2WVBA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
130
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTAIAMDEHNSLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 36
structure length 130
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvbA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvbA02
3VEBA 2GPEA 1Q5VA 3QOQA 2K5JA 2JXIA 2FGCA 2K6LA 2BJ7A 2F1FA 1BAZA 1MYKA 2HZAA 3LGHA 1MNTA 2BNWA 3GXQA 2CPGA 1ARRA 1QTGA 3BKUA 3H87C 2HZVA 2CADA 2CAJA 1EA4A 3PHTA 2BA3A 4FXEA 3QSIA 2KELA 2Y3YA 1ARQA 1B28A 2WVFA 1BDTA 3FMTA 1PARA 2BJ1A 2BSQE 3BKFA 1NLAA 3BKTA 2K9IA 4D8JA 2WVBA 4ME7E 3VEAA 2AY0A 2CAXA 3VW4A 1X93A 2CA9A 1P94A 1U9PA 2JXHA 1MYLA 1BDVA 2BJ9A 2BNZA 2NZCA 4HV0A 2WVEA 2BJ3A 2H1OE 2RBFA 2BJ8A 3OD2A 1Q5YA 2K29A 2WVDA 2PC6A 2WVCA 2JXGA 1B01A 3FT7A 2K1OA 1IRQA
chains in the Genus database with same CATH superfamily
4N5SA 3AJ2A 3MPYA 2R3VA 4NCGB 1H73A 3TA0A 3QAUA 2RKIA 2NLWA 5ETLA 3LGHA 5CYQA 4FF2A 2K1RB 2JZ5A 2J9CA 2FVCA 4DXLA 2X3DA 1VQ6S 1TUGB 5F41A 3FGVA 4OL8A 2BX6A 4B9VA 1SB6A 4J7CA 2JEIA 3C14A 5IT0A 5HATA 3HVTB 3MMAB 4Y2CA 4RNFA 3EUNA 2HHSA 1ZZNA 4IFYB 1OY6A 2AGOA 3S1TA 2ZDOA 4U95A 4FXDA 5HBMB 2GIFA 4F3MA 2EBGA 5LMNF 4X4PA 1ZM2A 5L1IA 1HQUA 2XEXA 2YWWA 4ID8A 1KVKA 1HWKA 2ZBQA 2RNEA 1B0VA 2AZ1A 2XSJA 5H9FJ 1NJZA 3MURP 1KN6A 1TL1B 4DL4A 2EFNA 2NUHA 2R8HA 4C8OA 3LAKA 2AZ3A 2M9KA 1HBOA 1RISA 3KDOA 2XSJB 3SDEA 4KH1B 2OGUA 4O3SA 4F0KA 1HMVB 3G6XA 5F0UA 5HN0A 4LT6A 3SCLE 4F0HA 4DUYJ 3JS9A 4M5NA 3I87A 3M6VA 4X4UA 3M2VA 5E2QA 2HHPA 5E3CA 3U7JA 2K7KA 2R7SA 2MLYA 4DSEA 2V2VA 3IWXA 5KFNA 4YR0A 2O5DA 4BLGA 1SKSA 4P52A 5CCMA 4GVBB 2H65B 4DR1J 2C2DA 2QZ8A 1IBLJ 4HHHA 3GFZA 5IZHA 2I5JA 1VQNS 3L7UA 5D4OA 4RU2A 4G1IA 1AXQA 2OPPB 1N88A 2UVUA 2ZWPA 4CZCA 2HK2A 4ZCIA 1Q79A 5DGBA 4YY3J 4DUZJ 3H25A 4QWCA 2DXEA 4S0MA 2O3DA 1K8AT 3ONQA 4G1PA 5IV4A 7FD1A 4F0MA 2CJ9A 3CB4A 4MK9A 1RKIA 3PFEA 2W8LA 1F9EB 1RDRA 1FE0A 5L8RC 2KZMA 1ARRA 2YPZA 2VBYA 3CJQA 1NDCA 1CULB 1PGZA 3N5FA 4RR5A 1WF2A 2MKCA 3HX9A 4DX7A 1S0VA 4F8RA 4UY85 1FWKA 1WSRA 1U45A 4WYLA 4F2SA 2WBMA 5E3RA 1VFJA 1Q7YT 3SCIE 3MAHA 1DURA 1ZAVA 1ZETA 4EZ9A 1OYEA 4W90B 5DM6Q 4DG1A 3CWJA 4L3NA 3I6PA 2D7SA 5KFZA 4KFBA 2IRYA 3KNGA 1LK5A 2WVDA 3TZYA 1AT1B 4DU7A 3Q2SC 1UFLA 4FPRA 4WFXA 4KFBB 4USUA 2G13A 2CQBA 3H40A 2F63A 3WC2A 1QTMA 2DXFA 1RT6A 1MNTA 5B09A 3EGWB 3US5A 3GR0A 2ZWOA 4YMEA 2CJBA 4DV5F 2Z2YB 3C19A 1RT6B 4Z7CA 3HKZD 4LMZA 4X66F 3CIZA 3M6WA 1BY9A 9RUBA 5DQIA 3BB5A 2QMUB 3ICLA 3HZEA 1QAIA 4ZITA 3ILOA 1VRTA 1X9WA 4PWDA 2UXDF 1RGVA 3MOZA 1LK7A 2AYBA 5L1JA 4ECWA 3O44A 2L08A 2LECA 4O44B 1RUSA 1IBKF 1VGYA 2I38A 1X5TA 4PWDB 3BN7A 3DLEA 3DMJA 5A6WA 2HQCA 2FJVA 2BE2B 1WHWA 4C3KA 4YR3A 5GMKa 2PMZD 1XMQF 1SC6A 3IRXB 2HK3A 2AJ4A 3RAXA 2WK4A 4OX9J 1HYSA 2VDHA 2KJWA 3VAHA 3TOQA 2OI2A 3T1AA 1R0AB 4FPIA 3MD3A 2R8GA 2R2RA 4USIA 1WNEA 1HYSB 1EZZB 2FVRA 5KFLA 2CJKA 3V6HA 1AROP 2MYFA 1WKKA 1C1BB 5E3QA 1GMWD 4PG6A 2JJ4D 4TY9A 3R2CJ 2CZ4A 3W1YC 1NO8A 2UXCF 2HFSA 3IN5A 1IBMF 1RSCA 2HRTA 1VOMA 2OLWA 1S79A 5D0HA 3DOMA 4LF6J 3SQGA 3CSKA 3FSXA 3R5JB 2YNGA 3MEGA 5D0EA 2V2ZA 2FC8A 5M2RA 4U7CA 5GADU 3HFKA 2C2EA 1FRIA 5F8IA 3M8QA 2MQLA 1N0VC 1BWVA 3DRPA 4PQUB 1N5YA 1OY8A 1UFKA 2DGQA 4LR9A 3KLEA 5GAEU 1Y4ZB 2VOOA 1Q1KA 2JC1A 3CO9A 3M8QB 1M1KT 3C6UB 4EZ6A 4Y65A 4FYDA 3MM5A 5IT4A 2GAHC 2B5JA 3TI0A 2WB1D 3R8YA 1CBKA 3M8RA 1JK9B 1NSAA 3TUJC 3VVUA 1G3OA 3SXLA 5GMEA 3QGHA 4R5PA 2PN6A 2LEBA 2B5JB 4UOHA 2DJWA 2IM0A 3K57A 4TY8A 1QSLA 1YI2S 2IMWP 4X4VA 1FVSA 1X0FA 4F50A 1K0TA 2MQ8A 3CJRA 2L41A 4ZVGA 2DCLA 5LMUJ 5G4DA 2AIRB 1G4CA 4YQWA 4USMA 1MWQA 1S10A 1BDTA 4F4AA 1PARA 4BBYA 1Y3JA 1YQHA 3TX8A 2PFDA 4JP8A 4OYBA 3U1MA 3CIMA 3ZTPA 1N32F 2NSBA 2ERRA 1AFIA 4F4WA 2QT7A 1SJ1A 4ATNA 4EK2A 4ZVTB 1U02A 1H2VZ 2QLBB 2FLLA 4DV0J 4JI7J 4LRFA 4DV2F 1EARA 4F26A 4MIWA 4B17A 3W9JA 4LFCJ 3NXZA 2CUYA 4MKYA 1D09B 1NHKL 3MR7A 3M6UA 1T02A 4XPCA 4PXCA 1NZ8A 3MCSA 2HS3A 1H7XA 5A8KA 1IM6A 3DOKB 1RTJA 2CRLA 1OG7A 5SUHA 4B9TA 3S6EA 5K8OA 3LALA 4WE1A 1VBYA 1FKOB 2E5IA 4O3PA 1N6QB 