZJQA 1D8YA 2LDIA 2Z57B 4XDCA 3G4SS 2OAUA 1U45A 4DX7A 1T94A 1N34F 3C2PA 2BKPA 4DL4A 2IIHA 5A8WB 1EARA 4KSEB 3K8WA 3J7ZT 2I38A 4ID8A 4RR5A 1FDDA 2R7OA 4LF9F 1CJTA 4DX5A 2LEBA 2HAIA 4R25A 2YWKA 2FVQA 3OUYB 2B5JA 4CNYA 4J9UE 4KV8B 1BUXA 1QTGA 4ER8A 4URQU 2UVWA 5L1KA 2O66A 1AROP 4DV6F 4D3HA 2R42A 3NWRA 4ECQA 3MUMP 4HHUA 5DM6Q 5DJBA 3ZZUA 4DQRA 2HBRB 3DGPB 1HBMA 2W4CA 4DLGA 2GFFA 2AIRB 2FZCB 4ANDA 3B8HA 2HQ3A 3OW2R 1TKZB 2CZVC 3KMQA 4FNHA 4G1QA 5K14A 2HVIA 2Q3PA 3UDLA 1U6BA 2ZH5A 2GCFA 2O3DA 3W5YA 3SDEA 4L72B 5HBMA 2P5VA 1SL2A 1QDUB 4RX6A 3W8PA 3EVWA 3OTOF 4O44A 4F4XA 2CAXA 1EP4B 2KELA 1MNEA 1G1XA 4ECRA 3KG0A 1NSPA 4ECTA 3DHXA 5HVHA 1UTAA 4X66F 4YB7A 1PC5A 3MM9A 3B82A 3EWGA 3UDCA 2YBVA 3C14A 2GPEA 5RUBA 2KDOA 3PDNA 3J7Z5 1N33F 4QR0A 1TKTA 4LFAJ 4QYZJ 1VQNS 1PG5B 1U48A 1Q78A 4MMOA 3MM5A 3KNGA 4PZVA 3BO3A 4JI8F 1ZM9A 3ZZPA 2WOMA 2DPJA 4DR5F 2D3O1 3EVOA 5DZ7A 1EKSA 3HVTB 4RW4A 1TK5A 4Q5VA 3OJUA 2V4RA 5DM7Q 3UCUP 1MNTA 4L3KA 1BWVA 4N8OA 5DS7A 4PG7A 1RA7A 3LP2B 6FD1A 4K4XA 4USUA 4M5DB 3LGMA 1ELOA 5IT4A 3V81B 2E5IA 2CPXA 4CLLA 4IQXA 3CC7S 2HBZB 5KFBA 4UQGA 5J2MB 1NK0A 4X4QA 3QFHA 3VR1A 5F3TA 2MY7A 2OUGA 3AT1B 3V5RA 1RT6B 4U6PA 4A8OA 1MW7A 1R8CA 2KG0A 4LFCJ 3TJ9A 5DDOC 2YNFB 1CULB 3SQOP 4OHXA 5GAEU 4MKVA 1VRTB 2DHHA 3VAKA 3BPDA 2FLPA 3HO1A 1RHJB 3NNHA 2JBVA 2KKHA 2P6SA 2BE2A 1B4SA 3PZPA 2AKWB 3BBFA 3T5HA 1BQMB 3R5GA 2BUNA 4NLQA 4K0KJ 3UN5A 3J81U 3AODA 3WDOA 1VQ7S 3M2VB 4E98A 2AGQA 1CVJA 1UJ4A 4TKTA 3T19A 5LOQA 3AJDA 5CYMB 4JV5J 1P27B 5H9FK 3RRHA 4ZHRA 1HWLA 3MM7B 3DLJA 3AJ2A 2UUCF 2QG9B 1Q8LA 4ZMMA 1ARRA 4MK9A 4Y00A 4LF5J 1SJ1A 4FNIA 4LIRA 3OXGA 1RHMB 3GWCA 3DLBA 1ZBTA 2GHWA 4JI4F 3MMAA 5AJ3J 3CXCR 2OPPB 3P49B 4FKYA 3TAQA 2BJ1A 1VLYA 4S0MA 2LYVA 3D2WA 3AJ1A 4CLSA 3DOKA 2MGZB 1RHUB 1IWAA 3E01B 4MK7A 3H90A 5ETOA 5H1SV 1UVMA 4LFBJ 1SJ4P 3ZZZA 4OYMA 2JFDA 3ZNUA 3CCVS 2XNRA 3QJLA 3GJTB 4DR7J 3Q0AA 1ZA2B 2IPOB 4Y2KA 1FNOA 4ANEA 4C3KA 1FRKA 1Q53A 4O4RA 2ZOFA 2IM2A 2VFTA 3NS6A 1AW0A 3HI9A 3RR7A 5G0RB 4LR8A 3QMQA 4MK8A 3IM8A 2CDQA 2MJNA 1KWMA 1KHWA 1X9WA 2HIYA 3CJSA 3RAMA 1JLAA 1DHMA 4PXDA 3FFIB 2RKIB 4J90A 2N4DA 3JYTB 1PO6A 4JI1J 1H98A 3ZZTA 3LP1A 5F8GA 2HLTA 3V2UC 4IFVA 4P75A 3HHLB 1FWPA 1S1WB 4HTIA 5IWAF 3CGIA 4ZVFA 1N5YA 3TQ1A 2GO8A 2HRYA 3V4IB 4CLFA 3QOQA 3UD5A 2ZNZA 5IQ6A 3MPUB 5KFLA 3G6XA 3HK2A 2HPUA 4KT0C 4NZ7A 3R5DA 4DSEA 3DOMA 2XLKA 4F8RA 2WZ1A 1N5QA 1MROA 5HLFA 3G9CA 2QA4G 4BLGA 1VQSA 2V2QA 4F4WA 4MAKA 5JVGQ 4UW2A 4QQBA 2UUTA 4C11B 1UZDA 2DGWA 2RS2A 3M9MB 3QBCA 2LQBA 4ID5B 2XCAA 4LSNA 1XNQJ 2VQFF 1RT7B 1AT1B 3L09A 3EGNA 3CEDA 4LF9J 2BRLA 3IRWP 1Q1KA 2QMUB 2BJ9A 1RXOB 3E8OA 4LQ3A 2ZH8A 2HW3A 3HDSA 1T9WA 1E6VA 2FIUA 2DKOB 3FQKA 2DITA 2F3JA 3KLGA 1CJKB 4RZRA 2WHOA 3K5NA 1T9TA 4IFYA 3FC9A 4ECUA 3BYPA 4OZ3A 1NH8A 4JI2J 2K29A 2B9XA 3OVSA 2MQQA 1UA0A 3KK1B 4NX9A 4Y2AA 1XMQF 4QCLA 4OI4A 3QJPA 1ZOTA 2RRBA 1OPZA 4H4MA 2CUYA 4X66J 3CSKA 3HZGA 4UUWA 5CYJA 1S72S 2A18A 5L9XA 1SB6A 2JC1A 2HHWA 2MZ1A 2DNPA 1ZTWA 2IDLA 1R7IA 3ZFVA 2EFNA 2HQFA 5A8WA 3J80U 4J9RA 4YB6A 3CD5A 3PCOB 4DV3J 1S97A 1WJ9A 3KNAA 4B3TF 3M6UA 1YK9A 1BLUA 5BXIA 1TU0B 1S77D 2X7IA 1H73A 1KLMA 4FF2A 1M5OC 4DQPA 5A8RA 5CD4H 5IT9Y 2DGVA 1U1QA 1W7WA 1LV5A 4ELUA 2C42A 2PA3A 1JWWA 1M5VC 2NUUG 3PW4A 4WJBA 1CQMA 2Z58B 1P94A 1FXLA 2OPRA 4JI7F 2DYAA 1L3SA 3BS9A 5ETMA 2DNNA 1FFGB 1RAEB 4HYKA 1FK9A 2V6AA 3OXLA 3LOUA 4NRTA 4AQYJ 1EAYC 2EKYA 5JXSA 1U26A 2MKYA 2VOPA 3CC2S 2HFZA 3MEDB 5DDRC 1Q8KA 2A2CA 1TUGB 2DGSA 4NI2A 3ZTPA 1UPMB 3LA0A 3BSOA 2KU7A 4RPFA 3TR5A 2HEKA 4WIQA 1EP4A 2HZAA 2G4BA 5LMUJ 2UV8A 4IRCA 1VBKA 5K8OA 2C2OB 2WVEA 3OL7A 2M52A 2IRUA 5KOXA 1HNXF 2ADCA 2OD4A 5J2PB 4C3MA 1KFSA 1VQOS 3TAMA 1JKHA 3FVYA 1IN0A 1ZAWA 1RYRA 4LSZB 5D0EA 1FT8A 2ZUGA 3HHDA 3K59A 4DPOA 4R0JA 2E29A 4ZVOB 3PIOQ 2FHMA 2YNIA 3ZTRA 4QU7A 3D1HA 2UUCJ 4IRKA 2OMLA 3CD6S 1TL5A 1HHQA 1QE1A 2EFGA 2P9GA 2WSFC 4WYLA 3VAJA 1PC4A 2CNLB 2XI2A 2FC8A 2GIFA 2XYHB 5LJ3Y 2WTFA 4DPXA 1IM6A 1IM4A 3IO1A 2FZKB 3V81A 1FF2A 2VG7B 3MEEB 4I7FB 3IM9A 2F1FA 4ECWA 3MOJB 2B6AA 4U9RA 4E8UA 4O4GB 3KLHA 2ZOGA 4O23A 4C0BA 3WIUA 2KT3A 3CJRA 2P9CA 2YNFA 4FVMA 1TTHB 2KXFA 1Y9OA 2HNZB 5HQLA 2N4CA 4EK2A 2DISA 4LBHA 4NPOA 5KFFA 3IWLA 1QVGR 3FMTA 1UCNA 2GAHC 2GJFA 5HSPA 4X64F 1DFDA 2AHOB 1DTQB 3FJ2A 1OYDA 1RACB 4P9SA 3AOCA 2HSEB 4DHVA 2LVWA 2AJ1A 3A4TA 1VDHA 4NCBA 3DN9A 1PKUA 3PM9A 1NDPA 2M0GB 2VA3A 3HHLD 1GXTA 2XWXA 1JMTA 4LRDA 3ZZYA 3L95X 2BANA 2OPPA 1HIYA 4PYAA 3IS9B 3QZ7A 3PV8A 1FKPB 3U27A 2HFVA 4IR1A 2HBQB 2EBEA 1Q16B 3G82B 4RW7A 4QWDA 1RTDA 3UQSA 4DWIA 1KLNA 4OI0A 4U95A 1YRUA 5EWFA 3V4MA 5HP1A 1VRUA 3SIPB 2B56A 3H4DA 3TARA 3R7BB 2DNYA 3UVJB 4B02A 3H20A 4YUDA 3D3BJ 3C15B 4RNNA 4KFBA 1WC0A 3P6YC 2ZJRQ 1YJVA 2DD8S 5C24B 3N6LA 4K50A 5D4PA 3O44A 1W2BR 2RRAA 1XR5A 3RBZA 4NLXA 4QWEA 4FXDA 5G0RA 4UQTA 4A8XA 4NL5A 4OYWA 1MG7A 4NA2A 3QO9A 1DQAA 4OHYA 1JLBB 1XMOF 1LWEA 4FF4A 1WF1A 4AT1B 3BGRA 2CJXB 5F9LA 2DNGA 4W4MA 2VODA 3D6MB 4F04B 1M5PC 2RJZA 4BBYA 5J2NA 3ISNC 2W24A 4C9DA 2OJ3A 2ROEA 1ZM2A 2PSZA 4GKJJ 5CXTA 2Z8QA 3HHLA 4F0KA 1SC6A 4LF4J 4C8OA 1RCOB 2W2NP 3CPWR 3V4IA 4CM2A 2XWYA 1XERA 2KZZA 4MIWA 4CH1A 3F73A 1KP6A 4ECYA 5T7LA 2HMIB 3HX9A 2PMZD 3ETMA 5DZ6A 2E9RX 4DV5F 2W9BB 2E7WA 1IBCB 3HLUA 3MEGA 2FJXA 1YRTA 2LECA 2XSJA 4OMFG 2R7SA 2UP1A 2YWWA 5B0BA 1LW2B 4JOUA 3D3CJ 4K4ZA 4NXMJ 2BX6A 3H25A 2H3EB 1BD6A 3TZYA 3BO4A 2XMWA 1HLWA 2YKAA 1F3FA 3RGIA 3HVRA 1OSDA 2GQQA 4CLYA 1RWWB 1U9PA 3I87A 4WCEQ 5KFWA 3N0VA 2UXCJ 3KG1A 2POKA 4JP8A 3SCLE 3PJXA 4OHWA 4O0IA 1UKUA 3LANA 1NDLA 2SXLA 1QSYA 1VIXA 2MQOA 4B9VA 4IOAQ 2Y3YA 2XEXA 2VIHA 1CC7A 1MN7A 1I51B 2J0WA 4ZIVA 1P8GA 2Z2ZA 1K73T 4K8RA 4RBVA 2HS4A 3QT7A 4WTOB 2XHWA 3GPAA 3NGKA 1HKAA 1XEZA 5IM0A 1JXLA 3R2DJ 3B6BA 1HNXJ 1M5HA 2DNRA 1JLQA 4ETXA 2YNGB 2HQGA 4WFZA 2PFDA 3NKYA 3CNQP 3DYAB 1U8WA 1HYSB 4Q8EA 2DBBA 1WKJA 3KJFB 5ETSA 3FQLA 4Y0FA 2DRBA 1ZM3A 5CYQA 4JBCA 2C28A 1VYAA 5C42A 1N32J 3MPDA 1IXKA 1HQEB 2BA3A 2GV1A 1S6PA 4NLSA 3GFZA 3PNIA 4J9MA 2ZD1B 3CJTA 2DK2A 2LQJA 3CCMS 2J9DE 2R8HA 4YOEA 1BXNA 3OTCA 2NR0A 1KQKA 5C2CA 2V63A 2C2NA 3ULHA 3D0GE 4K5RA 4CP5A 4I64A 1RT4A 2EFOA 1U0HB 1XN9A 4LSLA 1BDTA 4ED8A 9ATCB 2B7BB 2QV6A 2AJ0A 1VRQC 2B7CB 1LQ9A 4HH1A 5AXMA 3CD0A 1Y0HA 2ZOMA 3CDBA 3UD4P 2IC3A 1ZH5A 4HHJA 4C8YA 2VFRA 3W9IA 1H2TZ 2IVMA 2YWHA 2KM8C 2DRAA 4MKBA 1HHTP 4UY8T 2VH7A 4PAAA 1IBMF 3D4JA 1N52B 2DY1A 3BQ2A 5KFVA 3HT3A 3M8QB 2BA9A 4H54A 2C1EB 4CWBA 4ZS6A 3KLFB 2H48B 1C1CB 4KPYA 1F9FA 2FVCA 4AD6A 1ZZNA 2R8KA 2RF2A 5EDWA 4DSKA 1RBLA 1WHWA 3R6LB 1RWKB 4OJHA 3VEBA 2BKNA 4ZPBA 2BV3A 1Z2ZA 1I6JA 3GG1A 2ACYA 1TL7A 3M32B 5BYQA 1T11A 2PGCA 3PFOA 2XY7A 4U8VA 1YIJS 2HS0A 2OSRA 4DL2A 1TL3B 2OPSA 2KYZA 3IA0A 4QR2A 4OIXA 5AXKA 4M8LA 2EG2A 2OEMA 4W92B 3PW5A 4DV7J 2VF3A 1FE4A 4LRBA 3H5UA 2OH2A 1FJCA 1YITS 2MZRA 1CPZA 1M5KC 2FJBB 3D67A 2VG6B 3M8PB 5D3GB 2ZBPA 4DPTA
chains in the Genus database with same CATH topology