5DG8A 2DNQA 2O1PA 4USHA 2HLUA 2ZEJA 5AJ3J 4QIFA 1B64A 4B3SJ 2DR8A 4WE1B 1PSDA 3DRXA 3GMGA 4WBFA 4ZN1A 3P96A 2KHCA 3TAMA 4DX6A 3MR3A 1HD0A 2XLJA 1D3WA 1HARA 1RB0A 4FZVA 2QSWA 2BM0A 2GVDB 4KC5A 2HVZA 3V6JA 1GXUA 3EDQB 4J9UE 1AW0A 3TAMB 3JQJA 4IFVB 4LREA 4K4VA 2XZDB 4RUCA 3P4UB 2ADBA 4RZRA 1S9GA 2V8GA 4QYZK 3W66A 1P8GA 5I3UA 2IBKA 3KJVB 3ENWA 4I4BA 2PFFB 4RU9A 4F25A 1F3FA 3K8WA 3CW2C 5IXUA 4DS4A 1S9GB 1XNQJ 3KJQB 5BYQA 2QLFB 1UJ6A 2LP4A 3R5DA 4LVOP 2J8SA 3ET6A 2MZJA 4W98A 3HFZB 4QIEA 2GV1A 3TJAA 1VQ8S 1NB2A 2HRYA 1ZBTA 3JB9k 2C28A 3IR5B 2B9EA 1S76D 3OXLA 1AUDA 1RAFB 1LEOA 3ET6B 5A8RB 2DNYA 5KT3A 2DVIA 3DM2A 4AD6A 1WEYA 3PKYA 3UQSA 1R8AA 2VASA 5FJ4A 1N36J 2HAFA 1DARA 1KSPA 2HBQB 3T3FA 2VQFJ 2WVFA 3W2VA 3CPWR 3DM2B 4PPDA 2QYCA 3IR7A 4OFZA 1LWCA 2EFVA 4QZVB 1RWKB 4ZJQA 2IAJA 2CPFA 2Y1RI 3W5XA 1VLOA 4DPWA 1RTDA 5E33A 4OZNA 3W64A 2XQCA 1VS3A 6AT1B 4CRJA 4ZLPA 2IAJB 2C3MA 1I94F 5DETA 1HNIB 2HQIA 1AZSA 2J6SA 1OPIA 1BQXA 1UWBA 3KFWX 3E51A 4ZVSB 3W9HA 3H2UB 5ETRA 1JLAA 3MECA 3BH6B 4EO6A 2E7XA 3EPIA 1FRMA 1GFWB 2G0CA 2DEIA 1WI8A 1EQMA 1RQ0A 4YEAA 2HNZB 2ZVIA 1RA6A 1VQPS 2M8HA 1KOOA 4YB6A 3QWUA 2V0NA 4HVZA 1FJGF 4P7TA 1X4HA 3VAGA 2GVZB 4DI6A 1F1BB 4RBVA 1TV6B 1T8EA 1X4DA 1KDNA 2RH3A 2J9DE 3Q23A 2DO0A 4DPTA 1D9FA 2ZD1B 2MKHA 1Y3KA 8AT1B 3CVKA 3AB4B 5DZ6A 1FESA 1S99A 4DR7F 1V5IB 2V63A 2ZE2B 2HNDA 3C8YA 5T41A 3R97A 1NK6A 4MKBA 1UJ4A 2YNIB 3SI8A 3BSAA 2F7VA 3ZNUA 2HNDB 4MYTA 4JI0J 1OQ6A 2DRDA 3VGUA 2N3OA 2DGTA 2HVDA 3NAIA 1F5CA 2KT3A 2LQ8A 1NCLA 1VC5A 2UUTA 2VBZA 1PJ6A 4NYPA 3I32A 3BZQA 2OPQA 4NLDA 3FCHA 3OSPA 2DHGA 1CG2A 2OMOA 4UY8T 1RWUA 1RLDA 2BQ3A 4UZBA 3FZBA 4OX7A 1HPZA 1S0OA 2OPQB 4HTJA 1IBCB 1IWAA 3V4IB 3JTNA 1ZH5A 4J9SA 2PMWA 1LXJA 2VFTA 1DBDA 1L3VA 3POTB 3HSGA 1MN9A 4LFBJ 3DLJA 1HPZB 2YH0A 3KUHA 2LFVA 2ZFHA 2F9DA 2E1AA 1S57A 3CNQP 3UN3A 2DR9A 1K1SA 2JXHA 2YNHA 5HROA 1YJ7A 1NEEA 1UP1A 1HWLA 2W4CA 3D54A 3C15B 2HIQA 3KUEA 4UUWA 3GCWP 2YWKA 2IJRA 3CULA 2XCPA 4LSLA 3M2RA 3HSZA 1RYSA 1Y0HA 2NPIA 4DSLA 4QR0A 4DR6F 3GV7B 2K6LA 4ZMMA 3D0HE 1MYKA 4JB8B 5CZVA 1EETB 1DTTA 5D4PA 3RU0A 3ZZUA 4DUYF 1UZDA 2BMBA 5E41A 2UUWA 2XZWA 5DQHA 4MAKA 4M8LA 2LMIA 2VG6B 4YHHJ 2C42A 2HHUA 4WTYA 3PZPA 2BANA 1XJWB 1B3TA 4J9QA 1UMJA 4DR1F 3SZ2A 1QUPA 2HHHJ 3HKWA 2AHOB 1IBLF 5KG4A 2BANB 4OZ5A 4DFKA 4OHXA 4V19J 2C2ZB 2W2MP 2XYHB 4C4WA 4C0OC 2DCUB 1JXLA 4DUZF 5F3ZA 4IG0A 3ILIA 7FDRA 3LPEA 1MLAA 3W61A 1LKZA 3MZIA 4CLSA 1WD6A 3H4BA 1HR0F 4JBCA 2YXLA 2FHOB 1FD2A 5D78A 3A3PB 4IG0B 2F8MA 2F4VJ 1WACA 2IM2A 4I7FA 1EB0A 2D74B 1PO6A 4ECVA 1S6PA 4H4MA 4C8ZA 1UA1A 1HL6A 2IC3A 4I7FB 4TN2A 1U1OA 1X5OA 2DNGA 2LQ5A 3MI7X 4H4MB 1VBZA 2BACA 2IC3B 1Y5NB 5A76A 2XNRA 3ISND 1T3NA 4JV2A 1N5VA 5DDQC 1Q78A 1TTHB 3IG1B 3W7BA 3TZZA 5J2PA 5D0RA 2XO6A 3QPIA 2QYGA 3GJQB 3GFXA 1FK9A 2D69A 3D6FB 5E5NA 1YJ9S 2M2BA 2JVRA 4LQ9A 4C98A 2KDOA 3I55S 5J2PB 3QJLA 3H42A 4RUBA 2VG7A 1FK9B 3TVYA 1WSVA 3FUYA 3FEZA 4LRBA 4PXEA 4CM2A 1VDHA 5IC6B 1WDDA 4ZPTR 5KFRA 4DV3J 4BDPA 4A8KA 3VAFA 5IT9Y 2OSQA 2POKA 4V19X 1U7LA 2MXYA 2ZH1A 3M05A 5EHHA 3MD1A 1IR1A 3FMBA 1FTRA 3CJKB 1XQIA 2VPXB 1Q4RA 4L75A 2MQOA 1ROFA 2WVBA 5AE2A 1FEEA 3R7BB 2JEGA 5T7LB 4CT8A 3J7A1 3TJ8A 1H6KX 3K0JA 3I96A 2E5JA 4ENOA 2AEJA 1XIQA 4V1Ak 4WU3A 3W65A 2V68A 2MHNA 1BE4A 1RAGB 2RF2A 3FEYB 4E8UA 4OX9F 3QZ7A 5I3QA 2MQPA 2IRUA 1NPKA 1RAIB 1X5SA 2GC8A 4LRAA 3ZTQA 2HKEA 1OO0B 4TYBA 2OH2A 1M1HA 2F65A 2CVEA 2V4QA 3TP2A 2DEJA 3OR1A 2IRXA 2Y8YA 2V2QA 1IKVA 2VH7A 4L74A 4QU7A 3OR1B 1ZM4A 1RT4A 2MQNA 4LF6F 2X1GA 5F9NA 4LBIA 2ZH8A 4N77A 4N41A 4NLQA 1ZYQA 3C46A 4HACA 5K8NA 2ACYA 1KQSR 3W8GA 1S77D 1HD1A 1IQZA 1GMVA 4AL6A 4YB5A 3TR5A 3QRQA 2JLGA 1YBAA 2ZH9A 5LSRA 4HACB 3VQTA 1NK9A 3CO0P 1S6OA 2LDIA 3B8HA 1S12A 3GB0A 4DN0A 3BPDA 2AX0A 3DLKB 2XHCA 2E1PA 4I64A 4X4QA 1YIJS 3CD7A 1FCAA 4CLTA 2RILA 4CP5A 5F8LA 4IG3B 1TL4A 3UO0A 1V3ZA 1S9EA 1B01A 1M5SA 4ZVFA 1KLMA 1TR0A 1SPBP 4E2FB 2DKOB 5IOLA 4ZCLA 4FF4A 2IIHA 2MZTA 2MY7A 1TUVA 1XNRJ 4HDGA 2IVYA 1KLMB 3EZOA 1OIAA 4Y3CA 4URGA 3V6DA 2FY1A 2B6AB 5LMUF 3AOAA 4EYIB 4LRCA 3HXMA 3RGIA 3M7VA 2KELA 3HF5A 1R27B 5FDLA 1R43A 3Q8SB 4QWEA 3H59A 4GKJJ 4RW7A 3ZO7A 2ROGA 3BPSP 4RLEA 1QSYA 1WDTA 2FVPA 1SUQA 3CCQS 3V81B 4RWXA 1IR0A 3W8PA 1H38A 2R7UA 3QGIA 4JI7F 3CDUA 2IDEA 4YFUA 2GX8A 1SUQB 2VQEJ 1T03A 4NPOA 1VRUB 2DNNA 3CTRA 4LFCF 1S1XA 4KHRA 3IS9A 1A0OB 1UVMA 2HBRB 4WFYA 1UTAA 1FRXA 2FVSA 3NAHA 2RQKA 1T03B 3ENAA 4ZLJA 4NLSA 2XGPA 1KHWA 2BUNA 2VFVA 4CYUB 5HJXA 4NI2A 2QLXA 1S1XB 3E3XA 5L1KA 2CQCA 2AQ4A 2OELA 3AFGA 4RW9A 4ZCMA 4PABA 3PIOQ 4F4YA 3LW5C 1WC6A 3LGMA 1OSCA 3HHDA 5AJ3F 1U1MA 4LQ3A 1VQKS 3D1OA 4B3SF 1FVQA 1NH7A 5LXRA 2F8HA 4RBTA 3V2UC 2JBVA 2I6WA 1UEUA 4DEZA 1P9QC 3PW2A 2EPIA 2YKNA 1RT5A 2FHJD 4ME7E 2K7JA 1DZ5A 2OPSB 3AJDA 4CT9A 1GTHA 1J5EJ 1RT5B 2UU9F 1KFDA 2WB4A 3PEJA 3QIDA 2F8EX 1R8CA 1YJNS 1TL7B 2PO4A 1MSWD 3AXKA 3H0PA 1CJKB 3PYGA 1RWVB 4JI4J 2CDQA 4O3QA 4B9NA 3WIUA 1HIYA 3OTOF 3BSCA 1MROB 3MEEB 5DJBA 5JUMA 1IM4A 3N79A 2B9YA 2GHVC 1BLUA 5K14A 3VGVA 2P9EA 3BGUA 2HLTA 2FGOA 2M0GB 2X3GA 3OJSA 4X4SA 2FZKB 1N36F 4HEA9 4ZS6A 4ES1A 4P73A 3DN9A 2VQFF 3WZ0A 4ECYA 5K14B 1TK8A 3K5MA 3M8ZA 4ZHRB 2NXEA 2CQIA 2XMMA 1V5VA 1DHMA 4K2XA 5B0GA 2VC1A 4Y34A 2XZTB 3JSBA 3ZNJ1 4XTTA 2L9NA 3DOLB 5C42B 4IO9Q 2PIIA 2FJBB 4URSA 4CLLA 4Q8FA 4PAAA 1RU1A 1RHRB 2ZM6J 1UEKA 2KRBA 4ECZA 1YRTA 3BN4A 2YKOA 1XBWA 4DF4A 2IM3A 3HZGA 3MPWA 4RW6A 2MJNA 3G86A 2CZVC 2C3UA 4ZVHA 3HM9A 4A8XA 3W2WA 2LA6A 5EWFA 4RW6B 2BJEA 1T9UA 1FHTA 3QSYB 4IQMA 1S1WB 2W2OP 1VIOA 1W25A 4B08A 4ZPBA 3W2WB 4G6VB 3R1LA 3FRZA 2WBRA 2QA2A 1JX4A 4M5LA 1FKPA 5J2NA 2YBVA 3KJNB 1TKDA 1B7YB 3NNAA 2K8GA 2KVIA 2E9TA 2KL8A 4Q8EA 2HNYA 7AT1B 3BO3A 3GV8B 3VEAA 2LU2A 1RT7A 3CCTA 3TVKA 2W9BA 2B9WA 4P2MA 2B8PA 3GYXB 4O4RA 1I51B 5ADZA 2MJUA 2OHDA 4ZVOB 4OJ3A 2N4CA 4Y2IA 4DMZA 4KH0B 1KQFB 4HI2A 3PX6A 5ETSA 2V69A 3ETMA 1U1QA 5KFJA 3UVJA 4KBIA 3NP5A 5IWAJ 2Y1JA 1ZS6A 5E3PA 2GGPA 3HHLC 4RNMA 3O5TB 1SIZA 4J9PA 2J0XA 4OHZA 5IS2A 5GAHI 3R1HA 4ALZA 4KPYA 3D3CJ 3EPGA 3SSRA 3N0VA 2ADCA 1UFWA 2XNQA 1RTIA 3NGUA 1R89A 2GGPB 1NKEA 1RK8A 1TKZA 4I2PB 4FXVA 3ELHA 4EI2A 1VQ5S 3PW0A 1C0UA 1MMDA 3ULHA 3PRBA 1QTNB 1NMEB 1RABB 4QBUA 1RCXB 4DS5A 5ETQA 2MB0B 5GAGI 3RAMA 4USJC 5KFCA 3NNEA 1VRQC 3PIPQ 3GILA 3EDRB 3SCJE 1R7IA 2ZZMA 5KFVA 1G6BA 5AE3A 1FDNA 1D1UA 4MMOA 4AUKA 3R6GB 2Q66A 4E98A 3TEGA 3MPUB 1C4AA 1CJUA 3OLAA 1HWIA 3NG8A 3RG6A 4NLVA 5IT9U 3EVWA 1H74A 1IKXB 5HVGA 1RP5A 4FS1A 1FDDA 2V6AA 2M4MA 3F0NA 1QD1A 3MEDA 2G1DA 2R2TA 2W9CA 2RMLA 2FHMA 3MMBA 1HA1A 2KZZA 3Q8UA 1CEZA 3MEDB 4NX9A 4QR1A 3JAMY 3ISNC 2J7KA 3LF0A 1CJTB 1HBUA 5HP1A 3U27A 2ASDA 3BO2A 2QIFA 3Q83A 2R8JA 3FZ2A 4A48A 2QJ3A 3DLGA 4ECXA 5KFIA 3PW5A 2XMTA 4OZLA 1YZ6A 3RJMB 1V3SA 4YHHF 2N82B 2VBWA 1X7VA 1URRA 3DLGB 4PXBA 4JI6J 4X65J 4NLXA 1VBKA 4NMXA 2HHHF 5AE1A 2Z2MA 3BO4A 1JLFB 4EBEA 2CAXA 3OHBA 4PG4A 3GYNA 1JJCB 3LOUA 1U48A 2LU1A 1URNA 5K5MA 1L3SA 3J7Z5 4F02A 4WZMA 2MKSA 1SV5A 1EKRA 4KTQA 3MOJB 1UVJA 2GQQA 1VR6A 5BJRA 5DLFA 1JJ2R 2MKJA 4FDFA 2F4VF 3M8YA 4LIWA 4OHWA 4IYQA 2KT2A 4DJBA 5LT5A 1XC9A 4X2BA 2HSEB 4RNHA 1PILA 4OI0A 4ZOSA 4DL0C 3BBFA 4JI8J 2DGWA 3BKUA 4HH1A 3CCES 3WHIA 2ASYA 2VOPA 3D7SB 4DBQA 3MTJA 3D6MB 1D9AA 3UWTA 1TP7A 3FCVA 2BE7D 4DSKA 2NZ4A 1B0PA 1VQLS 3NKYA 2NREA 4ICLA 4EWTA 4F04B 1S7HA 3LGNA 2JLFA 3BREA 2GCFA 2ZNYA 2V4JA 2RU9A 3OTDA 3H2VE 4DU8A 4WP9A 3HVAA 3VALA 2HQGA 1GX6A 1NJIT 3KK1A 2V4JB 4ETZA 2BKNA 3TX0A 1NBEB 3OTEA 1BC6A 4L72B 3A3OB 5KTQA 1AUSL 4KE5A 5ITHA 1YITS 3QO9A 1YWXA 3M2UA 4H54A 3QLHA 4DV3F 3G71S 3UCUP 1SKWA 1JLQB 2YQ0A 4DV5J 2HIYA 4NLTA 3R27A 4I68A 4A8SA 5JJBA 2P2CB 3EXYA 1FXRA 2C2NA 2XYPB 1SIWA 2B56A 5J2QA 1SJRA 3RBZA 5B7WA 1CQNA 3E8OA 5CYMA 2GJFA 1W26A 2J7UA 4CCHA 2OEMA 4K0KF 2ZHOA 3JSMB 5J2QB 5CABA 2R7OA 2VL1A 3RRHA 1PC5A 2MZSA 1U2RA 5HMZA 3QJJA 3UE2A 2HHQA 3MMCB 2GHPA 1CC8A 3RUBL 2QL7B 4WPAA 4DX8H 5KG5A 2E7WA 2X1BA 4WCEQ 3HHLA 2K1OA 1GMUA 2P5VA 2EC0A 2VDIA 4KV8B 2BRKA 4HI1A 4OZ1A 3PEHA 4ED0A 1U24A 3I5BA 3GYGA 4P75A 4ECUA 3I82A 3K5LA 2NS1B 3HHLB 3SYZA 2LVWA 4Y2MA 2WCXA 2J7WA 3AAWB 2OSRA 1PAEX 5A0YA 1H2TZ 3M8PA 2FLOA 2WZ1A 3A8EA 2ROEA 