2K9IA 3BKUA 1BAZA 4HV0A 4FXEA 4ME7E 2BSQE 1U9PA 2H1OE 2F1FA 2BJ8A 2K5JA 2BA3A 2CA9A 2BNWA 3PHTA 2BJ3A 2CAJA 2HZAA 1BDVA 1ARRA 3H87C 1MNTA 2BJ9A 2WVEA 1Q5YA 3QSIA 2HZVA 3BKFA 3VW4A 2CPGA 1MYLA 2WVDA 2K1OA 2Y3YA 3VEBA 2BJ1A 1MYKA 2BNZA 3OD2A 2JXIA 2JXHA 1IRQA 3FMTA 2NZCA 2AY0A 2CAXA 2KELA 1NLAA 1BDTA 3BKTA 3VEAA 2WVCA 1EA4A 2BJ7A 3GXQA 3QOQA 2RBFA 2GPEA 1P94A 1PARA 1B28A 1X93A 2WVBA 2PC6A 2K29A 3LGHA 1B01A 2JXGA 1QTGA 1Q5VA 4D8JA 2CADA 1ARQA 2K6LA 2FGCA 3FT7A 2WVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9I A;  3BKU A;  1BAZ A;  4HV0 A;  4FXE A;  4ME7 E;  2BSQ E;  1U9P A;  2H1O E;  2F1F A;  2BJ8 A;  2K5J A;  2BA3 A;  2CA9 A;  2BNW A;  3PHT A;  2BJ3 A;  2CAJ A;  2HZA A;  1BDV A;  1ARR A;  3H87 C;  1MNT A;  2BJ9 A;  2WVE A;  1Q5Y A;  3QSI A;  2HZV A;  3BKF A;  3VW4 A;  2CPG A;  1MYL A;  2WVD A;  2K1O A;  2Y3Y A;  3VEB A;  2BJ1 A;  1MYK A;  2BNZ A;  3OD2 A;  2JXI A;  2JXH A;  1IRQ A;  3FMT A;  2NZC A;  2AY0 A;  2CAX A;  2KEL A;  1NLA A;  1BDT A;  3BKT A;  3VEA A;  2WVC A;  1EA4 A;  2BJ7 A;  3GXQ A;  3QOQ A;  2RBF A;  2GPE A;  1P94 A;  1PAR A;  1B28 A;  1X93 A;  2WVB A;  2PC6 A;  2K29 A;  3LGH A;  1B01 A;  2JXG A;  1QTG A;  1Q5V A;  4D8J A;  2CAD A;  1ARQ A;  2K6L A;  2FGC A;  3FT7 A;  2WVF A; 
#chains in the Genus database with same CATH topology
 5KT5 A;  1K1Q A;  1UW4 A;  1RWU A;  3H2L A;  4TY8 A;  3QRP A;  2UUA J;  4RBT A;  4FPI A;  3NCP A;  1U1M A;  2FHJ D;  2FDN A;  3PHT A;  1VQ4 S;  1JXV A;  3CMQ A;  1DAR A;  4I2Q A;  1A6L A;  4ED3 A;  2V4J B;  4Q2L A;  1JLG A;  2W25 A;  3TJA A;  2ALY B;  5A8K B;  5F0U A;  4PQU A;  2D3U A;  4K4S A;  2R4F A;  4ED5 A;  2YWG A;  4FXW A;  3BBC A;  1S1U A;  1RWO B;  3K5P A;  4GVB B;  4PG4 A;  1RAB B;  2M8H A;  3MFI A;  2HGN A;  1HBU A;  1U24 A;  4F2R A;  1D1U A;  2DEJ A;  1AZS A;  2G1H A;  3NGT A;  4MYU A;  5I42 B;  4KGX B;  2E1M C;  1NHU A;  1S79 A;  2KB2 A;  3KFW X;  2ZBQ A;  4ZCL A;  2YPY A;  5CH7 B;  1PJ6 A;  3OFH A;  3ADA C;  3OR2 B;  5LL6 d;  1NUE A;  5MAO A;  1REV B;  3GYX B;  3FCV A;  3ILL A;  1T03 B;  1NU4 A;  4PUO B;  3CJ8 A;  2Y0S D;  1IVZ A;  4ZVH A;  3DRX A;  2MLZ A;  1I5O B;  1JJ4 A;  1Y3K A;  2FHJ A;  3M8Y A;  4HAC B;  1KVJ A;  1ITP A;  5HK4 A;  1ZZF A;  2QL5 B;  3ZTQ A;  2HHV A;  1HQU B;  4N47 A;  4CO5 A;  2WB1 D;  1XK8 A;  3CIZ A;  5DRK A;  2QMX A;  5F9N A;  1FDA A;  4LBP A;  2ZH9 A;  4V19 J;  2N3L A;  3GV8 B;  2HFN A;  1RB0 A;  2EWH A;  4R0E A;  3OL6 A;  1B01 A;  1N0U A;  2UVU A;  2MKH A;  1AXQ A;  2H5J B;  3W62 A;  2RQ4 A;  4Y2I A;  3BM7 A;  3OLB A;  3PX4 A;  1P1L A;  4NLV A;  5J1E B;  1N36 F;  2X1F A;  4B9U A;  4IRD A;  3T5K A;  5AXN A;  2WON B;  3H40 A;  1SC1 B;  4ECV A;  1IKY A;  2DTJ A;  2ZHB A;  4I4B A;  2R2S A;  2PMH A;  3CVK A;  2QEX S;  5IC4 B;  2Y8Y A;  4RUB A;  1TAQ A;  4YFU A;  1VR6 A;  3HD1 A;  4GC6 A;  2ZE2 B;  3DMJ A;  1NME B;  1YJ9 S;  1RTH A;  1AYE A;  4ATN A;  1M90 T;  3KK3 B;  4ZPT R;  3IN5 A;  2IDE A;  5BR8 J;  4IG0 A;  2YX4 A;  3RU0 A;  3ENQ A;  4C98 A;  3FMW A;  3D54 A;  1VK8 A;  4PYD A;  1Q79 A;  3BKT A;  4PXC A;  1R8A A;  3I0R B;  1DBD A;  3IRX A;  4NLP A;  3PX0 A;  4H4K C;  2P2C B;  1TKX A;  3P96 A;  3I55 S;  1YJW S;  3M9O B;  4WBF A;  5KFD A;  2H54 B;  1RT2 A;  4USW A;  4JI3 F;  4QPT A;  3TAP A;  3QGH A;  1VQM S;  2B51 A;  3KHG A;  4UT4 A;  1P9Y A;  2KOE A;  2AGO A;  4UZC A;  1UW9 A;  3A8I A;  3G8S A;  1S1X B;  4BHQ A;  4N41 A;  4RUA A;  1PBU A;  4ZP9 A;  3DXS X;  4AUK A;  4D3G A;  3DRR B;  4NLY A;  4UOH A;  1BDV A;  3FNN A;  1FRI A;  3B54 A;  4HVZ A;  3C16 A;  2F63 A;  3WX4 A;  4DR1 F;  3A8K A;  3T1Y F;  4K4Y A;  1IR2 A;  4CLK A;  1FVS A;  4X4S A;  1IBL F;  1XJW B;  1X4B A;  1FKA F;  1D09 B;  2Y1J A;  3T6J A;  5C25 A;  2YKP A;  3PVX A;  3BV8 A;  2RIJ A;  4DF8 A;  2J0X A;  1REG X;  1SKW A;  1Z2L A;  2V2V A;  2C2M B;  1HMV B;  3FRY A;  1KEK A;  4DR4 F;  4ZVQ B;  5KT3 A;  2DR7 A;  5KG5 A;  2JXG A;  2XSF A;  4OZJ A;  1EJ7 L;  2XCP A;  2ZH1 A;  4QU6 A;  2RQM A;  1TK8 A;  4MTP A;  4XIU A;  3Q8S B;  2LXF A;  1O0P A;  4X2B A;  2XS7 A;  2MLY A;  1ZPV A;  1HWI A;  5L1I A;  3ET6 B;  2DRD A;  2GVZ A;  1VBY A;  1F5C A;  3HFK A;  4RNO A;  4R8U A;  4EEY A;  4HT5 A;  1QUP A;  5M2R A;  4I2P A;  2CRL A;  1ROF A;  1OY9 A;  1UAW A;  2H5I B;  4Q7A A;  4DX6 A;  5A2Q U;  4N56 A;  3HZE A;  1HW8 A;  1SH0 A;  3NS7 B;  2G2O A;  1C0T B;  1XTZ A;  1RSC A;  3GFY A;  1VC6 A;  4B3R F;  2VAS A;  4LF7 J;  2CJ9 A;  3MCO A;  4GRS A;  4EWT A;  1OY8 A;  2DNO A;  2CPJ A;  1MSW D;  4OYX A;  2GS8 A;  1OYE A;  2K06 A;  1R6Y A;  1IJF B;  2L3M A;  5IV4 A;  2FYX A;  1LFP A;  2MHE A;  5GMD A;  3CCE S;  2H65 B;  4NZ6 A;  1MWZ A;  2YKM B;  3DLE A;  3MHY A;  4TXS A;  1NK5 A;  2M5Y A;  1NAQ A;  4LF1 A;  4ALZ A;  2B0G A;  1PAU B;  1S0M A;  2GQC A;  1T05 B;  1SCJ B;  2RAQ A;  3K5L A;  3EM1 A;  3MM6 B;  3MMJ A;  1FJG J;  4OJ3 A;  2FGO A;  4BC9 A;  3K57 A;  1Q7Y T;  4OV6 A;  4FZV A;  4B08 A;  1Q95 G;  2GVD B;  3F44 A;  2YKN A;  1SV5 B;  2M8D B;  3H98 A;  4EO8 A;  2CZ4 A;  4RNM A;  5ETT A;  4DJB A;  1T3O A;  4NLR A;  2XYG B;  4TU8 A;  4KHP J;  1X4A A;  2LU2 A;  4ENO A;  3TZX A;  4JV2 A;  5EGY A;  3GE9 A;  1UJ5 A;  3QSI A;  1J2V A;  2FLN A;  3NAH A;  2WRM A;  3KJQ B;  2QGF B;  1PCA A;  1HNI B;  4L73 A;  2RVJ A;  4TLR A;  4RWW A;  1IKW A;  4B9T A;  3NBP B;  1NKB A;  3IG1 A;  4C6A A;  2ZFH A;  2HQI A;  4FYD A;  4DSL A;  4NWB A;  2VPZ B;  3KTQ A;  3DLG B;  2NYI A;  2QSF A;  5J2Q B;  4DUY J;  5KFT A;  2OMO A;  2HZC A;  2ZJP Q;  2VU5 A;  2K6L A;  5L8R C;  3M6V A;  3R27 A;  1LKZ A;  2KKE A;  1S1T A;  4WU3 A;  4GMK A;  2OPQ A;  2ZH2 A;  1O8B A;  4HR2 A;  1KR4 A;  2FZG B;  1TV6 B;  5KT4 A;  1HNV B;  3OBI A;  2V34 A;  2RQC A;  4QIF A;  2GJ2 A;  1L3T A;  4ETZ A;  2W2O P;  2R8J A;  2QMW A;  4LR7 A;  5KFN A;  1LWF B;  3IAS 9;  3PJ9 A;  1U2R A;  3AB2 B;  3NGU A;  2DHX A;  2RHS B;  3D0I E;  2EK1 A;  3JTN A;  2RUS A;  3ICL A;  2IMW P;  5E3C A;  3RJM B;  3CO0 P;  2M70 A;  2U1A A;  5KFS A;  2IAJ B;  4OI1 A;  4LF8 F;  4RWX A;  4CH0 S;  4UOC A;  4K5S A;  1LXJ A;  4UST A;  2BJ7 A;  3J7Y I;  1N4L A;  3BSN A;  1GQE A;  4F50 A;  2HHH F;  3CJ5 A;  4ILR A;  2XY6 A;  4XTT A;  4BCA A;  4RW8 B;  4EUV A;  4WP3 A;  2FVS A;  3MPW A;  4IH6 A;  3G8T A;  2RDJ A;  4DR2 F;  1X5P A;  5H9E K;  1VIS A;  2LLZ A;  5GMK a;  2RNE A;  3KUG A;  3POT B;  4I56 A;  3FGV A;  4AXI A;  4C8K A;  1VS3 A;  1Y10 A;  3WIV A;  4WU2 A;  1UP1 A;  4X62 J;  3W61 A;  1HQU A;  2FTR A;  2IRY A;  2DXD A;  3GJS B;  5JUM A;  1Q5Y A;  3H2U B;  5BYR A;  3S01 A;  4OYA A;  2CWX A;  1WOP A;  1YTY A;  2XMA A;  3PG9 A;  4ZJL A;  3SCJ E;  1T02 A;  4O0N A;  3TX0 A;  3FBB A;  1X60 A;  3Q22 A;  5D15 A;  3N01 A;  1Y5N B;  5THW A;  6AT1 B;  4NXN J;  4ZLJ A;  1V3S A;  3SCI E;  3EMT A;  2DIV A;  5J1E A;  3DFE A;  3FSY A;  1WG5 A;  1HNZ F;  3PY8 A;  3OFE A;  5HQ8 A;  3RB6 A;  1SJF A;  2RDI A;  1V5V A;  1YKW A;  5E3Q A;  2N7Y A;  4WFB Q;  2KM8 B;  1EQ0 A;  4QWC A;  3TZW A;  2DEI A;  1FX4 A;  1CJT B;  1DQ9 A;  2PT0 A;  5LSO A;  2B5J B;  5D4N A;  4A8K A;  2HAF A;  2BXJ A;  4BS2 A;  1DTT A;  1VHI A;  2RUG A;  3VAH A;  2OFG X;  4OX7 A;  1OQ6 A;  3UWT A;  5CZX A;  3CD7 A;  3MCN A;  4NLW A;  1OWX A;  3OVA A;  1YZ7 A;  1HBM B;  4JYA J;  2FC9 A;  