4L3KA 4RW8A 1S1TA 2BA3A 2G0JA 1TFYA 4HL9A 1TK0A 3OFGA 3N5BA 3DRYA 1YZ7A 1TMJA 3VV2B 3MM8A 1JNRB 4XAKA 2CWKA 3X1LB 2QC3A 2EFOA 2H4WB 1S1TB 1NLKL 1RLCL 3BV8A 4CH1A 1WOPA 1X93A 2G0IA 1EP4B 1NDPA 1BHNA 1DTQA 4KGVB 2Q3PA 3OR2B 1FDAA 5DGAA 2CJXB 2BEFA 1E6VA 2W7AA 1JXVA 5B0CA 4K4YA 3H5XA 1PAUB 2KTQA 1RA7A 3AB2B 1UETA 1R0BG 4X84A 2OFGX 2WSCC 4TU9A 3M32A 3PR4A 4FYVB 4OV1A 1R8BA 2E9ZA 3PACA 1FWPA 2K3IA 4NCBA 3OV7A 1XNRF 2CNKB 3DRSA 2VHGA 5C24A 2KI2A 2ZH6A 3KLGA 2RT3A 5B0FA 2VA2A 4QWDA 2MMYA 1UVNA 3I0RA 2W24A 1TKXB 2MLXA 4OI1A 2M3DA 4ED2A 2E66A 1UVIA 4GKJF 4KGZB 3QRPA 2GIQA 1N32J 2YH1A 2G1HA 4J9KA 3VAJA 3GPAA 4NLUA 2YKMB 2DBBA 3FNNA 2VQEF 2FIUA 1PYTA 1T05A 2YX7A 1DQ9A 1DFDA 4CLZA 1SJ4P 3CJ3A 3CC4S 1FEHA 3MCMA 2BDPA 1YX2A 1H0HB 2BZ2A 3NEKA 3PJXA 3G8TA 2CJAA 3GONA 5KFOA 1O8BA 2X1FA 1IQTA 4CO2A 2FB0A 2VUGA 4HHUA 1AFJA 2EW9A 2OUGA 4FP9A 4WF9Q 2AV5A 1LW2B 5AXLA 3IAM9 4QIVA 1NKBA 5LJ3Y 2FTRA 3QT5A 5HK4A 4NLYA 2Z0GA 4NLGA 2W7OA 3FMTA 1VHIA 4LR7A 5L46A 1KEKA 1JB0C 1R31A 1WEXA 5B0AA 2H54B 3GLJA 2V9WA 1J5EF 2B4PA 4A46A 2HURA 3PNIA 4K5SA 2R2SA 2EEYA 1CC7A 1NK8A 3T6BA 1RHJB 1WELA 1N5TA 3HDSA 2CQ2A 4PG8A 2CJQA 4YDXA 2ZBCA 4YB1P 3NS6A 2Q6CA 1I6JA 1A6LA 3MM7A 4P7VA 4IDKB 4DHVA 2Q2KA 5KT4A 2JX2A 4U6PA 2YWHA 2XBPA 2BJ7A 3EGVA 1JQGA 4ZPCA 4QPTA 1NH8A 2A0FB 3HD2A 2C2MB 3OVSA 4MIAA 5IV3A 3DHXA 4A8WA 3ZZZA 2QLWA 1NHVA 3FKBA 3ZTSA 4KKOB 4LSNA 2AGQA 5J1EB 3FJ2A 1YJUA 4UUXA 4OMFG 1D8YA 2M5YA 4NEYA 1YJWS 4IOCQ 4OYOA 4EGLA 2M52A 4NLRA 3JAMU 2C22A 3OVAA 4DQSA 3BKTA 1N54B 4HR2A 4C11A 4J9RA 4BC7A 2ZM6F 2HWIA 3IP0A 3TA2A 5KT2A 4DQQA 2V67A 2OIHA 4F2RA 3GIKA 2HMIB 3F41A 4ZPVR 1KWMA 4DR5F 2XGQA 2PDAA 4A47A 2J6TA 2A2BA 5KG7A 4ECTA 3MR6A 2HPUA 4RWWA 2Z4PA 3DC2A 3IO1A 2EFPA 2U2FA 5A6PA 1QY7A 2FGCA 1FJGJ 1AYEA 2BBEA 1B99A 4B3TJ 2EKNA 3KMSA 1S7IA 1LFWA 2DNMA 2CPIA 3M30B 1LW0B 4K4SA 2QL5B 3ITHB 2ILYA 4FXEA 4KR0B 2BW2A 3J7ZT 3N6NA 3MR2A 4D3GA 1Q16A 4WKYA 4ECRA 4PEOA 4DR7J 3BGRA 4ZA1A 3KKFA 1BQNB 2VICA 4KPCA 4CDIA 4NLPA 5ETNA 3D6TB 1RBLA 4FKYA 1Q16B 2ZH4A 3WX8A 3BGRB 2XHWA 1YKWA 2VZ9A 1MYLA 5IWAF 2HG4A 5H1SV 3HO1A 2PD1A 2K1RA 3IGNA 4ELUA 4UQGA 2AYGA 4O0IA 2GAGC 4P74A 1Z1ZA 1L3UA 5GAHU 2DNZA 4OJGA 2W4DA 3UDVA 2BQUA 4P9SA 2UVVA 4AT1B 3PDNA 4W4MA 2UXBJ 2FHJA 2HQDA 2K3KA 3HVTA 3MMAA 3JQMA 4TLRA 1RWPB 4IFYA 1R8HA 2DGOA 3GIIA 3CD6S 4B9MA 2IJFA 4MJKA 3RB4A 5HBMA 3NRBA 1VC0A 4WK1A 2RDDA 3Q8VA 1ZA1B 5DG9A 3VAKA 4DF8A 5GAGU 3DKDA 3TZWA 2HHXA 4NXNJ 5F9LA 2KFZA 2DR6A 3MPDA 3GSDA 3GG0A 4OYAA 4PUOB 4M94A 2YWFA 1U6BA 1TL1A 3OTCA 3GTYX 4L73A 1EQ0A 3PX0A 1FFSB 5ETTA 4TU7A 4BWMA 3ZZRA 5HL7Q 2B0GA 3IR6B 5CQGA 1WTFA 1OYDA 2YQ3A 3H4DA 3RR8A 1R3NA 2LDYA 1SC1B 1WEZA 1HMVA 4FYWB 4I1TA 2E29A 3QMQA 5KT5A 4DWIA 4DR6J 3G6VA 3C2PA 2V8PA 5F8GA 2QX0A 3ZTRA 2GZOA 2LYVA 3CF5Q 3L7PA 5BYRA 1K9MT 3UR0A 1C4CA 3M9OB 4N56A 4LFAJ 2ZHAA 1TELA 1S1VB 4K4TA 4GVBA 5HVFA 2X1AA 3A4TA 3WC0A 3C16B 2GNKA 1GX5A 4R8UB 4JI6F 4X65F 2OPPA 1BGXT 3IGVA 2AEMA 5DO2A 1IWGA 2ACMA 2Z2LA 3KYLA 3FDSA 3S8SA 1HBNB 4KY3A 5ETKA 1HI8A 1KONA 5CA5A 1M5PC 4ZP9A 3F44A 1RAAB 3AD8C 3MWBA 3MUTP 3Q86A 2CQPA 1RHQB 3DXBA 3RBEA 1FO1A 3HHNB 4OI4A 2MZQA 2RBFA 1R8PA 1LV5A 3HLUA 1CULA 4YDDB 1XWLA 1HR0J 2PE8A 2JVOA 4F4XA 5KFYA 4KT0C 1RBAA 5HI7A 3JQKA 1TVRB 2E5HA 3NL0A 3BBBA 2XS2A 4QWBA 3NS5A 1RT1B 1BUXA 4LF4F 1UEVA 4U96A 3LTOA 4I67A 3JTPA 4JI8F 2F1FA 3B6BA 2HZAA 1C1CA 3BS9A 4OLPA 2IA0A 2VKRA 4FNHA 3IWNC 4NCAA 3QFWA 1JJHA 1MWZA 3CDAA 2CADA 3PYEA 3T9ZA 2EK1A 3QT6A 1C1CB 2HVEA 3NBPA 3KHRA 1G2EA 4DQIA 3UCGA 4R25A 1MU2B 2KFNA 3UD5A 4ZP6A 4ZDNA 2XLIA 4IR9A 2MKKA 3DI6B 4DR4J 3OQ2A 2MDAA 4J91A 3NBPB 4J90A 2DITA 3SV3A 4GKKJ 2L48A 1UKUA 2HWHA 5SZTA 1VMBA 3NMRA 1B0TA 1YVFA 3KDNA 3R6LB 4C0HA 3GZ7A 1PJ7A 2XY6A 4OI6A 4C6AA 2JXGA 4NRTA 3NGRA 1FDBA 4ZPWR 1RWOB 1HQ2A 2GIRA 3CXCR 1RHUB 4OJ1A 4ED4A 3QOQA 2ZKUA 4LIRA 5ETMA 3CCVS 1VBXA 4N8NA 3AODA 1FI4A 2RQMA 4O44A 1X4EA 4RKUC 2RRAA 2IHR1 2BE2A 4KIAA 1WC5A 2D3UA 1KTVA 4K50A 3U1NA 1YLXA 5DS7A 1J5OB 5EN1A 3IRXA 3I4PA 2C2RA 3I0SB 1QM9A 3EM1A 1T9WA 1O51A 2H5JB 5HLFA 2DGSA 1LWFB 2RUGA 3MFHA 3EE3A 1P6TA 2MKIA 1R0AA 1N5QA 1R0CB 2XMWA 2XI2A 4QJVA 4LF8J 2CPDA 4HH0A 5HLFB 1WC4A 1C1BA 3KG4A 3QT7A 2VJUA 2OD6A 3HFVA 2HFOA 4CO4A 2MZ1A 4ES3A 2ZITA 5KFWA 4NLOA 3ENQA 1I3OB 1IXKA 2XWXA 2Z56B 4UOGA 3UDEA 4ZLLA 2KXNB 4GO5X 3KWMA 2LXIA 2G2YA 1T3OA 4KO0A 1TAUA 2FZCB 4PQUA 3M1VA 4DFJA 4EO8A 4OZ3A 5CD4A 3I4HX 2V8VA 3CCJS 3CD0A 3S7RA 5KG0A 3BGFA 4JYAF 4M5JA 3C6UA 1B7FA 4FVMA 3H5YA 1KHVA 4KO0B 4IO1A 1X4FA 1X60A 4Y2AA 3I31A 3M1VB 3DDKA 1TMMA 1HBMB 1XR5A 4UOFA 2MSTA 2H3AA 3P3DA 2FLPA 2RDJA 5DG7A 5KFMA 2AY0A 1VIXA 3VGTA 1K73T 1QVFR 3C6TA 1WTBA 2J9EA 2VG5A 2YTCA 1FRJA 1M1GA 1RBOB 3RW6A 1PJ5A 2GMHA 1IN0A 3C6TB 3LANA 2R42A 2VG5B 2H3EB 4NXMJ 2AGPA 3TNVA 5AT1B 1JWWA 4NOHA 4N7TA 3KOAA 3T1HJ 1U26A 4PPZA 4WP8A 4EU0A 2V2KA 5BXIA 2IMOA 4OI2A 2OMLA 3IWLA 3MGJA 1F9HA 2XMVA 1Q8LA 4F7VA 5CH7B 3DGPB 2EXUA 5J1NA 4DQRA 3KXDA 1Z2LA 3Q2TC 2Z57B 3D2WA 3CDBA 4JI1J 4NZ6A 3HD1A 2HVIA 3LPYA 3KNAA 3MM6A 2UV8G 4QU6A 1U2FA 3OXGA 1REVB 1HHTP 2CPXA 1TL3A 2WONA 3BYRA 2QA4S 2VODA 3MAQA 4QW9A 4Q45A 4M5MA 3MM6B 1KD1T 3THVA 1NNDA 2JH3A 2IPOB 3R5CA 1TL3B 1Q0NA 1QDUB 2WONB 4OIXA 4ES2A 1NSQA 2Q43A 1KKHA 2DNPA 5I4MA 4OYMA 2MTLA 4KSEB 5J2MB 2G9OA 3HK2A 2W01A 3DOKA 4RW4B 4G3IA 5KOXA 2OEJA 2KKHA 2VV5A 5B0EA 3Q8PB 1FKOA 1Y10A 5B0DA 3EVOA 2DT9A 3BQ2A 1N6QA 2YQ1A 4TXSA 4KGMA 2GQ2A 4I56A 2CKWA 3DDIA 3MMJA 3A8JA 3FT7A 2BXJA 2CG4A 4IH5A 1S9FA 4M5GA 2GVDA 1Y11A 2VONA 4LF7J 1HFEL 3Q8RB 2HBYB 4IFVA 3RTVA 3J81Y 4EBCA 5ETVA 4EBDA 1BWEA 4IRKA 4BWJA 4LF5F 4H4OB 3H87C 3DU6A 3KJVA 4K5RA 2R9LA 2CAJA 3H5SA 3BH7B 4UW2A 4C8YA 1D9DA 3MAAA 1CS4B 1IKYB 4O3RA 2UU9J 1YHQS 2J0SD 3NCPA 3SIPB 1XMBA 4PKDB 4CTAB 1E6YA 2F3JA 3MAAB 2HHVA 1FFGB 1FX4A 1VC6A 3EMTA 5A8RA 3BSNA 1Q8BA 3MR5A 1E6YB 4Y28C 3OTOJ 2XO7A 1K0VA 2W2QP 4C3LA 1HQEA 2N3LA 4Z7YA 2E7VA 2ROPA 1M90T 2WVCA 3DYAB 3TWZA 4M5HA 3RAQA 2F9JA 4CI0B 4IH7A 3K5PA 1N33J 3L3CA 3TUZC 1HQEB 1OY9A 2DHHA 4TYAA 4JI3F 2Y1IA 3HI9A 4MKAA 5IC4B 4AQYF 2P9GA 1XN9A 3KK3B 1DY3A 3PM9A 5CCLA 1GH8A 3AQOA 4DZ6A 2VFRA 2P8IA 2NUUG 2DHSA 3QSIA 4KJIA 5J1PA 1HNIA 1WHVA 1GNKA 2AT1B 4DCPB 4AAIA 1KBRA 2ZZTA 1M5KC 2QO3A 1H3DA 2XULA 5FD1A 2FJXA 4RO0A 2GJ2A 3K89A 1HWUA 3RRKA 4IOAQ 1C2PA 4ZJOA 1U0SA 2PI5A 3N01A 1NU4A 1RZMA 3CDEA 2HNZA 2BM1A 2CG8A 3VVTA 4ID5B 4NA2A 2COLA 1VQOS 2PEBA 2WOMB 3A1YG 3O1LA 2GVZA 1XTZA 1TV6A 1HNWJ 3PYDA 3P5TL 5CXTA 4FYXB 2ZD1A 2EFQA 4B3TF 2DH9A 3DCAA 1OS5A 3T5LA 4DPYA 4JOUA 2YVSA 2ZE2A 2IYGA 1ITPA 3C3LA 5EWEA 4P10A 3FFIB 4OI3A 2MGZB 2YNIA 2PSZA 1GT8A 4ZK7M 5A8WA 1J27A 5L1LA 1YTYA 4AYBD 2HEKA 1QE1B 2VD3A 3G82A 4M5DB 5B0BA 2ZHBA 5KFEA 5GMDA 3R7NB 5A8WB 3VQSA 2H1YA 4O3NA 3RR7A 5F8HA 1F9FA 4LBPA 4N47A 4MFBB 3G82B 4ER8A 1WKLA 2GO8A 2PEHA 4ZVEA 3AD9C 3N28A 5AXNA 5D77A 3ZZOA 3AH6A 1T9XA 3VR1A 4FS2A 1Z2ZA 2XYGB 5F8NA 3A13A 3V4IA 2APOA 2UXBF 1PYOB 2LQJA 3POTA 2DIUA 5EWGA 3LJPA 4KB7A 4K4UA 1R6YA 5CZXA 1NPPA 2Y0SD 3HULA 3GXQA 2J0QD 2A10A 2ABYA 2IY5B 1DAXA 1IKWB 4NXNF 3CJ2A 3C15A 5HJYA 1S6QB 1TFWA 1DLOB 4ZP8A 2KJVA 3B78A 2C3PA 2HFVA 1B70B 2FJDB 3RRGA 4CLUA 1HNXJ 2MY8A 4ERDA 2KH9A 3RBXA 1T94A 4U8VA 5D4LA 5E3AA 3AQPA 5KFPA 1SH2A 1YDLA 4QCLA 2JEFA 3PXGa 1EETA 3S01A 3ETOA 3LP0A 2DGXA 2HYIB 1RHKB 4B9UA 4LRVA 1U47A 4CO0A 2GQCA 2N7YA 5K20B 4U7UK 1DJ0A 4WYWA 3CJTA 3ZZYA 4ANCA 1JIHA 2VG6A 3LP0B 1Q8KA 5L9XA 1UW9A 2MEWA 4M5KA 4U8YA 1N56A 4LFAF 1PBAA 2L9DA 4DPOA 1Y5LB 4NA1A 4FXWA 1NB7A 1FKAF 4JUZA 3J7YI 3HHLD 4B9SA 1C0TB 2R2UA 4WIQA 2YX1A 4NA3A 4B02A 3QATA 3BF4A 3BBCA 1MMLA 1SJ3P 1QAJA 4FBUA 1NSPA 2RDIA 2BOAA 2ZOGA 2CZ9A 1APSA 4D8JA 4CH7A 1PYSB 2OFHX 4K59A 4DCOB 2RKIB 1Q7LB 2V4RA 2EFGA 3EZ5A 2R7QA 5CYQB 4M95A 3K59A 4LUBA 5FLXY 4O0NA 1XMOJ 4WXOA 2DIVA 3PV8A 4IUFA 2KXHA 2ASJA 2H1OE 4ILLA 1BXNA 5DQGA 4P71A 1S97A 2NSCA 3D1HA 5DDOC 1WORA 2B4VA 2H51B 2W4PA 1GXLA 4GC6A 3C14B 2DNRA 2WAQD 3L9ZA 2FY8A 2GHWA 2RU3A 3CCZA 2C1EB 1VJQA 3P8BB 2QMWA 1SBRA 2G2ZA 2D9OA 3EJMA 2XWYA 1S72S 5DDPC 1HNZJ 1T0TV 1HQUB 2HFNA 2HHTA 3IG1A 3F73A 1IJEB 4CIOA 2R4FA 3OPKA 1N48A 3PKMA 2DNKA 1NKCA 5HQ8A 1FRLA 3BKFA 3H7HB 3MM9A 3P49B 4DR4F 