3O5T B;  1RBO B;  4DCO B;  4G1Q B;  3PFE A;  3SI8 A;  2KXN B;  3MEC A;  4M95 A;  4LRF A;  2HVH A;  3RYL A;  3SZ2 A;  5H9F J;  2HFS A;  5L1J A;  3SDE B;  4DR3 J;  5HBM B;  3ZO7 A;  3TWZ A;  3HHL C;  3FBE A;  2YWF A;  1QAX A;  1D9F A;  4NYZ A;  2VPY B;  3RB4 A;  3QT5 A;  2DO4 A;  2G0I A;  1YBA A;  3GON A;  4O44 B;  3SFU A;  2WVC A;  1RTI A;  3GQC A;  3NNC A;  1TMM A;  3MM9 B;  2BE7 D;  1S1X A;  3GFX A;  3D5M A;  3C14 B;  5HRO A;  2XMM A;  4ZCI A;  1SI9 A;  3CTR A;  1FO1 A;  5ETV A;  4USH A;  1ARQ A;  3JQJ A;  1TKT B;  1WTF A;  3LQV A;  3H5Y A;  3QAE A;  4PRF A;  3MM5 B;  3PAC A;  3SQG A;  3AOB A;  2E7X A;  3IXQ A;  1QLN A;  2KFN A;  4Y2M A;  3M2R A;  2WOM B;  2XGQ A;  3NG8 A;  4DXL A;  4YN3 B;  3MCM A;  1LK7 A;  1TL1 A;  4MYT A;  4FF3 A;  3R2C J;  3MR6 A;  4IH7 A;  1TEL A;  2B9W A;  3CJ4 A;  3NOC A;  4CIO A;  2KFY A;  4AL7 A;  4B9S A;  2XI3 A;  3TUZ C;  3I4H X;  3DI6 A;  3IBC B;  4C7Q A;  3LJP A;  1NK4 A;  3PEH A;  3UW1 A;  3BJY A;  2E5L F;  3VGV A;  2J8S A;  5D4O A;  1WOO A;  2AY0 A;  2MZT A;  5KFM A;  4JV0 A;  3NMA A;  3N6N A;  2LKZ A;  3C6T A;  1EET A;  1VK3 A;  3IWX A;  2JVO A;  1T3N A;  2VPW B;  1S12 A;  1TMJ A;  3ET6 A;  4KKO A;  3OVB A;  3QAU A;  1AUS L;  5J1N A;  2QJ3 A;  4MJK A;  4F0H A;  1SIZ A;  4G65 A;  1JIH A;  1N5S A;  2VG5 A;  2B4O A;  1X7V A;  2HNY A;  1X5T A;  1DZ5 A;  2BE2 B;  1RT3 A;  2BYC A;  1HI0 P;  3K8V A;  2IHR 1;  1SC3 B;  4N76 A;  4YEA A;  1C0T A;  4FS2 A;  4WFN Q;  2CYY A;  3MR3 A;  4F3M A;  5DG9 A;  3CJK A;  2F8M A;  4OFZ A;  2BM1 A;  2MST A;  3T41 A;  1VBZ A;  2IBK A;  4OYO A;  4DUZ J;  4DFK A;  1H6K X;  1XNR F;  2KH9 A;  3QLH A;  2AV5 A;  3O6Q A;  2V69 A;  2B4V A;  4FBT A;  5ETK A;  1MU2 A;  2ZKT A;  3NEK A;  1MYK A;  3MMA B;  3G6V A;  3TJ8 A;  4A48 A;  2F9J A;  3EGW B;  1LWC A;  3MUV P;  3V6J A;  3DOK B;  3AD7 C;  4WWS A;  2XS2 A;  3TOQ A;  1DLO B;  2BEF A;  3SEO A;  8ATC B;  3HVW A;  4JI5 F;  4LVN P;  2F5G A;  1QUV A;  2ZBI A;  4Q0B A;  3X1L B;  3QRQ A;  2EC2 A;  4F25 A;  1RE1 B;  3AH6 A;  3TO8 A;  3R1H A;  1X4G A;  4QWB A;  1NJX A;  3FSI A;  2VBW A;  3PW2 A;  3J7Y U;  2V8G A;  3MFH A;  3KLE A;  5G4D A;  1HNI A;  1KVI A;  2MZQ A;  3M8S A;  1IKX A;  4Y2C A;  3MD1 A;  3R5A A;  2GAG C;  2HHH J;  4QIG A;  1Q82 T;  2KI2 A;  3LPY A;  2Y0B B;  1I94 F;  2OKQ A;  4CRJ A;  2RDD A;  4DUT A;  5KFP A;  1JLA B;  4G3I A;  2XHC A;  3DGV A;  3C6U A;  3W2V B;  4Y34 A;  2JEI A;  2FUG 9;  3LP1 B;  2QTW A;  4CLW A;  3AXK A;  2AN7 A;  1RKJ A;  4A8F A;  1FRX A;  5KG1 A;  4ZLL A;  1PYT A;  4F02 A;  1YG0 A;  3RUB L;  5GAG I;  4YY3 J;  1N5Y B;  3ENA A;  3D0H E;  3FZ2 A;  1HBN A;  3B4D A;  1TV6 A;  3GSD A;  3K89 A;  1JQG A;  2IVF B;  3PJW A;  2EKN A;  1FNM A;  3DOM B;  4B9L A;  1FRL A;  2ZC4 A;  4G1I A;  1MRO B;  5KG0 A;  4DV4 J;  5HLF B;  1K0T A;  1K47 A;  2FB0 A;  1A9N B;  1RT1 B;  5CCM A;  4WK3 A;  4ZPW R;  1QTM A;  2LP4 A;  2A2B A;  1GTH A;  3AY0 A;  1WSV A;  2CPE A;  2A6O A;  3QT6 A;  5CQG A;  3IR6 B;  3KOA A;  2C3O A;  1K1S A;  5F0W A;  1WEZ A;  1PGZ A;  4N7T A;  4O3N A;  1PYO B;  4EBE A;  2ROG A;  3BRE A;  3OQ2 A;  3CJQ A;  3VW4 A;  3QRR A;  1YBU A;  1S9E B;  3IMQ J;  1UVN A;  2LQ9 A;  3LPE A;  3M4X A;  1WC6 A;  4RW8 A;  5F3Z A;  4KO0 B;  2JXH A;  1S9F A;  4DL3 A;  4P2F A;  3KLG B;  2AJF E;  2VB6 A;  4WK1 A;  3HF5 A;  3I5B A;  1HNW F;  5F8L A;  2RE1 A;  2RH3 A;  4QIE A;  2BOA A;  4PPD A;  5B09 A;  4IDK A;  3W7B A;  4IFY B;  4B3S J;  3CC4 S;  1RI7 A;  5FLX Y;  3RAX A;  1XWL A;  1B0T A;  2J5A A;  4OI6 A;  3FZB A;  3PR5 B;  4N8N A;  1EIY B;  2G0J A;  2NSB A;  2RSQ A;  3CCR S;  3BDP A;  4JI0 J;  1WG4 A;  3OSP A;  4G1P A;  4Y3C A;  1GTE A;  1KQS R;  2W8L A;  2KRR A;  8AT1 B;  3ISZ A;  1J5E F;  5FD1 A;  2PDA A;  2P6T A;  3MZI A;  2BJ8 A;  1BHN A;  4FN5 A;  4H4M B;  1RLC L;  4PWD A;  4UUX A;  2GMJ A;  2Q6B A;  2L9W A;  2MXY A;  3EVM A;  2NSC A;  2HWT A;  1JX4 A;  2MMY A;  3D6F B;  1R0C B;  2HS3 A;  5DQG A;  3GJR B;  2QFJ A;  2OTL S;  1T95 A;  1SPB P;  3CE8 A;  5EWE A;  1K8A T;  1SC4 B;  3H7H B;  2BDP A;  2HVE A;  3NY0 A;  4I68 A;  4Y65 A;  1KLM B;  2V2Z A;  3JAM U;  3AFG A;  3IR7 B;  1R43 A;  3VV2 B;  5A8R B;  3OL9 A;  3BR8 A;  2UXD J;  3V6K A;  1BC6 A;  2CIM A;  3VGU A;  1Y4Z B;  1NPK A;  3EXY A;  4WFY A;  1NK9 A;  4NEZ A;  2VFS A;  2CG8 A;  2OPR B;  4NE9 C;  1Y3J A;  4HL9 A;  3TUI C;  4RBU A;  3CO9 A;  4OHV A;  2CKW A;  1FK9 B;  1EHW A;  2W9C A;  4U96 A;  3RRK A;  5L1L A;  2VDH A;  1SH2 A;  4UOG A;  3MAH A;  4P72 A;  4FXE A;  3VAG A;  2W8K A;  4LRA A;  4FP9 A;  4V1A k;  2BW7 A;  4NI2 B;  1LOU A;  2DVI A;  2Z2M A;  4FDF A;  1OSC A;  2E1A A;  3Q8P B;  1O5J A;  1S49 A;  3BYR A;  2BW2 A;  4LIW A;  1KBR A;  2K3K A;  1UWA A;  2WW4 A;  4DV0 J;  4EYI B;  3TAM B;  1JKH B;  1QJH A;  2UV8 G;  1FXR A;  4CDI A;  1O6X A;  3CDU A;  1PIE A;  3RB3 A;  3HPO A;  1N8R T;  1GEH A;  2NS1 B;  3L4B C;  7FDR A;  2RB7 A;  3H4B A;  4EMD A;  3I32 A;  3CUL A;  2YPZ A;  3CDE A;  4DEZ A;  2YNI B;  2CJK A;  4J9O A;  2EFV A;  1JJH A;  5FJ4 A;  1X9M A;  3AXM A;  4DPW A;  1QE1 B;  4ZCM A;  2CVI A;  1R31 A;  3IR5 B;  2XLI A;  5MLC V;  4LF6 F;  1M0S A;  3BKU A;  5L38 A;  3PIP Q;  1FRJ A;  3HHE A;  4Q44 A;  3OR1 A;  1DUR A;  1VJW A;  4KTQ A;  2QX0 A;  3NCQ A;  3GV7 B;  2XQC A;  3HKZ D;  2B6A B;  3WC2 A;  2ASY A;  3KLH B;  3GIK A;  4URS A;  2MKK A;  3G87 A;  5HAN A;  2UUB J;  1GXU A;  5F8N A;  2ASJ A;  1H0H B;  3D28 A;  1NJI T;  4PAB A;  2CPY A;  1OMS A;  4WP8 A;  1GH8 A;  1NH7 A;  4KGZ B;  4DR6 F;  2ZEJ A;  4DV2 J;  4WXO A;  4L76 A;  4KBI A;  3N4W A;  3GYG A;  4USI A;  5F8M A;  2DGT A;  3GTY X;  2HK3 A;  2OEK A;  3CW2 C;  2VL1 A;  4M5H A;  3D1Q A;  4HI2 A;  3M1V A;  3TAN A;  3MDF A;  4F3Q A;  3SV3 A;  1N56 A;  4DV1 J;  2QLW A;  2K7J A;  2CAD A;  3BQ1 A;  1TFW A;  2GZO A;  3Q2S C;  4CT9 A;  3G96 A;  3U1M A;  4ZPV R;  1WNE A;  3JSM A;  2C2Z B;  4PWW A;  4Z7C A;  2ZM6 J;  3ZZO A;  4DL7 A;  1WI8 A;  4YDD B;  1HL6 A;  4M5N A;  2PA8 D;  1Q0N A;  5GAG U;  3BO2 A;  2R7W A;  4A47 A;  4F4A A;  3W64 A;  1KDN A;  2BAN B;  3PO5 A;  4J9S A;  2CA9 A;  2YWE A;  3CCJ S;  2FQQ B;  1RAO A;  4C2M A;  2QE5 A;  4RW7 B;  1RTD B;  4PCQ A;  2Z30 B;  1DLO A;  2OEL A;  1TP7 A;  2CNK B;  1RKI A;  1H7W A;  1SKU B;  3GCX P;  1HBO A;  1C1B A;  5KFX A;  5HP1 B;  1VRU B;  2FJV A;  1TVR A;  2JHE A;  4L3N A;  2AJ2 A;  2AJQ A;  4I6Y A;  2ZHO A;  5CAA A;  2C22 A;  4UZB A;  2NLW A;  4ELT A;  4KFB B;  4PPZ A;  1F9E B;  2HIQ A;  2M7S A;  4C3L A;  1RWM B;  2ATC B;  3QWP A;  3ITH A;  5BYS A;  1AUD A;  1YWX A;  2WVB A;  2XB2 D;  1N5T A;  3Q8V A;  4R5P A;  3CWJ A;  4GKK J;  1X5O A;  3QO9 B;  2XO7 A;  4PKD B;  2UU9 F;  2YH0 A;  4PQA A;  1LWE B;  2AQ4 A;  3THT A;  3BGR B;  1X4C A;  3DRP A;  2VZ9 A;  3NOG A;  5KFA A;  4KGV B;  4YHH J;  3W2V A;  5J2N B;  4X84 A;  5DGB A;  3RZA A;  1FE0 A;  2L41 A;  4ZCK A;  2R7U A;  1UA1 A;  3MPV A;  1T7P A;  2HHS A;  3M6W A;  4X4O A;  4IR9 A;  2AW0 A;  5HO4 A;  2NRE A;  2HVZ A;  1FX2 A;  1RK8 A;  4QPX A;  4YB1 P;  1RAJ A;  3GP9 A;  4WYW A;  