2DO4A 3EGZA 2XY5A 4WXWA 4GKKF 3GIRA 2YWGA 1HBOB 3MM9B 3SDEB 1TU0B 1QAXA 4ZCKA 4OYPA 3CJ4A 4DR3J 2XMJA 3KG1A 1Q86T 4QIWD 1UA0A 3KTQA 4CLWA 1FJEB 4ANDA 1BD6A 1T9TA 1X4GA 4USVA 4TKTA 5M2UA 3K2YA 5F8JA 2QMXA 3M2VB 4K7QA 4DFMA 3CJKA 4NLWA 4MIBA 3R7SB 3LP2A 2KOEA 3W5ZA 4U7UD 5T7LA 2HWTA 5KFAA 1RHMB 2I5JB 3LP2B 1GK8A 1SKUB 2XCAA 3GJSB 5K8PA 1RAHB 3TAQA 1H98A 1VQ9S 4K0KJ 1F5BA 2IM1A 4AL7A 5KFXA 4WIIA 3D4JA 2HFUA 5LSOA 4K8RA 4G1QA 1HI1A 3VW4A 2KG1A 3J81U 1S0MA 2UZAA 4LF8F 4LF9J 2XC9A 3MEKA 1WI6A 4G1QB 1ZM3A 2V9KA 1XR6A 2HQ3A 2ZC3A 2DPJA 2BJ8A 4J9MA 3C66A 2ZH7A 5D8HB 3QYYA 2KXFA 1L3TA 2LLZA 1UCNA 3RYLA 2VA3A 2ILZA 4FNIA 3UW1A 1VI7A 1HWJA 3OL6A 2GMLA 1EKSA 2R7XA 1NK0A 4DG1B 4URQU 1RYRA 1RWXB 4WWSA 4C8KA 2X51A 2KYXA 4N8OA 2QV6A 3NGSA 1EAYC 2SXLA 3DLKA 4Q5VA 5G0RA 5EX0A 2RSQA 4I69A 2QSFA 1HNVA 1RACB 1YJRA 3JYTA 4IG3A 3J7AN 2MHEA 1NRKA 4LF1A 5G0RB 1HNVB 4PR6A 3CCRS 2EK6A 3JYTB 1RT2A 1NDLA 1G1XA 2NYHA 4NXMF 4AXJA 3BR9A 4ZKAA 2P6TA 3NS7B 3LQVA 3T1HF 3PO4A 4LR8A 2B6AA 2WVEA 1PBUA 1LWEA 1RT2B 2FPHX 4P2XA 3OXFA 1NAQA 1HKAA 4XDDA 4NYZA 5HANA 1VCTA 1VRTB 4TVAB 2KM8B 2W8KA 1LWEB 2HFZA 3KLFA 3R5GA 4JI1F 3QGGA 4QW8A 3V81A 4PYAA 4I6YA 4DV6J 2C2OB 2OPRA 1O6XA 2AN7A 3DLEB 3DMJB 4OYZA 3R5BA 3KLFB 1SC4B 4CM0A 2ZOMA 3LH2S 4ED8A 3IA0A 3K58A 1WOOA 1VQ4S 1P1TA 2OPRB 3GJRB 3SCKE 4C48A 1VRUA 2DH7A 4ITSA 1ZPWX 4DN9A 2PA3A 2DHAA 3QJPA 5CHCB 1RI7A 2H5IB 1GEHA 4GRSA 3FCWA 2FVQA 5D0GA 4CYUA 1S4FA 2NXJA 3G8QA 2GW8A 2P6SA 2DGUA 3E01A 2GS8A 2NCKL 3RW7A 5KFBA 1O5JA 3L95X 1OPZA 3GCXP 1X0PA 2BJ9A 4JI2J 1FE4A 3GFYA 4ZVRB 3CJ8A 3E01B 4HV0A 4KYZA 4HDHA 4NZ7A 3DOMB 3SQGB 3IXQA 2YNGB 3UN5A 3GP9A 3IRWP 3MEGB 3BQ1A 4DL5A 4CNYA 3HSJA 2R7RA 4LF7F 1KOHA 4I2QA 1Y00A 3NCQA 1VK3A 3DRPB 1B4SA 1N5YB 2RQ4A 3FVYA 2IVMA 2OPSA 3A3NB 1FWLA 3KLEB 2DR5A 4C97A 4O23A 1VHFA 4I2QB 2H5EA 3SV4A 3OT9A 2UUCF 3MM5B 2BVZA 3OL8A 1TL7A 4LJMA 4EYHB 3PHTA 1UJ5A 3MTKA 1CJKA 4MK7A 4ZN3A 3RB6A 1ARQA 3K5NA 2Y8WA 1H2UX 2Z8QA 5F3TA 3W62A 2AX1A 3OFHA 5HO4A 4R5PB 2VFUA 5I3PA 5KAKA 3D68A 4DSFA 1YRUA 2JHEA 4TY8B 1MROA 3MEEA 3GE9A 4FF3A 2LA4A 2C3OA 3PVXA 2HW3A 2O01C 3E2EA 8ATCB 1TUWA 2DXDA 2AJ2A 3UN2A 2D3ZA 3IM8A 4OQJA 4C8LA 4ZHRA 1N33F 4Q7AA 1KRPA 2GA7A 3QGPA 2RHQB 4PG7A 3IBCB 1OMSA 2AW0A 2ZJRQ 4RX6A 3SSQA 3DOLA 4JI5J 5C42A 2DH8A 3R3TA 1BAZA 3HJFA 3GJTB 1FJ7A 3M6XA 2BNWA 5H9EJ 4C9DA 3PYFA 1MNEA 2HZVA 2R7VA 2QA1A 2G4BA 5KFQA 1B28A 5JVGQ 2BSQE 4QWAA 3N9UC 3O2IA 3OUYA 5A8KB 2CQ3A 2E1CA 4P72A 1UAWA 3QQCD 1RTJB 2QTWA 4ANEA 3MUVP 1RWNB 4DR5J 3UDLA 3SSSA 3OUYB 1S1WA 4A8OA 4A8QA 3O6QA 1ZTWA 3A8KA 2K2PA 1K1QA 1YG0A 5E0OA 4OHVA 2AJFE 4OJHA 2QGFB 1HNWF 1V9OA 2A3JA 3NWRA 2XLKA 2F5GA 2A18A 4IOBA 5C5JA 1Z4UA 2EG2A 5D4NA 4DV7J 3FC9A 3QWPA 5E7OB 4O4GA 1KLNA 1OHNA 3KHGA 3RBDA 6FDRA 5FLXU 3U02A 3J81j 4Y00A 2A2DA 3DHWC 4PG5A 5I3UB 1XEZA 2X7IA 2BABA 2V94A 2AEFA 3NOGA 4O4GB 2GJIA 3RB3A 2DY9A 2RS8A 1IUJA 2YKQA 1EA4A 4WKRA 3D28A 3CJ5A 3EWGA 4K2JA 2BJ1A 3D66A 1LFPA 4U67Q 1P1LA 3M9MB 2LXFA 3W9IA 1RE1B 3K5OA 3V6KA 2OD4A 2VPZB 2B8QA 2AJQA 2QEXS 1RXOB 4ILRA 1U25A 3GG1A 4I2PA 3D1QA 2ZJQQ 2R8KA 2ZBPA 2OEKA 2RVJA 2NR0A 2L3MA 4KGKA 4U9RA 4YOEA 3W2VB 3WQPA 3UNGC 2ZH3A 4FN5A 1SH0A 2K29A 5H9FK 1IJFB 2PC6A 3WDOA 3QIPA 3IR7B 3UCZP 2NYIA 1LWCB 1MWYA 3OL9A 2Q1LA 5KFUA 3DLHA 3MFIA 3R9LA 1AA1B 1NPRA 4HYKA 2E1RA 3QIPB 3BEGB 4K4ZA 5HVHA 1RTDB 4B9LA 1CVJA 3H5UA 4AFFA 1IKXA 5IFMA 3ZXWA 1AZSB 2F4FA 3GIMA 1O0PA 3T1YJ 1UWBB 1Y9OA 3SFGA 3HT3A 4NZ0A 4TU8A 4RJVA 2BE9B 1HNXF 3OSNA 2WSEC 2B4UA 4MT1A 1JLAB 3MECB 1FF2A 2CPJA 1U8WA 3TANA 1G7CB 1TL5A 1CJTA 2XSFA 2Q79A 4QQBA 1U8SA 2Z30B 5GVQA 1RTZA 4NMLA 5HSPA 3KLHA 2I1RA 4P6QA 1RU2A 3BSOA 1JLBA 4IQXA 1NSKL 3FBEA 3H8YA 1KVIA 1UPMB 2DTJA 5HQLA 2UUAJ 3KLHB 4Q0BA 3OHAA 1CJVA 1N4LA 2FC9A 1JLBB 3WBZA 2VC0A 4IR1A 3VZIA 3J7YU 1JLFA 3TAPA 4OX6A 4X64J 4J37A 4Q0BB 4DCJB 1SQEA 1CJVB 1ZAXA 1KC8T 4Q2MA 3T6JA 3T41A 3TQ1A 4USWA 2RHSB 1ULRA 4KRWA 4DR2J 5ETPA 4G65A 4DZDA 2RAQA 1F0XA 4OX8A 1WG5A 3ISZA 3D5MA 3HP6A 2BOPA 2UUBJ 4WU2A 3KJFB 2BKOA 5T14A 3ZZTA 3K17A 3IBFB 1XMOF 5THWA 2BJDA 3PTWA 1F6TA 4ECQA 1S59A 2ZJPQ 3DRRA 2CQ1A 3OJUA 3T5KA 1HLWA 1FNMA 4J5OA 2H48B 3DRRB 4LF4J 2MQMA 4JV0A 2KB2A 3LWMA 1SL1A 1U1KA 4P2SA 2JWNA 1Y7PA 1HNZF 4ED3A 2YNHB 5HROB 2ZZNA 1GXTA 1T9VA 2IJNA 1JXEA 4CLYA 3CJ0A 2PMHA 2J0WA 4LSLB 3M2RB 4ELTA 2E1MC 4ZP7A 2LQBA 2AJ0A 5L38A 3PCOB 2NQPA 2FLNA 3VF0B 1FFWB 2YKAA 2PI4A 3QBCA 2BW7A 4CNZA 1PKUA 4DR3F 1WG1A 1DTTB 3VAMA 1VLYA 1T95A 4OYXA 1JLQA 1HHQA 4IKAA 4ZJLA 3PY8A 3JTOA 2AKWB 2V5HG 3EGNA 1NDKA 5CYJA 3THPA 2D41A 3ZC4A 4LVNP 4NYOA 2DK2A 3SEOA 5IM0A 4ZVPB 2MZRA 4USKA 4XIUA 2BKPA 4WK3A 2JFKA 3W3SA 3TUPA 2R7WA 1NZAA 1M5OC 3JSMA 2WSFC 5IM0B 1X4CA 4YY3F 4DLEA 3I5CA 4USTA 2KT5A 1I5OB 4F36A 2CPGA 3MMCA 1FRKA 3IMQJ 2JOQA 3TJ9A 2CQ4A 4WZQA 2B43A 4CQ1A 2HRUA 3UDCA 2QFIA 2YPYA 2ZNZA 4J9NA 4LF9F 1ZAWA 4KAIA 3KUGA 2W1BA 3UR3C 1SQGA 4KV8A 2CNLB 2E5LJ 4TNOA 4N76A 5HAOA 1ZTTA 2VU5A 1W7WA 2EI5A 1S6PB 2CQGA 4DPXA 4JV1A 5HMXA 3NY0A 1NXIA 5KFHA 4B3OA 1NM2A 3MHYA 3D0IE 2CJYB 2YWEA 1F3VA 3HT0A 4HT7A 3P5BP 3BJYA 1S48A 2B4OA 2VPWB 5C2CA 4I6AA 3L4BC 3HHKA 4B3OB 3SMZA 2ATLA 3GIJA 2GPEA 1KNZA 5C2GA 4DV1J 3B54A 2MLZA 3UFCX 1MMNA 3TA1A 2O66A 4Q44A 4JYAJ 1EP4A 4ZVQB 2KN4A 4H4KC 4KHPJ 2VPYB 1PC4A 1QVGR 3OR2A 5L39A 1SL0A 1QTGA 3Q0AA 3HJVA 3IBWA 2YKPA 3D67A 5ETOA 2XTJP 3Q89A 4DPUA 4Y0FA 1X5PA 2IDLA 1SKRA 5LL6d 3KLVA 3LWLA 5KT7A 2VG7B 2AJ1A 3NMAA 1W2IA 2LEPA 1SJFA 1ACMB 2CA9A 1KFSA 1EHWA 2ALYB 1P94A 4RL1A 3DXSX 3AA8A 2ATCB 3HCXA 2C3YA 3KMQA 3QFHA 3PR5B 5KFGA 1TKXA 1WKJA 2LEAA 3OW2R 3NGDA 4TQRA 2D3OR 3U1LA 1SI9A 2FUG9 4DV6F 4MK8A 5D15A 3G87A 2NPFA 4CLKA 1AB8A 2LXUA 2JXIA 3G6YA 2YKMA 5MLCV 3TEHB 4M63A 4OYWA 2CPZA 4X4RA 4BS2A 1RCOB 4WFZA 4BHQA 3KLIA 2RF2B 3EZUA 3I5AA 2XG8A 3CMQA 3H98A 3D3BJ 3GWCA 3NWGA 5CAAA 4GO7X 3MF5A 4HLBA 3KLIB 2DNLA 1T11A 1U6FA 3BR8A 2EG1A 3CT9A 4PCQA 3T5HA 1LNQA 1IKVB 4OZ2A 4F4KA 4FBTA 1X4AA 4UOCA 4JI2F 4IRDA 1U4BA 1XK8A 1RT4B 1LW2A 2J9DA 4ZIVA 1VQ7S 3KHLA 3CMES 3GV5B 4X62J 1RAJA 1UVKA 1U1NA 2XS5A 4DX5A 1F2GA 1NK5A 2IFXA 3DFEA 3H2LA 3CCLS 4DL2A 3CJSA 3GSIA 3N4WA 1H7WA 4LF5J 1CLFA 2GO9A 2J8AA 3ADAC 1U1RA 2QL9B 1LQ9A 1IVZA 1KR4A 4DUTA 1Q8IA 2IVFB 3DNCA 1FA0A 1Q81T 1S9EB 1WUUA 3W60A 2CPYA 4C2MA 3NNHA 3V4MA 1QLNA 2FYXA 3J80Y 4YB7A 3CD5A 4IDKA 3DDNA 4PWWA 3OVBA 3V6DB 3VTIA 2A6OA 1RTHA 3HVRA 5BR8J 3CDWA 1KQKA 2ZOFA 2KFYA 3NGTA 1WC1A 4EMDA 1FT8A 2AYMA 4I6WA 4HHJA 3TVZA 1UL3A 3VHQA 1RADB 1RTHB 4JV5J 2RJZA 5FDLB 2EKYA 3TYTA 3D6HB 4KKOA 5J1EA 2OKQA 4RW7B 3IFEA 1H72C 4DV0F 2KO1A 2OJ3A 4JI3J 5KG1A 3G8SA 4AQYJ 2YY3A 3VEBA 4JI5F 2QA4G 1UW4A 1W2BR 1HW8A 3B82A 3TARA 1PCAA 4PYDA 4B3RJ 3A12A 2I8EA 3QNWB 3G2XA 3AA9A 1FJCA 3I9ZA 3THTA 2HMIA 1N34J 4KGXB 3IS9B 1WHXA 5DRKA 2WRMA 3Q22A 1N0UA 2UVWA 4NI2B 1K44A 4UT4A 4CO5A 3EYZA 3OL7A 3LP1A 3QT8A 4UF4A 4RW9B 2CYYA 1ZOTA 3EICA 4NE9C 4C8NA 4WP3A 3B4DA 3LP1B 3MDFA 4L6V3 1ZM9A 3R5AA 2B3TB 3IAS9 2NZCA 3ILLA 3TQEA 1WC0A 2DNOA 3KG0A 3M30A 1LW0A 5FIIA 2RRNA 1EIYB 2IYIA 2ALZA 3W5YA 3ITHA 1N8RT 3G96A 3VZHA 2AWZA 4DV7F 2I9SA 5EX3A 3DLBA 3CGIA 2MQQA 2YKNB 1ICEB 3NCRA 3LAMA 1XNQF 1GMWA 1VQSA 5DZ7A 2D1CA 1YK9A 1BQNA 1YJVA 1KS2A 3JXOA 2ZH5A 5KOWA 3BM7A 5B08A 2QFJA 3VWSA 3UPFA 3LA0A 4AE5A 3OTBA 4X4OA 4H4KA 3PRVA 1N52B 2G2OA 3RZAA 4LBHA 4C8MA 2FJEB 2VF3A 4FKXA 3T19A 3M9NB 2CQ0A 2KVQE 2N4DA 3X3UA 2BA9A 4QYZJ 3PHEA 3N6LA 1TKTA 4Y2KA 4BC9A 2QN6B 1N5SA 4LSZB 4ILMA 4GMKA 3CCUS 2P9CA 1TKTB 3D9BA 2KRRA 2W7PA 5LM7E 4TQSA 5BYSA 3HMJG 1Q5YA 1J2VA 3M8SA 1SJQA 1T7PA 2ZUAA 4RUAA 4FVCA 4DSIA 4XDCA 2HQFA 4J9VA 1S49A 3KHHA 4QYRA 4EUVA 2K5JA 2W25A 2Z58B 2W2NP 2L9WA 3L09A 3TZXA 2M70A 4PUOA 1OQ3A 3M8WA 1KVJA 1LOUA 1L5UA 1HW9A 1Q53A 2GMJA 5C25A 1RJJA 2VIHA 3T1YF 4K4XA 3AY0A 3AHPA 1KTQA 5LXYA 4QOTA 2AYEA 3PX4A 2IBOA 2CPHA 5C25B 2XB2D 1TZ0A 3VCDA 4CO3A 4AL5A 1JLCA 4NL5A 3ENVA 4DV4J 4ZPDA 3FMWA 2EC2A 1M0SA 3EVMA 1JLCB 1FKPB 5K8MA 5J2NB 3P6YC 3LUYA 2KKEA 5JMNA 3PJ9A 1X9MA 1S1VA 3QZ8A 3SQOP 1M5HA 2MSSA 2UUAF 1JLEA 3C16A 2EVZA 3MXHP 4R8UA 2EWHA 2HNYB 2M8DB 4AXIA 1SVDA 2JLEA 4F67A 4PWUA 4B3MJ 2A2CA 1RT7B 2W9BB 4X64F 2E9RX 4NWBA 4JI0F 1JLEB 1OSDA 1HBNA 