2AJ4 A;  4RW6 B;  2BNZ A;  3SMZ A;  4DI6 A;  5T7L B;  3RRG A;  4KH0 B;  2DR5 A;  2C3P A;  2EFQ A;  4G6V B;  4EBC A;  2J6T A;  4M63 A;  1KQF B;  3MM8 A;  2GIR A;  1RT1 A;  1U0S A;  3HHK A;  3MEG B;  3D7S B;  1NB7 A;  4K4T A;  3DLK A;  2XSJ B;  1PJ7 A;  1N34 J;  4QW9 A;  2ZH6 A;  1NDC A;  1KTV A;  3BQ0 A;  2PN6 A;  2RU9 A;  1S6O A;  2AF6 A;  1OJ4 A;  3KK2 A;  1S9E A;  3VHQ A;  4OYI A;  4OX6 A;  2IYG A;  2OHD A;  5ETR A;  5I3U A;  1P6T A;  2VHG A;  3QIP A;  5I3Q A;  4ED4 A;  4KO0 A;  4DV6 J;  4X4V A;  4KAI A;  3SBM A;  4WXW A;  2WK4 A;  3KJV A;  4DQI A;  1ZS6 A;  5LT5 A;  4XK8 C;  4EZ6 A;  2LU1 A;  2ADL A;  1HR0 F;  2F4V F;  1WEL A;  3N28 A;  1UJ6 A;  3M8Z A;  2HKE A;  3G6Y A;  2FLO A;  4B17 A;  2NZC A;  1SUQ A;  1KD1 T;  1FFW B;  1KNZ A;  4JV1 A;  2H1Y A;  2V8D A;  4CYU A;  2Q66 A;  5KG4 A;  4ED0 A;  3NAI A;  3W3S A;  2ROP A;  2KYX A;  2ASD A;  2Y9H A;  4C4W A;  3OTO J;  2CXE A;  2K1R A;  1OY6 A;  4OYP A;  3EX7 B;  2H5E A;  2MSS A;  1TUV A;  5IM0 B;  1UWB B;  3PYE A;  1UET A;  2CWK A;  1QTN B;  2FGC A;  2DIU A;  1JLQ B;  2FD2 A;  5L46 A;  1AB8 A;  2ASL A;  1F9H A;  1P9Q C;  1N33 J;  2WBM A;  1N6Q A;  4B3M F;  1FDN A;  3MOZ A;  2VQE F;  4QW8 A;  1CS4 A;  5CYQ B;  4WII A;  4JB8 B;  3U1L A;  3LWM A;  4JI8 J;  5C42 B;  5C5J A;  4GO7 X;  3IR7 A;  4DR5 J;  1S6P B;  1TKD A;  3WX8 A;  2AD9 A;  4DDF A;  3ZNJ 1;  1Y11 A;  4O3R A;  2KZM A;  4C8L A;  2Y1L B;  2K1O A;  1K9M T;  4ZK7 M;  1PAE X;  4P2M A;  1LW0 A;  3TEH B;  2B9Y A;  3GIR A;  2EI5 A;  4CLZ A;  5IFM A;  4FXV A;  2KG1 A;  1RT4 B;  2FPH X;  1RYS A;  2COL A;  4LSL B;  2PI5 A;  2CPZ A;  3NGD A;  4USK A;  2B43 A;  5AE3 A;  3PO4 A;  2IC3 B;  4EGL A;  1C2P A;  5HN0 A;  1UFL A;  1E6Y A;  3J81 Y;  2W01 A;  4YQW A;  1VBX A;  2A0F B;  4LF2 A;  2ADB A;  3VZI A;  2MEW A;  4CO4 A;  3FUY A;  2J9E A;  3I9Z A;  4ZP8 A;  3I4P A;  4LMZ A;  3TZZ A;  3M30 A;  2LEA A;  3SSS A;  2KHC A;  5EHH A;  1X0F A;  2RF2 B;  2QLX A;  4ZP6 A;  3DRS A;  1FI4 A;  2F8E X;  1R0A A;  2HGL A;  1IKV A;  4JI4 J;  2WSE C;  4U7U D;  3CJ0 A;  4LFA F;  1TL7 B;  2M2B A;  4P10 A;  2W9A A;  1NND A;  2VV5 A;  1FWL A;  4NLD A;  5DET A;  2AYB A;  2R2U A;  1UPP A;  2PC6 A;  2MQN A;  5E41 A;  3EGV A;  2OPS B;  4DZ6 A;  3H5X A;  3PW7 A;  1RGV A;  3TVY A;  4D8J A;  3FEZ A;  5DG8 A;  2JFK A;  3OTD A;  1H72 C;  5KFK A;  5KFH A;  1JLF A;  3OTE A;  1M1H A;  2V8H A;  2QT7 A;  3KWM A;  1B7Y B;  4DF4 A;  2GA7 A;  4DS5 A;  4BC7 A;  5CA5 A;  3ZTO A;  5E3R A;  4HT7 A;  3CME S;  5KFE A;  3HJF A;  2DNL A;  1EQM A;  3FBC A;  4P2X A;  4CLT A;  4TY8 B;  4DN9 A;  1FD8 A;  2BNW A;  2JZ5 A;  4WP9 A;  4FBU A;  3LTO A;  4OHZ A;  4KIA A;  3NGS A;  1YZ6 A;  4I2Q B;  2BQR A;  2J0S D;  4LFC F;  3KJN B;  3OD2 A;  3L7U A;  3GB0 A;  4BWM A;  1JLG B;  2KL8 A;  3ILI A;  4U7C A;  1NSQ A;  4PQU B;  4A8Y A;  4P7T A;  5JVH Q;  5GAH I;  1SJR A;  1FES A;  1Y5I B;  1S1U B;  1SKR A;  4NCG A;  4H4O A;  4WF9 Q;  1LNQ A;  1ZAX A;  1HBU B;  3RBE A;  3FEX B;  3GIM A;  2HVD A;  4K0K F;  2AYE A;  4K7Q A;  1AZS B;  2F4F A;  2Q6C A;  5IWA J;  2A1B A;  1KFD A;  5D77 A;  4MJW A;  3EYZ A;  1S7I A;  1S0N A;  5DG7 A;  1UVK A;  3MEK A;  1SH3 A;  4JV5 F;  1F1B B;  1WOS A;  2I5J A;  4CQ1 A;  3OPK A;  4OX9 F;  1RWN B;  3W2W A;  1X9S A;  2JWN A;  1FA0 A;  4LF5 F;  4X65 F;  2Y1R I;  3IBF B;  1H2V Z;  5HL7 Q;  1DY3 A;  2CQ2 A;  4ECX A;  5AJ3 F;  5HJX A;  3HKW A;  5C2G A;  1YGY A;  4X4R A;  4LR9 A;  2H3A A;  1S57 A;  3B4M A;  1TL4 A;  1WHV A;  4FKX A;  2FLL A;  2NXC A;  2FVP A;  2CPG A;  1BQN A;  2VQF J;  1URN A;  5KG2 A;  4P73 A;  4RL1 A;  4ED1 A;  1UFK A;  2V8V A;  4TNO A;  1F6T A;  3QWU A;  4DMZ A;  1F3V A;  5HQM A;  1RIS A;  3DDK A;  1FCA A;  1B3T A;  3Q8R B;  2A10 A;  3MF5 A;  2BKO A;  4DR7 F;  3GXQ A;  2P8I A;  4NLU A;  3RG6 A;  2ZKU A;  2DR6 A;  2VUG A;  4AFF A;  4M5I A;  2DT9 A;  1RZM A;  2V2K A;  2PEB A;  4KHM A;  2MTL A;  4K4W A;  3N5F A;  3AAW B;  3LW5 C;  2KTQ A;  4CT8 A;  4KC5 A;  1IKY B;  4TU7 A;  1ZA1 B;  4QOT A;  4RW6 A;  4I67 A;  2MZJ A;  4K2J A;  2IRX A;  3AD9 C;  4JI1 F;  1XMQ J;  1CJU A;  4WPA A;  4C48 A;  3US5 A;  3J80 Y;  4ED2 A;  3G6E S;  4F26 A;  4ZVS B;  3DMJ B;  3G2X A;  2NXN A;  2WVD A;  3OHA A;  3MMB B;  2DHG A;  4CI0 B;  1RTH B;  3RTV A;  1JXE A;  1WSR A;  2XG8 A;  4IG0 B;  3UI3 A;  5HI7 A;  2W2Q P;  3V6D A;  3VGT A;  3HM9 A;  4B3T J;  1HWU A;  3MUR P;  4ZDN A;  3CCZ A;  4DOZ A;  5I4M A;  3ZTS A;  1I1G A;  3M2U A;  4ZLN A;  1QD1 A;  2LA6 A;  4MT1 A;  4YR2 A;  3EZ5 A;  4YME A;  4J9K A;  3H5S A;  3IFE A;  2R7X A;  4IUF A;  3IRX B;  1LFW A;  2YTC A;  1TKX B;  3AQO A;  4OJG A;  2YKO A;  4DU7 A;  3JXO A;  3V6H A;  2NCK L;  2OSQ A;  1XNQ F;  4ZJO A;  1PBA A;  5KFR A;  2HK2 A;  5EWG A;  1HFE L;  4JI7 J;  1RT5 A;  1S0O A;  1RT2 B;  5KFY A;  2R7Q A;  1WTB A;  1CEZ A;  5IOL A;  3G8Q A;  2ZC3 A;  2B8Q A;  4WZQ A;  2Q2K A;  1B70 B;  4OQJ A;  2NPI A;  4USV A;  1YJ7 A;  5L39 A;  4DU8 A;  5HJY A;  4ANC A;  2VDI A;  2Y1I A;  5CAB A;  4O3P A;  1MMD A;  1U1P A;  3OJS A;  4CO3 A;  3W65 A;  3U1N A;  1VQ9 S;  3FMB A;  2HQC A;  3C16 B;  4QBU A;  2BRK A;  3BH6 B;  1SQG A;  2QSW A;  4L75 A;  2J9C A;  3NXZ A;  2W2P P;  1RTJ A;  3GIL A;  4LT6 A;  2Q43 A;  1HA1 A;  3K2Y A;  1R8P A;  4QIV A;  2YVS A;  2D3Z A;  1UWB A;  3ZZ0 A;  4JI2 F;  4OJ1 A;  1MLA A;  3KLI A;  3DLL Q;  4TLQ A;  3O3L A;  3N5B A;  4NAS A;  2KVQ E;  5C25 B;  1VMB A;  3EZO A;  3WZ0 A;  3E2E A;  2EBG A;  3S8S A;  2KFZ A;  1X4D A;  1S6Q A;  1FKO A;  3N9U C;  2DH8 A;  1SQE A;  2VFV A;  2DCL A;  3L7P A;  1HPZ A;  3BSC A;  4DLE A;  3M9N B;  3MR7 A;  1D3W A;  3JSB A;  1HWK A;  1UVI A;  2NXE A;  1KC8 T;  4DV3 F;  3THP A;  2WAQ D;  1GFW B;  4IYQ A;  2GVZ B;  1KVK A;  4M5M A;  2E1R A;  4RU9 A;  1GMV A;  4R8U B;  3A3P B;  2XY5 A;  4I2P B;  4OYB A;  3I56 S;  2I1R A;  2MQ8 A;  5JMN A;  2LCW A;  4CLP A;  4TQR A;  3DNC A;  1FEE A;  1WEY A;  5IT9 U;  2ZH3 A;  4AQY F;  3MTJ A;  4DFM A;  4U7U K;  3C19 A;  5D78 A;  4URG A;  3E51 A;  1FTC A;  4NA1 A;  1X93 A;  3PYF A;  3HSG A;  3GJQ B;  2QN6 B;  4X64 J;  2BAC A;  4C8N A;  4KB7 A;  1CSJ A;  1VC5 A;  3DXB A;  2IFX A;  2GIQ A;  1HD0 A;  1OHN A;  5GAH U;  3DLE B;  3PYD A;  2FJD B;  2WB4 A;  4I6A A;  5LMU F;  4WZM A;  1U49 A;  4ZVR B;  3B78 A;  4OI2 A;  1CJV A;  3EIC A;  2J8A A;  2W4P A;  3F41 A;  4CCH A;  3K5M A;  1XIQ A;  4O3S A;  5H9E J;  3R7S B;  1RAI B;  2BOP A;  5D0G A;  5FDL A;  1RJJ A;  2YKN B;  3M8W A;  2DCU B;  5SUH A;  2GJI A;  3MMC B;  1VQ6 S;  4HDG A;  3VZH A;  2GW8 A;  2EK6 A;  1LXN A;  1G4C A;  4OX9 J;  2KHD A;  4M94 A;  4WE1 B;  5IZH A;  1HWJ A;  4X65 J;  1CC8 A;  1IKW B;  2I2Y A;  3P5B P;  2M9K A;  1R89 A;  1YDL A;  3HFZ B;  3IG1 B;  2IYI A;  1NK7 A;  4XDD A;  2DH7 A;  2E66 A;  1LWX A;  3LP0 A;  4OX8 A;  4UY8 5;  1GT8 A;  4IG3 A;  2RIL A;  5KFC A;  2I9S A;  1XBW A;  1GMU A;  1N88 A;  3ONQ A;  2CJY B;  3PTW A;  1NJW A;  3F56 A;  3QID A;  3H42 A;  3TQE A;  5ETP A;  3IWN C;  1S9G A;  1S1T B;  3ELH A;  4NCA A;  2GGP A;  1QVF R;  1R27 B;  1XMO J;  2QA4 S;  5B0C A;  2X51 A;  5E5N A;  2GML A;  2DNQ A;  3I0S A;  2OPQ B;  5IV3 A;  3HVA A;  2DHA A;  1U47 A;  3HSD A;  2WBR A;  1U1K A;  1V9O A;  3P8B B;  2B9E A;  1AA1 B;  3BGL A;  3C3L A;  4ZVG A;  3SV4 A;  1HI1 A;  3MD3 A;  4DL0 C;  1EX8 A;  1NPP A;  3A3N B;  2XBP A;  1M1K T;  2MZS A;  2QYG A;  2XZW A;  2ZZM A;  3W9H A;  3DHW C;  5HVG A;  1GX5 A;  2FVR A;  1EB0 A;  3Q89 A;  3QNW B;  3AQP A;  4H4K A;  3H0P A;  3VTI A;  2QLB B;  1B28 A;  5D8H B;  4PR6 A;  4DV5 J;  5HMX A;  5IXU A;  1IJE B;  3GV5 B;  2CQ0 A;  4NML A;  2HHQ A;  3UN3 A;  4KY3 A;  1FRH A;  2YNH A;  3Q8Y A;  3TX8 A;  1U09 A;  2A3J A;  2K5J A;  5D4L A;  5LSR A;  4IH5 A;  2ATL A;  2V5H G;  2IM3 A;  1SL1 A;  3UNY A;  3A8E A;  3MPY A;  3SSR A;  3QSY B;  1RAD B;  4GVL A;  1SJQ A;  2OFH X;  4FPR A;  1RQ0 A;  2XS5 A;  1YRX A;  3PHE A;  1TQL A;  5CZV A;  3DM2 A;  5DDQ C;  5KT2 A;  1K44 A;  2LXU A;  1B0P A;  2N3O A;  3CB4 A;  5ITH A;  1LK5 A;  1JLC A;  5HAO A;  5ADZ A;  1XR6 A;  1OPI A;  2CQ3 A;  4Q2M A;  1QM9 A;  2JSX A;  2A2D A;  5SZT A;  2VKR A;  2HBY B;  3NL0 A;  1DRZ A;  3MAA A;  2CNO B;  4X4U A;  1FVQ A;  2EC0 A;  1X5S A;  2VD3 A;  2LXI A;  2D3O R;  2CNN B;  2ZBC A;  5B08 A;  4F7V A;  4GKJ F;  4X4P A;  1ULR A;  2DXE A;  4WKY A;  2MKI A;  1P1T A;  1DTT B;  4LF4 F;  1C0U A;  3MMB A;  3K0J A;  1IBK F;  2F8H A;  3JS9 A;  5A0Y A;  3IAM 9;  2XO6 A;  1RAG B;  1GNK A;  3PR4 A;  3KDN A;  3EZU A;  1FEH A;  1KS2 A;  5LSL A;  4J9L A;  3OXF A;  3OHB A;  3Q23 A;  1X8D A;  2JH3 A;  3DDN A;  3MEC B;  1R6V A;  2YXL A;  2AZ3 A;  4L74 A;  3IP0 A;  2BE9 B;  2DJW A;  5DGA A;  3AA8 A;  1XC9 A;  1L3U A;  4CO2 A;  3W5X A;  2CG4 A;  1T9Y A;  2PI4 A;  2CPF A;  1X31 C;  1WC4 A;  4NXM F;  3OUY A;  1RTI B;  4ED7 A;  3ILJ A;  4KV8 A;  3L7O A;  1NK6 A;  3OTB A;  3NRB A;  3HSZ A;  5FII A;  4LJM A;  5DLF A;  5HRO B;  2E1C A;  2GHV C;  5CHC B;  3OFG A;  3NP5 A;  2UXC F;  2L08 A;  2G13 A;  3D68 A;  2K9I A;  3DGP A;  3AA9 A;  1GAO A;  2O67 A;  1BQX A;  3HCX A;  2HUR A;  1RU2 A;  3FKB A;  4KYZ A;  3SQG B;  1X4E A;  1TKZ A;  3M2R B;  2W1B A;  4J91 A;  4Z37 A;  1C4A A;  4E2F B;  2Z2Y B;  1TL1 B;  1B7F A;  3FCH A;  1IBM J;  5D6G A;  1CBK A;  1YBT A;  3LAM A;  3RW6 A;  3PEJ A;  1U4B A;  1FRM A;  3NNA A;  2DGQ A;  4OZL A;  4MKY A;  1VC0 A;  3AHP A;  3SYZ A;  4DN0 A;  1UEV A;  2ZZN A;  1URR A;  3DI6 B;  3VAL A;  3JQK A;  1SL0 A;  7AT1 B;  4DL5 A;  1DJ0 A;  5F8J A;  1IRQ A;  2IA6 A;  2XNQ A;  3VCD A;  2DNK A;  2G9O A;  3L9Z A;  3H2V E;  3TYT A;  1RLD A;  4IOB A;  3RBD A;  3WHI A;  3C6T B;  1EET B;  3IGV A;  4LBI A;  2R7T A;  4ZIW A;  3TA2 A;  1S48 A;  5KG6 A;  2DHS A;  4OV1 A;  3K5O A;  1H38 A;  3KHH A;  3KHR A;  2Z2L A;  2Q79 A;  4KKO B;  1JNZ B;  1N32 F;  5EUH A;  3M8R A;  2LA4 A;  1NXI A;  1S6U A;  2ZNY A;  2VG5 B;  1HHS A;  5KFJ A;  2HNY B;  1U1R A;  2MJU A;  4MKA A;  3HVT A;  1RT3 B;  2H4Y B;  2Y8W A;  4FS1 A;  2AYM A;  1OS5 A;  3VQS A;  4OZ5 A;  5F8I A;  4U8Y A;  5HAT A;  3LP2 A;  4Z7Y A;  2D74 B;  3CJK B;  2RD5 C;  2MHN A;  4M5D A;  1WC5 A;  4B3O B;  1F2G A;  3TP2 A;  3NMR A;  5J2M A;  4AL6 A;  2V9W A;  3QLH B;  4I1T A;  2BAB A;  1RT6 A;  2AU0 A;  1MU2 B;  2X3G A;  2NUH A;  2CQC A;  5K5M A;  2L9N A;  2VFU A;  4RJV A;  1W25 A;  4FYX B;  1LWC B;  4RO0 A;  1CUL A;  2ZBR A;  5J1P A;  1VRT A;  5K20 B;  4RW9 B;  1VQL S;  3TA0 A;  2YY3 A;  2HRT A;  2ZH7 A;  1BQM A;  2VBZ A;  4EI2 A;  4M5J A;  1WF0 A;  2CFX A;  4Q0B B;  3UCG A;  3I82 A;  2IBO A;  3M2V A;  2PD1 A;  4F0M A;  3T9N A;  1W2I A;  3MMC A;  5CYM A;  3ENV A;  3H59 A;  4A4J A;  4F3O A;  3H8Y A;  2C3U A;  4Q45 A;  1IUJ A;  2AX0 A;  2YH1 A;  3MM7 A;  1NCL A;  4J9P A;  4WE1 A;  3KLE B;  2AZ1 A;  1NKC A;  3DKD A;  3WBZ A;  4HH0 A;  2JEJ A;  3C66 A;  1F2H A;  1BWE A;  2ERR A;  1IKX B;  1BMQ B;  2D1C A;  2C3M A;  2BBE A;  3W63 A;  2OIH A;  2MGZ A;  4ES3 A;  3C6U B;  3E01 A;  2HYI B;  1VQP S;  1TR0 A;  1JJ2 R;  4DV7 F;  4W90 B;  1NLA A;  2CQB A;  4QYZ K;  2RHQ B;  1B0V A;  4C8Z A;  2QL9 B;  2NZ4 A;  5KTQ A;  4ILM A;  3W60 A;  2BVZ A;  4LUB A;  4I6W A;  3UN2 A;  2AEF A;  2J6S A;  1X4H A;  1V5I B;  1PYS B;  2D69 A;  2PO4 A;  1HBN B;  2UUA F;  1UVL A;  2ABY A;  2J6U A;  3EDR B;  5EN1 A;  4NMX A;  1F0X A;  1Q81 T;  2JC0 A;  1N36 J;  4O3Q A;  3JTP A;  3M6X A;  3RR8 A;  4YS2 A;  3FFI A;  2RKI A;  3HP6 A;  1VQ8 S;  3JYT A;  2QO3 A;  2HZV A;  1SXL A;  1PSD A;  2EXU A;  4WFX A;  1S10 A;  1ZET A;  3JB9 k;  5B7W A;  3RAQ A;  5JJB A;  1NHK L;  4ES1 A;  1Q7L B;  1HD1 A;  1S1W A;  4F4K A;  1WWH A;  1GXL A;  1IBK J;  5KG3 A;  1R3N A;  4ZKA A;  2V68 A;  2VBX A;  3LO3 A;  3GMG A;  1D8Z A;  3QJJ A;  2MQP A;  4IDK B;  3VVT A;  3VF0 B;  2K3I A;  3SSQ A;  2JNJ A;  2K2P A;  2B4U A;  4N77 A;  2XMV A;  5T41 A;  1D0E A;  5A76 A;  2WVF A;  4C11 A;  2AT1 B;  4ID5 A;  1D9A A;  2FJA B;  2R7R A;  4ICL B;  2VC0 A;  1EZZ B;  1RWX B;  3Q86 A;  3KYL A;  1RT7 A;  4ZPC A;  1KKH A;  4JI3 J;  2ZWO A;  1KSP A;  4ZVT B;  1DQ8 A;  1U6Z A;  1RCX B;  4GC7 A;  1H74 A;  1S76 D;  2P9E A;  3CJ2 A;  4PWD B;  1JB0 C;  4OI3 A;  1IQZ A;  3ZC4 A;  2IM1 A;  3ETO A;  3GCW P;  1YJT A;  3FCW A;  1N0V C;  3THV A;  2YX7 A;  2ALZ A;  2PEH A;  4OZ0 A;  1CJK A;  2J9D A;  2C2K B;  2V94 A;  1C4C A;  2G2Y A;  1N48 A;  3K58 A;  4DR1 J;  3T1Y J;  4MFB B;  4M5K A;  2ZHA A;  3BN4 A;  4TYA A;  3EDQ B;  1IBL J;  5KOW A;  4A8M P;  2RBF A;  3TA1 A;  5DLG A;  3LGH A;  3KK1 A;  2HND B;  2AX1 A;  3U7J A;  2BQU A;  3FT7 A;  3GLJ A;  4TN2 A;  4DR4 J;  2W9C B;  1UEU A;  1NSK L;  5A6W A;  3R5C A;  3MR5 A;  3QGP A;  3KUH A;  3BPS P;  1U2C A;  1QSL A;  1YX2 A;  2C3Y A;  3S1T A;  5BR8 F;  3Q2T C;  2YQ0 A;  4HHH A;  5GVQ A;  3BGF A;  4HKQ A;  3PW0 A;  5A2Q Y;  2JVR A;  4NOH A;  3GZ7 A;  3TI0 A;  3VQT A;  3I6P A;  5B0D A;  4OZ2 A;  3HFV A;  3KHL A;  1CLF A;  3OT9 A;  4MIB A;  2OO4 A;  4AYB D;  1X4F A;  5LMN F;  5IS2 A;  1FTR A;  3EUN A;  2AGP A;  3HSJ A;  1UVJ A;  1U6F A;  3R97 A;  2IM0 A;  3TUP A;  4B3R J;  2AWZ A;  2Z0G A;  5HVF A;  1TK0 A;  2VON A;  2HHU A;  2IJN A;  1QSS A;  1RAF B;  2KT5 A;  1Y5L B;  1J5O B;  3MED A;  2CJA A;  3KG4 A;  5K9F A;  3J81 j;  4CO0 A;  1WHX A;  2J7U A;  4PEO A;  1YI2 S;  5I3P A;  3CDA A;  4XO0 A;  2ZIT A;  3OR1 B;  2IJR A;  1YJN S;  4Q8F A;  2O1P A;  5J2P A;  4KR0 B;  3W5Z A;  1HQ2 A;  2HGM A;  2JJ4 D;  1YHQ S;  2VIC A;  5DQI A;  2KN4 A;  4A8Q A;  3QPI A;  1Q86 T;  2R2R A;  1T0T V;  1NK8 A;  2E5G A;  3R5J B;  3OV7 A;  1MMN A;  2L48 A;  4HTJ A;  5LXY A;  3VGS A;  2MLX A;  2OI2 A;  3G5O A;  4EO6 A;  3M1V B;  1NLK L;  1NHV A;  2KO1 A;  5K8P A;  4B3O A;  4USM A;  2VG7 A;  3MEE A;  4I7F A;  2IA0 A;  3JSM B;  4HV0 A;  1G2E A;  5KT7 A;  1M5S A;  2AYG A;  2JEG A;  4W98 A;  1VCT A;  4TU9 A;  3P45 B;  2HFO A;  4O4G A;  3T1A A;  2ZVI A;  2FJW A;  1RDR A;  1KRP A;  2PII A;  1VJQ A;  1S99 A;  2GNK A;  4BDP A;  3Q8U A;  1HW9 A;  1QAJ A;  3O2I A;  2GO9 A;  2ZJQ Q;  1NM2 A;  2D9P A;  3Q8Q B;  1T9V A;  3VAI A;  5B0F A;  2HNZ A;  4RW9 A;  4LF7 F;  2D9O A;  3C46 A;  3DRY A;  2NXU A;  3ZXW A;  4RLE A;  5KFG A;  8RUC A;  1VOM A;  2G2Z A;  3TRG A;  1HBO B;  1C1B B;  2IY5 B;  1CQN A;  1TVR B;  3T5J A;  1DTQ A;  3QFW A;  3TNV A;  3P4U B;  3MUT P;  3LUY A;  3EE3 A;  5EX0 A;  2LFV A;  4K4U A;  4M1K A;  4CZC A;  4K4V A;  5KFQ A;  1TUW A;  4PG5 A;  2LMI A;  4LF8 J;  1WOR A;  1YJR A;  3ITH B;  2IJF A;  5F41 A;  4ZOS A;  3N79 A;  1RBA A;  2LDY A;  4R5P B;  1FJG F;  4PXB A;  4RUH A;  1FJE B;  3W8G A;  2D41 A;  3R5B A;  2QA2 A;  2BMB A;  4B9N A;  1MWY A;  2H51 B;  3IS9 A;  1WD6 A;  4KHP F;  1FKP A;  1QY7 A;  2XGP A;  4ES2 A;  3LAL A;  2RML A;  1Q16 A;  3DRP B;  3G82 A;  2X1G A;  2BJE A;  4DR2 J;  2QA1 A;  3HUL A;  4IOC Q;  5LXR A;  2FHO B;  1U1L A;  3UVJ A;  2EPI A;  3QZ8 A;  1YLX A;  5GME A;  2B3T B;  3C15 A;  3HD2 A;  1H2U X;  1T9X A;  2WCX A;  4J9Q A;  5C24 A;  1H7X A;  2MKJ A;  2ZUA A;  5B0E A;  4DUY F;  4IKA A;  4KH1 B;  1KQG B;  4PG8 A;  3CJ3 A;  3FBF A;  2AMC B;  3TVZ A;  1FNX H;  2W2M P;  3MM8 B;  2I8E A;  1YVF A;  1JLB A;  4M5L A;  3NWG A;  4FYV B;  3GSI A;  5M2P A;  4NLT A;  2V0N A;  4K2X A;  3I5A A;  5K8N A;  1Q5V A;  4DX8 H;  1HNZ J;  4DQS A;  3ENW A;  2DGO A;  3DLK B;  2W4D A;  3E3X A;  3SCK E;  5KG7 A;  1IR0 A;  2QC3 A;  2R3V A;  3HMJ G;  2CQI A;  2KJV A;  2EW9 A;  4IO9 Q;  4ZVP B;  4J7C A;  3KK2 B;  3DCA A;  3M05 A;  3QAT A;  4KJI A;  4DBQ A;  1PIL A;  5I3U B;  3QIP B;  5E3P A;  3Q83 A;  1L3K A;  5BJR A;  2JDJ A;  4F36 A;  1JK9 B;  3KJV B;  2NQP A;  2HMI A;  4L6V 3;  4PG6 A;  3K7R A;  3CF5 Q;  2DPI A;  3AOA A;  2V8P A;  1S4E A;  5E33 A;  2W9B A;  1Q8I A;  1WI6 A;  2NYH A;  4TY9 A;  2XTJ P;  1GK8 A;  1SBR A;  2PE8 A;  4QJV A;  3J7A N;  4TYB A;  1SUQ B;  3NLC A;  1X0P A;  4ZPD A;  4ICL A;  1K0V A;  4CYU B;  3R7N B;  2J0Q D;  2HHP A;  1PAR A;  4DG1 B;  3KKF A;  1S5Z A;  3DLH A;  1LW2 A;  4AXJ A;  3BBB A;  1N54 B;  2K1R B;  5A6P A;  2Z4P A;  2ACM A;  3HT0 A;  4X62 F;  3ILO A;  3DU5 A;  4IQM A;  3O1L A;  5AE1 A;  4PXE A;  2QFI A;  4M5G A;  4DL6 A;  3DOL B;  2XZT B;  3Q24 A;  4MIA A;  3RW7 A;  1N6Q B;  4MH8 A;  2PFF B;  2NPF A;  5LMN J;  1CS4 B;  2QL7 B;  3R3T A;  2CPH A;  2G1D A;  4MFB A;  4DPU A;  2V4Q A;  3TW0 A;  4NXN F;  2GC8 A;  2XMK A;  3T1H F;  1TZ0 A;  5T14 A;  1HI8 A;  2N82 B;  5AXL A;  4WFA Q;  5LJ5 Y;  3UNG C;  4NLG A;  4AL5 A;  1V3R A;  2E1P A;  2X1A A;  2HND A;  2XMJ A;  4ZVU B;  1NSA A;  2HHT A;  2IMO A;  2DXF A;  4P71 A;  1U25 A;  4CO1 A;  3UR0 A;  3A3O B;  3CCU S;  2WW8 A;  9RUB A;  4DQQ A;  1LW0 B;  5GAD I;  1VLO A;  1M1G A;  4C97 A;  3J7A 1;  4LRC A;  3CUN A;  4CNZ A;  2CQD A;  2JEF A;  4CLU A;  2R7V A;  4DSJ A;  4DCP B;  2UXB F;  2EEY A;  2E5L J;  1FDB A;  2R8I A;  1SVD A;  3EGZ A;  1KTQ A;  1WEX A;  2XZD B;  2YNG A;  1S59 A;  3DYA A;  2MKC A;  3VWS A;  1HYS A;  2MQM A;  4E0D A;  1U1O A;  2VKZ G;  4N5S A;  1U1N A;  3GFH A;  4JYA F;  2MKS A;  3IC1 A;  3RBX A;  2C2E A;  1E6Y B;  2QLF B;  1HQE A;  3D9B A;  3IBW A;  5HMY A;  1ZM4 A;  4EZ9 A;  2ZH4 A;  2VPX B;  2VJV A;  2ZD1 A;  4Q43 A;  2BM0 A;  3R1L A;  2G0C A;  2O5D A;  2JLF A;  1YJU A;  4DR3 F;  3T5L A;  2DNM A;  2OGU A;  4P6Q A;  3BGO P;  2LQ5 A;  5D0R A;  2VBY A;  1VIO A;  3MCS A;  2DGU A;  3LH2 S;  4UF4 A;  3NO7 A;  3M30 B;  2RU3 A;  3SXL A;  3PKM A;  1VI7 A;  4CTA B;  2VOO A;  4F2S A;  2J7K A;  5D0H A;  1U0H A;  4KGK A;  2HWH A;  1WKK A;  1XNR J;  3DRS B;  2C2D A;  2OP5 A;  2ZWP A;  1J5O A;  3T3F A;  1R0A B;  3G71 S;  1SQF A;  1IKV B;  4X4N A;  2A6M A;  1FER A;  3W66 A;  1UEK A;  2QRR A;  4UOF A;  2CJB A;  2BQ3 A;  2GMH A;  2JL9 A;  5CCL A;  5KT6 A;  2RT3 A;  2Z56 B;  4RUC A;  1I3O B;  3QQC D;  2YX1 A;  1W26 A;  2CVE A;  4JUZ A;  4ZLP A;  7FD1 A;  2DB1 A;  1D9D A;  4JI5 J;  3SFG A;  5K8M A;  1JLF B;  1BAZ A;  3M8Q A;  2XUL A;  4YR3 A;  4RNF A;  3KLF A;  5DO2 A;  3IGN A;  1V3Z A;  3I96 A;  3W9J A;  2MPU A;  1C1C A;  3AB4 B;  3TVK A;  3A1Y G;  2CPI A;  3H87 C;  2HWI A;  3D66 A;  1APS A;  3QGG A;  3LWL A;  1MYL A;  4OZ1 A;  4IO1 A;  3CIM A;  1WC1 A;  4ERD A;  2EVZ A;  3BB5 A;  2JRS A;  3M32 A;  3FRZ A;  3QYY A;  1UL3 A;  1I94 J;  3R9L A;  1TL3 A;  4NCG B;  3S6E A;  4DSI A;  3T6B A;  4H4O B;  2JLG A;  4J9V A;  4QYR A;  3RB0 A;  4DSF A;  2VG6 A;  3M8P A;  5D3G A;  5C7P A;  3OFF A;  1TFY A;  3KUE A;  3C8Y A;  2I5J B;  4XPE A;  2VC1 A;  4DUZ F;  1DAX A;  3CCT A;  1B99 A;  1HAR A;  2F40 A;  2QLJ B;  3W2W B;  3O8W A;  1RWV B;  4HLB A;  1MN9 A;  4I0W A;  4PWU A;  3JTO A;  2BJD A;  1J27 A;  1JLE B;  2V4J A;  1WDD A;  5A8K A;  3I31 A;  3I5C A;  2YQ3 A;  2U2F A;  2XMU A;  4ITS A;  5LM7 E;  5KFZ A;  2W7O A;  2OD6 A;  1BQN B;  2CDR B;  3CMA S;  3OL8 A;  1SIW B;  4GVB A;  1WUU A;  5EX3 A;  1NZ8 A;  3FK4 A;  1A0O B;  1UFW A;  1KN6 A;  5KFO A;  5M2U A;  4A8W A;  3MR2 A;  4ZA1 A;  5I42 A;  3BEG B;  1CG2 A;  4QR1 A;  3BH7 B;  2DH9 A;  1GMW D;  3P3D A;  1RTZ A;  3UR3 C;  2HLU A;  1HNW J;  2K8G A;  4ELV A;  2V50 A;  5AT1 B;  1AFI A;  4ECZ A;  3CT9 A;  2ZDP A;  3OR2 A;  1REV A;  3UD3 P;  4ME7 E;  4HEA 9;  1T03 A;  2DNH A;  3EPG A;  4V19 X;  4PUO A;  4FF1 A;  3QGI A;  3LAK A;  3GYN A;  3NCR A;  2CZ9 A;  1KOO A;  4ZN3 A;  1CJU B;  4HAC A;  4NRU A;  1J5E J;  3K17 A;  4NA3 A;  4P74 A;  3KDO A;  3LGN A;  1IWG A;  1UMJ A;  4X4T A;  1MML A;  3MI7 X;  4ILL A;  1T8E A;  2XLJ A;  2MYF A;  4P52 A;  1NPR A;  2KT2 A;  4YY3 F;  1S1V B;  2H9Z A;  2B8P A;  3GII A;  2VJU A;  3JAM Y;  1Q4R A;  4K59 A;  1YQH A;  1S4F A;  1Z1Z A;  3I9V 9;  2XM3 A;  3NS5 A;  5CD4 A;  5U47 A;  4JI6 F;  3V6D B;  1Y7P A;  2ZDO A;  4DV4 F;  3PYG A;  2YQ1 A;  3M2U B;  4FYW B;  4DZD A;  2V9K A;  4KHR A;  5HMZ A;  1G6B A;  4HDH A;  2DNZ A;  3T1H J;  3PX6 A;  2WON A;  3N6M A;  3FSX A;  2BZ2 A;  2E9T A;  5GAD U;  3HHN B;  1GMW A;  2KRB A;  4GO5 X;  1RT5 B;  4RU2 A;  3EPI A;  4QWA A;  3GIJ A;  2MB0 B;  1NDK A;  1ZYQ A;  5E2Q A;  4NYP A;  2O01 C;  3W1Y C;  2UXB J;  2ZE2 A;  4J9N A;  3HJV A;  2RRN A;  1Q8B A;  2CQG A;  3A12 A;  3U02 A;  4KPC A;  3LF0 A;  2J76 E;  3KK3 A;  4YR0 A;  1ICE B;  1KON A;  1WF2 A;  4F4Z A;  4YP3 A;  4RNH A;  4DG1 A;  1WAC A;  2XC9 A;  4KE5 A;  1G7C B;  3AD8 C;  2R2T A;  3GU0 A;  2LEP A;  1RTJ B;  5L9N A;  4B3S F;  2QZ8 A;  2MQL A;  2JX2 A;  5K14 B;  3I0R A;  1MWQ A;  3KLI B;  2JOQ A;  2AP6 A;  3WC0 A;  1B64 A;  3DOL A;  4JI0 F;  4C8M A;  3DC2 A;  3S7R A;  3T9Z A;  5FLX U;  2ILY A;  2UZA A;  1EKR A;  4U67 Q;  4OLP A;  5E3A A;  2FY8 A;  1FWK A;  3FEY B;  4DFJ A;  2DR9 A;  1S6Q B;  2Q1L A;  5KFU A;  1FKO B;  4RKU C;  1RHR B;  1SKS A;  3TEG A;  2AEJ A;  2ZVS A;  1RU1 A;  2GQ2 A;  2ZZT A;  1BGX T;  1HPZ B;  3UDV A;  2F7V A;  5DDP C;  1S0V A;  3D6T B;  2BSQ E;  3L3C A;  2C2R A;  1R8H A;  2W7A A;  1L3V A;  5AE2 A;  3DRR A;  4ZVE A;  3G86 A;  2YKQ A;  2E9Z A;  1VGY A;  3VAM A;  2CAJ A;  4LF6 J;  2DR8 A;  4WTY A;  2B4P A;  3D6H B;  5F8H A;  2V67 A;  2H4W B;  1WHY A;  1VQY A;  1KHV A;  1Y00 A;  3PKY A;  1U2F A;  2HRU A;  4HI1 A;  2UXD F;  5KFI A;  1O51 A;  1IQT A;  3R8Y A;  4B9M A;  1QAI A;  2AEM A;  4RW4 B;  3A13 A;  2E5J A;  3ISN D;  2IVY A;  3OSN A;  3KLV A;  1T9U A;  4NYO A;  2E5H A;  1HMV A;  4DPY A;  4OL8 A;  3FDS A;  3GR0 A;  3DDI A;  4I69 A;  4DR6 J;  4ECS A;  3M7V A;  1FHT A;  2OTJ S;  4YDX A;  1S7H A;  1F5B A;  4XPC A;  1FJ7 A;  4CM0 A;  3A8J A;  3CCW A;  1Z4U A;  4KGM A;  1WC3 A;  4O3O A;  1AFJ A;  3JSR A;  1BY9 A;  2JLE A;  3EJM A;  1NJZ A;  1NBE B;  2M3D A;  2OLW A;  4CTA A;  2XMT A;  2FJE B;  1CJV B;  3PRD A;  1OIA A;  4LVO P;  1VQ5 S;  4TVA B;  2HG4 A;  3R6G B;  3CDW A;  4OLO A;  4C0O C;  4DV0 F;  1F5A A;  4NEY A;  3UO0 A;  4ZIT A;  3CCQ S;  1XR7 A;  5FDL B;  4C0H A;  1JNR B;  3JQM A;  2ILZ A;  4YB5 A;  1RP5 A;  4DFP A;  2E44 A;  2QYC A;  4A8S A;  4P2S A;  5ETL A;  1BE4 A;  4FVC A;  4EBD A;  4NLO A;  4ZHR B;  2E7V A;  4ZN1 A;  2APO A;  4AE5 A;  4KRW A;  2R8G A;  1R8B A;  1RUS A;  5IT0 A;  1ZPW X;  3MGJ A;  2HFU A;  2M88 A;  4Y28 C;  2L9D A;  3BGU A;  4LRE A;  2FHK A;  3UPF A;  1U8S A;  2N7C A;  3P5T L;  1WG1 A;  2YKM A;  3HXM A;  3LP0 B;  2LQ8 A;  4ED6 A;  1FD2 A;  4IG3 B;  1SJ3 P;  3VVU A;  2HHX A;  5B0G A;  1WKL A;  1T05 A;  4DCJ B;  4ZP7 A;  2R9L A;  3MM6 A;  1A7G E;  1RWP B;  1S9G B;  5IC6 B;  3MTK A;  2GGP B;  2GVD A;  4QZV B;  1SV5 A;  1N5V A;  2UU9 J;  4USJ C;  2UUB F;  3NNE A;  3I0S B;  3PXG a;  3BZQ A;  2KVI A;  3KMS A;  4DV2 F;  5ETN A;  2CJQ A;  2EFP A;  4J37 A;  3JSY A;  4J5O A;  4EYH B;  5GAE I;  2KXH A;  2HQD A;  3NBP A;  2JXI A;  4Z2X A;  5IQQ A;  4KQZ A;  4BWJ A;  3F0N A;  1OQ3 A;  3BR9 A;  3CCS S;  2WSC C;  4F67 A;  4DV1 F;  3DLG A;  1G3O A;  3UDE A;  3GG0 A;  1U02 A;  1RA6 A;  2ZM6 F;  5J2Q A;  5ETQ A;  2GHP A;  4WKR A;  1NRK A;  4OYZ A;  4DS4 A;  3UCZ P;  2UVR A;  5E0O A;  2QIF A;  2MDA A;  2EG1 A;  3X3U A;  4OZN A;  3BDE A;  2CPD A;  1H3D A;  4IFV B;  1NB2 A;  2DY9 A;  1OG7 A;  2F9D A;  3D1O A;  1WDT A;  4ZPA A;  3UFC X;  1JLE A;  1NZA A;  1XMB A;  3WQP A;  2BR0 A;  3UE2 A;  4NZ0 A;  3CCL S;  1PJ5 A;  1ACM B;  1ZTT A;  2PMW A;  1HNV A;  3MXH P;  2H1O E;  1SIW A;  2UUW A;  1UZH A;  4JI6 J;  1JJC B;  4LFB F;  3VAF A;  2FY1 A;  2YNH B;  1F60 B;  3EXC X;  2GX8 A;  3BN7 A;  3QT8 A;  2KJW A;  4QIW D;  3KXD A;  1LWF A;  5E7O B;  2X1B A;  1XQI A;  3BKF A;  4LQ9 A;  1R0B G;  1NKE A;  1FFS B;  2CQP A;  3BF4 A;  1FXD A;  1IR1 A;  4F4Y A;  5HMW A;  2IAJ A;  4LSN B;  2CQH A;  3NGR A;  6FDR A;  4EU0 A;  2NXJ A;  5DQH A;  4XAK A;  3DM2 B;  1HR0 J;  1NEE A;  1GX6 A;  4GKK F;  2F4V J;  1L5U A;  1RHK B;  3VEA A;  2UVV A;  1EA4 A;  4LRV A;  1VQK S;  1JLC B;  4FYY B;  1LEO A;  1TAU A;  2F65 A;  1VHF A;  5KAK A;  1KOH A;  2M4M A;  1E6V B;  1RHQ B;  4Y6I A;  3DU6 A;  1U7L A;  3OLA A;  3PRV A;  4CH7 A;  4EFA C;  2CQ1 A;  2OEJ A;  4YHH F;  3MAA B;  2D7S A;  1YSJ A;  1QAY A;  2DO0 A;  2RQK A;  2CQ4 A;  3POT A;  1OO0 B;  2J7W A;  4AAI A;  1RAH B;  1NO8 A;  3TUJ C;  1VFJ A;  2RS8 A;  4UTG A;  3ZZR A;  1RAA B;  1C0U B;  2W7P A;  1S1V A;  3MAQ A;  2DGX A;  3PRB A;  2BJ3 A;  2VA2 A;  2I6W A;  2X3D A;  5A0Y B;  3MWB A;  4TQS A;  4B3M J;  4P7V A;  2VQE J;  1NJY A;  1V6H A;  2XYP B;  2K7K A;  1ZAV A;  3GR1 A;  3BSA A;  4A46 A;  2I0X A;  2MY8 A;  5B0A A;  4ZJQ A;  1D8Y A;  2LDI A;  2Z57 B;  4XDC A;  3G4S S;  2OAU A;  1U45 A;  4DX7 A;  1T94 A;  1N34 F;  3C2P A;  2BKP A;  4DL4 A;  2IIH A;  5A8W B;  1EAR A;  4KSE B;  3K8W A;  3J7Z T;  2I38 A;  4ID8 A;  4RR5 A;  1FDD A;  2R7O A;  4LF9 F;  1CJT A;  4DX5 A;  2LEB A;  2HAI A;  4R25 A;  2YWK A;  2FVQ A;  3OUY B;  2B5J A;  4CNY A;  4J9U E;  4KV8 B;  1BUX A;  1QTG A;  4ER8 A;  4URQ U;  2UVW A;  5L1K A;  2O66 A;  1ARO P;  4DV6 F;  4D3H A;  2R42 A;  3NWR A;  4ECQ A;  3MUM P;  4HHU A;  5DM6 Q;  5DJB A;  3ZZU A;  4DQR A;  2HBR B;  3DGP B;  1HBM A;  2W4C A;  4DLG A;  2GFF A;  2AIR B;  2FZC B;  4AND A;  3B8H A;  2HQ3 A;  3OW2 R;  1TKZ B;  2CZV C;  3KMQ A;  4FNH A;  4G1Q A;  5K14 A;  2HVI A;  2Q3P A;  3UDL A;  1U6B A;  2ZH5 A;  2GCF A;  2O3D A;  3W5Y A;  3SDE A;  4L72 B;  5HBM A;  2P5V A;  1SL2 A;  1QDU B;  4RX6 A;  3W8P A;  3EVW A;  3OTO F;  4O44 A;  4F4X A;  2CAX A;  1EP4 B;  2KEL A;  1MNE A;  1G1X A;  4ECR A;  3KG0 A;  1NSP A;  4ECT A;  3DHX A;  5HVH A;  1UTA A;  4X66 F;  4YB7 A;  1PC5 A;  3MM9 A;  3B82 A;  3EWG A;  3UDC A;  2YBV A;  3C14 A;  2GPE A;  5RUB A;  2KDO A;  3PDN A;  3J7Z 5;  1N33 F;  4QR0 A;  1TKT A;  4LFA J;  4QYZ J;  1VQN S;  1PG5 B;  1U48 A;  1Q78 A;  4MMO A;  3MM5 A;  3KNG A;  4PZV A;  3BO3 A;  4JI8 F;  1ZM9 A;  3ZZP A;  2WOM A;  2DPJ A;  4DR5 F;  2D3O 1;  3EVO A;  5DZ7 A;  1EKS A;  3HVT B;  4RW4 A;  1TK5 A;  4Q5V A;  3OJU A;  2V4R A;  5DM7 Q;  3UCU P;  1MNT A;  4L3K A;  1BWV A;  4N8O A;  5DS7 A;  4PG7 A;  1RA7 A;  3LP2 B;  6FD1 A;  4K4X A;  4USU A;  4M5D B;  3LGM A;  1ELO A;  5IT4 A;  3V81 B;  2E5I A;  2CPX A;  4CLL A;  4IQX A;  3CC7 S;  2HBZ B;  5KFB A;  4UQG A;  5J2M B;  1NK0 A;  4X4Q A;  3QFH A;  3VR1 A;  5F3T A;  2MY7 A;  2OUG A;  3AT1 B;  3V5R A;  1RT6 B;  4U6P A;  4A8O A;  1MW7 A;  1R8C A;  2KG0 A;  4LFC J;  3TJ9 A;  5DDO C;  2YNF B;  1CUL B;  3SQO P;  4OHX A;  5GAE U;  4MKV A;  1VRT B;  2DHH A;  3VAK A;  3BPD A;  2FLP A;  3HO1 A;  1RHJ B;  3NNH A;  2JBV A;  2KKH A;  2P6S A;  2BE2 A;  1B4S A;  3PZP A;  2AKW B;  3BBF A;  3T5H A;  1BQM B;  3R5G A;  2BUN A;  4NLQ A;  4K0K J;  3UN5 A;  3J81 U;  3AOD A;  3WDO A;  1VQ7 S;  3M2V B;  4E98 A;  2AGQ A;  1CVJ A;  1UJ4 A;  4TKT A;  3T19 A;  5LOQ A;  3AJD A;  5CYM B;  4JV5 J;  1P27 B;  5H9F K;  3RRH A;  4ZHR A;  1HWL A;  3MM7 B;  3DLJ A;  3AJ2 A;  2UUC F;  2QG9 B;  1Q8L A;  4ZMM A;  1ARR A;  4MK9 A;  4Y00 A;  4LF5 J;  1SJ1 A;  4FNI A;  4LIR A;  3OXG A;  1RHM B;  3GWC A;  3DLB A;  1ZBT A;  2GHW A;  4JI4 F;  3MMA A;  5AJ3 J;  3CXC R;  2OPP B;  3P49 B;  4FKY A;  3TAQ A;  2BJ1 A;  1VLY A;  4S0M A;  2LYV A;  3D2W A;  3AJ1 A;  4CLS A;  3DOK A;  2MGZ B;  1RHU B;  1IWA A;  3E01 B;  4MK7 A;  3H90 A;  5ETO A;  5H1S V;  1UVM A;  4LFB J;  1SJ4 P;  3ZZZ A;  4OYM A;  2JFD A;  3ZNU A;  3CCV S;  2XNR A;  3QJL A;  3GJT B;  4DR7 J;  3Q0A A;  1ZA2 B;  2IPO B;  4Y2K A;  1FNO A;  4ANE A;  4C3K A;  1FRK A;  1Q53 A;  4O4R A;  2ZOF A;  2IM2 A;  2VFT A;  3NS6 A;  1AW0 A;  3HI9 A;  3RR7 A;  5G0R B;  4LR8 A;  3QMQ A;  4MK8 A;  3IM8 A;  2CDQ A;  2MJN A;  1KWM A;  1KHW A;  1X9W A;  2HIY A;  3CJS A;  3RAM A;  1JLA A;  1DHM A;  4PXD A;  3FFI B;  2RKI B;  4J90 A;  2N4D A;  3JYT B;  1PO6 A;  4JI1 J;  1H98 A;  3ZZT A;  3LP1 A;  5F8G A;  2HLT A;  3V2U C;  4IFV A;  4P75 A;  3HHL B;  1FWP A;  1S1W B;  4HTI A;  5IWA F;  3CGI A;  4ZVF A;  1N5Y A;  3TQ1 A;  2GO8 A;  2HRY A;  3V4I B;  4CLF A;  3QOQ A;  3UD5 A;  2ZNZ A;  5IQ6 A;  3MPU B;  5KFL A;  3G6X A;  3HK2 A;  2HPU A;  4KT0 C;  4NZ7 A;  3R5D A;  4DSE A;  3DOM A;  2XLK A;  4F8R A;  2WZ1 A;  1N5Q A;  1MRO A;  5HLF A;  3G9C A;  2QA4 G;  4BLG A;  1VQS A;  2V2Q A;  4F4W A;  4MAK A;  5JVG Q;  4UW2 A;  4QQB A;  2UUT A;  4C11 B;  1UZD A;  2DGW A;  2RS2 A;  3M9M B;  3QBC A;  2LQB A;  4ID5 B;  2XCA A;  4LSN A;  1XNQ J;  2VQF F;  1RT7 B;  1AT1 B;  3L09 A;  3EGN A;  3CED A;  4LF9 J;  2BRL A;  3IRW P;  1Q1K A;  2QMU B;  2BJ9 A;  1RXO B;  3E8O A;  4LQ3 A;  2ZH8 A;  2HW3 A;  3HDS A;  1T9W A;  1E6V A;  2FIU A;  2DKO B;  3FQK A;  2DIT A;  2F3J A;  3KLG A;  1CJK B;  4RZR A;  2WHO A;  3K5N A;  1T9T A;  4IFY A;  3FC9 A;  4ECU A;  3BYP A;  4OZ3 A;  1NH8 A;  4JI2 J;  2K29 A;  2B9X A;  3OVS A;  2MQQ A;  1UA0 A;  3KK1 B;  4NX9 A;  4Y2A A;  1XMQ F;  4QCL A;  4OI4 A;  3QJP A;  1ZOT A;  2RRB A;  1OPZ A;  4H4M A;  2CUY A;  4X66 J;  3CSK A;  3HZG A;  4UUW A;  5CYJ A;  1S72 S;  2A18 A;  5L9X A;  1SB6 A;  2JC1 A;  2HHW A;  2MZ1 A;  2DNP A;  1ZTW A;  2IDL A;  1R7I A;  3ZFV A;  2EFN A;  2HQF A;  5A8W A;  3J80 U;  4J9R A;  4YB6 A;  3CD5 A;  3PCO B;  4DV3 J;  1S97 A;  1WJ9 A;  3KNA A;  4B3T F;  3M6U A;  1YK9 A;  1BLU A;  5BXI A;  1TU0 B;  1S77 D;  2X7I A;  1H73 A;  1KLM A;  4FF2 A;  1M5O C;  4DQP A;  5A8R A;  5CD4 H;  5IT9 Y;  2DGV A;  1U1Q A;  1W7W A;  1LV5 A;  4ELU A;  2C42 A;  2PA3 A;  1JWW A;  1M5V C;  2NUU G;  3PW4 A;  4WJB A;  1CQM A;  2Z58 B;  1P94 A;  1FXL A;  2OPR A;  4JI7 F;  2DYA A;  1L3S A;  3BS9 A;  5ETM A;  2DNN A;  1FFG B;  1RAE B;  4HYK A;  1FK9 A;  2V6A A;  3OXL A;  3LOU A;  4NRT A;  4AQY J;  1EAY C;  2EKY A;  5JXS A;  1U26 A;  2MKY A;  2VOP A;  3CC2 S;  2HFZ A;  3MED B;  5DDR C;  1Q8K A;  2A2C A;  1TUG B;  2DGS A;  4NI2 A;  3ZTP A;  1UPM B;  3LA0 A;  3BSO A;  2KU7 A;  4RPF A;  3TR5 A;  2HEK A;  4WIQ A;  1EP4 A;  2HZA A;  2G4B A;  5LMU J;  2UV8 A;  4IRC A;  1VBK A;  5K8O A;  2C2O B;  2WVE A;  3OL7 A;  2M52 A;  2IRU A;  5KOX A;  1HNX F;  2ADC A;  2OD4 A;  5J2P B;  4C3M A;  1KFS A;  1VQO S;  3TAM A;  1JKH A;  3FVY A;  1IN0 A;  1ZAW A;  1RYR A;  4LSZ B;  5D0E A;  1FT8 A;  2ZUG A;  3HHD A;  3K59 A;  4DPO A;  4R0J A;  2E29 A;  4ZVO B;  3PIO Q;  2FHM A;  2YNI A;  3ZTR A;  4QU7 A;  3D1H A;  2UUC J;  4IRK A;  2OML A;  3CD6 S;  1TL5 A;  1HHQ A;  1QE1 A;  2EFG A;  2P9G A;  2WSF C;  4WYL A;  3VAJ A;  1PC4 A;  2CNL B;  2XI2 A;  2FC8 A;  2GIF A;  2XYH B;  5LJ3 Y;  2WTF A;  4DPX A;  1IM6 A;  1IM4 A;  3IO1 A;  2FZK B;  3V81 A;  1FF2 A;  2VG7 B;  3MEE B;  4I7F B;  3IM9 A;  2F1F A;  4ECW A;  3MOJ B;  2B6A A;  4U9R A;  4E8U A;  4O4G B;  3KLH A;  2ZOG A;  4O23 A;  4C0B A;  3WIU A;  2KT3 A;  3CJR A;  2P9C A;  2YNF A;  4FVM A;  1TTH B;  2KXF A;  1Y9O A;  2HNZ B;  5HQL A;  2N4C A;  4EK2 A;  2DIS A;  4LBH A;  4NPO A;  5KFF A;  3IWL A;  1QVG R;  3FMT A;  1UCN A;  2GAH C;  2GJF A;  5HSP A;  4X64 F;  1DFD A;  2AHO B;  1DTQ B;  3FJ2 A;  1OYD A;  1RAC B;  4P9S A;  3AOC A;  2HSE B;  4DHV A;  2LVW A;  2AJ1 A;  3A4T A;  1VDH A;  4NCB A;  3DN9 A;  1PKU A;  3PM9 A;  1NDP A;  2M0G B;  2VA3 A;  3HHL D;  1GXT A;  2XWX A;  1JMT A;  4LRD A;  3ZZY A;  3L95 X;  2BAN A;  2OPP A;  1HIY A;  4PYA A;  3IS9 B;  3QZ7 A;  3PV8 A;  1FKP B;  3U27 A;  2HFV A;  4IR1 A;  2HBQ B;  2EBE A;  1Q16 B;  3G82 B;  4RW7 A;  4QWD A;  1RTD A;  3UQS A;  4DWI A;  1KLN A;  4OI0 A;  4U95 A;  1YRU A;  5EWF A;  3V4M A;  5HP1 A;  1VRU A;  3SIP B;  2B56 A;  3H4D A;  3TAR A;  3R7B B;  2DNY A;  3UVJ B;  4B02 A;  3H20 A;  4YUD A;  3D3B J;  3C15 B;  4RNN A;  4KFB A;  1WC0 A;  3P6Y C;  2ZJR Q;  1YJV A;  2DD8 S;  5C24 B;  3N6L A;  4K50 A;  5D4P A;  3O44 A;  1W2B R;  2RRA A;  1XR5 A;  3RBZ A;  4NLX A;  4QWE A;  4FXD A;  5G0R A;  4UQT A;  4A8X A;  4NL5 A;  4OYW A;  1MG7 A;  4NA2 A;  3QO9 A;  1DQA A;  4OHY A;  1JLB B;  1XMO F;  1LWE A;  4FF4 A;  1WF1 A;  4AT1 B;  3BGR A;  2CJX B;  5F9L A;  2DNG A;  4W4M A;  2VOD A;  3D6M B;  4F04 B;  1M5P C;  2RJZ A;  4BBY A;  5J2N A;  3ISN C;  2W24 A;  4C9D A;  2OJ3 A;  2ROE A;  1ZM2 A;  2PSZ A;  4GKJ J;  5CXT A;  2Z8Q A;  3HHL A;  4F0K A;  1SC6 A;  4LF4 J;  4C8O A;  1RCO B;  2W2N P;  3CPW R;  3V4I A;  4CM2 A;  2XWY A;  1XER A;  2KZZ A;  4MIW A;  4CH1 A;  3F73 A;  1KP6 A;  4ECY A;  5T7L A;  2HMI B;  3HX9 A;  2PMZ D;  3ETM A;  5DZ6 A;  2E9R X;  4DV5 F;  2W9B B;  2E7W A;  1IBC B;  3HLU A;  3MEG A;  2FJX A;  1YRT A;  2LEC A;  2XSJ A;  4OMF G;  2R7S A;  2UP1 A;  2YWW A;  5B0B A;  1LW2 B;  4JOU A;  3D3C J;  4K4Z A;  4NXM J;  2BX6 A;  3H25 A;  2H3E B;  1BD6 A;  3TZY A;  3BO4 A;  2XMW A;  1HLW A;  2YKA A;  1F3F A;  3RGI A;  3HVR A;  1OSD A;  2GQQ A;  4CLY A;  1RWW B;  1U9P A;  3I87 A;  4WCE Q;  5KFW A;  3N0V A;  2UXC J;  3KG1 A;  2POK A;  4JP8 A;  3SCL E;  3PJX A;  4OHW A;  4O0I A;  1UKU A;  3LAN A;  1NDL A;  2SXL A;  1QSY A;  1VIX A;  2MQO A;  4B9V A;  4IOA Q;  2Y3Y A;  2XEX A;  2VIH A;  1CC7 A;  1MN7 A;  1I51 B;  2J0W A;  4ZIV A;  1P8G A;  2Z2Z A;  1K73 T;  4K8R A;  4RBV A;  2HS4 A;  3QT7 A;  4WTO B;  2XHW A;  3GPA A;  3NGK A;  1HKA A;  1XEZ A;  5IM0 A;  1JXL A;  3R2D J;  3B6B A;  1HNX J;  1M5H A;  2DNR A;  1JLQ A;  4ETX A;  2YNG B;  2HQG A;  4WFZ A;  2PFD A;  3NKY A;  3CNQ P;  3DYA B;  1U8W A;  1HYS B;  4Q8E A;  2DBB A;  1WKJ A;  3KJF B;  5ETS A;  3FQL A;  4Y0F A;  2DRB A;  1ZM3 A;  5CYQ A;  4JBC A;  2C28 A;  1VYA A;  5C42 A;  1N32 J;  3MPD A;  1IXK A;  1HQE B;  2BA3 A;  2GV1 A;  1S6P A;  4NLS A;  3GFZ A;  3PNI A;  4J9M A;  2ZD1 B;  3CJT A;  2DK2 A;  2LQJ A;  3CCM S;  2J9D E;  2R8H A;  4YOE A;  1BXN A;  3OTC A;  2NR0 A;  1KQK A;  5C2C A;  2V63 A;  2C2N A;  3ULH A;  3D0G E;  4K5R A;  4CP5 A;  4I64 A;  1RT4 A;  2EFO A;  1U0H B;  1XN9 A;  4LSL A;  1BDT A;  4ED8 A;  9ATC B;  2B7B B;  2QV6 A;  2AJ0 A;  1VRQ C;  2B7C B;  1LQ9 A;  4HH1 A;  5AXM A;  3CD0 A;  1Y0H A;  2ZOM A;  3CDB A;  3UD4 P;  2IC3 A;  1ZH5 A;  4HHJ A;  4C8Y A;  2VFR A;  3W9I A;  1H2T Z;  2IVM A;  2YWH A;  2KM8 C;  2DRA A;  4MKB A;  1HHT P;  4UY8 T;  2VH7 A;  4PAA A;  1IBM F;  3D4J A;  1N52 B;  2DY1 A;  3BQ2 A;  5KFV A;  3HT3 A;  3M8Q B;  2BA9 A;  4H54 A;  2C1E B;  4CWB A;  4ZS6 A;  3KLF B;  2H48 B;  1C1C B;  4KPY A;  1F9F A;  2FVC A;  4AD6 A;  1ZZN A;  2R8K A;  2RF2 A;  5EDW A;  4DSK A;  1RBL A;  1WHW A;  3R6L B;  1RWK B;  4OJH A;  3VEB A;  2BKN A;  4ZPB A;  2BV3 A;  1Z2Z A;  1I6J A;  3GG1 A;  2ACY A;  1TL7 A;  3M32 B;  5BYQ A;  1T11 A;  2PGC A;  3PFO A;  2XY7 A;  4U8V A;  1YIJ S;  2HS0 A;  2OSR A;  4DL2 A;  1TL3 B;  2OPS A;  2KYZ A;  3IA0 A;  4QR2 A;  4OIX A;  5AXK A;  4M8L A;  2EG2 A;  2OEM A;  4W92 B;  3PW5 A;  4DV7 J;  2VF3 A;  1FE4 A;  4LRB A;  3H5U A;  2OH2 A;  1FJC A;  1YIT S;  2MZR A;  1CPZ A;  1M5K C;  2FJB B;  3D67 A;  2VG6 B;  3M8P B;  5D3G B;  2ZBP A;  4DPT A; 
#chains in the Genus database with same CATH homology
 2K9I A;  3BKU A;  1BAZ A;  4HV0 A;  4FXE A;  4ME7 E;  2BSQ E;  1U9P A;  2H1O E;  2F1F A;  2BJ8 A;  2K5J A;  2BA3 A;  2CA9 A;  2BNW A;  3PHT A;  2BJ3 A;  2CAJ A;  2HZA A;  1BDV A;  1ARR A;  3H87 C;  1MNT A;  2BJ9 A;  2WVE A;  1Q5Y A;  3QSI A;  2HZV A;  3BKF A;  3VW4 A;  2CPG A;  1MYL A;  2WVD A;  2K1O A;  2Y3Y A;  3VEB A;  2BJ1 A;  1MYK A;  2BNZ A;  3OD2 A;  2JXI A;  2JXH A;  1IRQ A;  3FMT A;  2NZC A;  2AY0 A;  2CAX A;  2KEL A;  1NLA A;  1BDT A;  3BKT A;  3VEA A;  2WVC A;  1EA4 A;  2BJ7 A;  3GXQ A;  3QOQ A;  2RBF A;  2GPE A;  1P94 A;  1PAR A;  1B28 A;  1X93 A;  2WVB A;  2PC6 A;  2K29 A;  3LGH A;  1B01 A;  2JXG A;  1QTG A;  1Q5V A;  4D8J A;  2CAD A;  1ARQ A;  2K6L A;  2FGC A;  3FT7 A;  2WVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...