4CLPA 1QAYA 3QRRA 4DLGA 3UVJB 4DDFA 4DR2F 2RB7A 1V3RA 3O3LA 1S1UA 1U6ZA 4NRUA 4QIGA 1A9NB 1NUEA 3FQKA 2IA6A 3ZZPA 2UUBF 1S1UB 1RTIB 3PW7A 4M1KA 1TKZB 3TRGA 4DOZA 4QR2A 5K9FA 1GQEA 3CEDA 2KHDA 1TVRA 4LFBF 3L7OA 1ZA2B 1RT1A 1FNOA 1C0UB 4R0EA 2DRBA 3TW0A 2M7SA 1VISA 4A8YA 4YR2A 3CMAS 2O67A 4WFBQ 2H9ZA 5I42A 3ZTOA 2HZCA 2R7TA 2JL9A 1EX8A 5LMNJ 3G9CA 2JRSA 5LOQA 1CSJA 5I42B 1MU2A 4C7QA 3DI6A 1CJUB 2H4YB 1UZHA 1FNXH 3NGKA 1F60B 1YJTA 2AMCB 2FJAB 2M88A 5A2QY 3UD3P 2JEJA 1CQMA 1TK5A 3RB0A 4CLFA 3DGVA 2W9CB 2FHKA 3MMBB 2BYCA 1DRZA 3DLLQ 2FZGB 1NLAA 1HBUB 1MN7A 3OFFA 4ZPAA 5HP1B 2FQQB 1Q82T 5DLGA 2CVIA 3VAIA 1RT3A 1TAQA 4UQTA 2B51A 2RQCA 2ZUGA 4PRFA 2OTLS 2NXCA 2NXNA 1U9PA 3K7RA 2BV3A 1ELOA 1RT3B 3JSRA 3LO3A 3M4XA 2XMAA 5JVHQ 1IR2A 4YP3A 2E5GA 4E0DA 1VYAA 4DL6A 2ZVSA 3BGLA 2Z2ZA 1S6UA 2OAUA 1ZZFA 1UPPA 1P9YA 1L3KA 1PG5B 3OFEA 1J5OA 2DNHA 3I0SA 3HSDA 4J9LA 1LWFA 2WHOA 4C3MA 3FSYA 2DB1A 3HVWA 4WJBA 3HHEA 3BYPA 1HI0P 1QSSA 2YNFA 5IQ6A 1SV5B 4F3OA 4DFPA 2OO4A 2AD9A 3P45B 2D3O1 2LCWA 4WFAQ 4Q2LA 1YBTA 2YNFB 2C2KB 1S5ZA 5MAOA 3PRDA 2CNNB 3CE8A 4YN3B 2E5LF 2LQ9A 4IH6A 1SL2A 2DPIA 2XMUA 3I56S 2XS7A 4XO0A 5F8MA 2CPEA 3FRYA 2GFFA 5LJ5Y 1XERA 5HMWA 3FSIA 2HBZB 3A8IA 3HPOA 3AOCA 2CWXA 5DM7Q 4L76A 1I1GA 1JMTA 4HT5A 2NXUA 1NJYA 1TQLA 3J80U 1HBMA 4DV1F 1UWAA 3FBCA 3EX7B 4ICLB 2Y9HA 5AXKA 1WG4A 4DQPA 8RUCA 4WTOB 4KHPF 2BRLA 2CQDA 1VJWA 4XK8C 4EFAC 5KFDA 2XY7A 3V5RA 4A8MP 2CFXA 2RUSA 4TLQA 1KQGB 3KK1B 1MG7A 4DL7A 1RWMB 3H90A 4HKQA 3R2DJ 2OP5A 3QO9B 4C0BA 3IM9A 4X66J 4MKVA 3M2UB 3QLHB 1WWHA 1BMQB 3DGPA 2UXDJ 3FEXB 3DU5A 1VQYA 4RNNA 4PZVA 3GR1A 2RIJA 1NJXA 1IBKJ 2CIMA 5IQQA 2QLJB 1LWXA 1REVA 1U49A 1SIWB 2D9PA 2DISA 5JXSA 5CYMB 4DL3A 3MCOA 1XMQJ 2RRBA 2VKZG 3NLCA 1REGX 3GQCA 2V8DA 2U1AA 2BR0A 3OBIA 1Q95G 5J2MA 2WW8A 4KHMA 2OTJS 4A8FA 4ED6A 3TO8A 4RW4A 1YBUA 4D3HA 1RWWB 1F5AA 4CH0S 3WX4A 2W2PP 5KFFA 2UP1A 1D0EA 1U09A 4OLOA 4QPXA 2HGNA 2F40A 2XI3A 2UXCJ 3ZZ0A 1YRXA 1IBMJ 3FBFA 4P2FA 4X4NA 1V6HA 4CWBA 3BQ0A 4MTPA 4W92B 1X31C 5GADI 1PIEA 2VBXA 2MKYA 1F2HA 2PA8D 4F3QA 4O3OA 4X62F 2E44A 1YSJA 5A0YB 5GAEI 3M8PB 2HS0A 3D0GE 4DSJA 4OHYA 2QG9B 2JNJA 4RW8B 4H4OA 3Q8YA 4PQAA 2KU7A 2WW4A 2V8HA 2KG0A 5DDRC 5AXMA 4J9OA 3MM8B 1CPZA 3NOCA 3UNYA 4Q43A 1CS4A 1IKYA 1RKJA 2B7BB 1LXNA 1NHUA 2RE1A 1Q5VA 1SXLA 1NK7A 3G5OA 1DTQB 1QJHA 2UUCJ 5KG3A 4RPFA 3MPVA 4CTAA 2ZBIA 1E6VB 2JSXA 3Q8QB 5KFTA 2UVRA 1U1LA 1A7GE 1HHSA 1RAOA 2VFSA 3M32B 2YX4A 2HVHA 3I9V9 5H9EK 4OZ0A 3PJWA 2RS2A 3BDEA 3DYAA 2XM3A 2DYAA 3DRSB 3B4MA 4UZCA 5L9NA 5C24B 1JKHA 2K06A 3PO5A 3GFHA 3FK4A 4K4WA 3KLGB 5HMYA 3CCSS 3CCWA 3NO7A 5BR8F 4PXDA 1EJ7L 1FX2A 2I2YA 4F4ZA 1JKHB 3I0RB 4X4TA 4FF1A 1D8ZA 4IRCA 4JV5F 2A1BA 4BCAA 4I0WA 3PG9A 4Z37A 3KK2A 1WHYA 3KK3A 1U2CA 3UI3A 4DV2J 3OLBA 4GVLA 4MJWA 3PW4A 3BGOP 1BQMA 1IRQA 3KK2B 2B9XA 4OYIA 4B3RF 1WOSA 2ZBRA 5EUHA 4MH8A 5EDWA 5C7PA 1T05B 3JSYA 1P27B 2Y0BB 1N34F 1BQMB 5LSLA 1RAEB 1SQFA 2ZKTA 1FRHA 5KFKA 2JC0A 4CO1A 4ZIWA 1X4BA 1JLGA 2J5AA 1S4EA 4Z2XA 4ID5A 1ZPVA 3WIVA 3G4SS 2Y3YA 2WOMA 3AXMA 4ELVA 3AOBA 4RUHA 5EGYA 1YGYA 1JLGB 3CC7S 3TUIC 1S0NA 3NNCA 3QAEA 2QE5A 2DHXA 5KG2A 4NEZA 2Q6BA 2AP6A 2PGCA 4WFNQ 4LRDA 3CCMS 1KP6A 2BJ3A 1NJWA 4RNOA 1X8DA 1OWXA 3OD2A 1XR7A 4ECSA 1OJ4A 2RD5C 3FQLA 2HHWA 2DD8S 2R8IA 2AU0A 2QRRA 3FFIA 2MGZA 1FERA 4KQZA 2ZH2A 1WC3A 1T9YA 1DQ8A 4JI4F 1QE1A 2HGLA 4M5IA 1FXDA 2N7CA 3T9NA 2HS4A 4M5DA 4UTGA 2UV8A 2CNOB 2HAIA 5HQMA 5KG6A 5RUBA 3AT1B 3W63A 4OV6A 2MPUA 3UD4P 3K8VA 3G6ES 4EEYA 4MFBA 2ADLA 1WJ9A 3MUMP 4HTIA 1JJ4A 2I0XA 1SC3B 2HGMA 2EBEA 1X9SA 1SCJB 3BDPA 4ED5A 2W9AA 5M2PA 4ZLNA 3MM7B 4A4JA 4ED1A 2K9IA 1GTEA 3ZFVA 3MCNA 2A6MA 3GU0A 3O8WA 2DR7A 2CXEA 1GAOA 5A2QU 1M5VC 4MYUA 2JFDA 3F56A 4R0JA 1U0HA 3IC1A 1BDVA 2VB6A 4LSNB 2AF6A 4OZJA 3AD7C 1IKWA 1JNZB 2CDRB 1U0HB 4YS2A 3N6MA 1UVLA 1I94J 2XMKA 3SBMA 2ASLA 1FD8A 1S6QA 1DLOA 2FDNA 3H20A 4ZVUB 4C11B 3T5JA 2WTFA 1VQMS 2V34A 1NK4A 3SFUA 2JDJA 4Y6IA 1QUVA 2KYZA 2J76E 4NASA 4FYYB 2J6UA 1VK8A 2Y1LB 2DGVA 2FD2A 4XPEA 5D3GA 5F0WA 2PT0A 5KFSA 4LF2A 3ILJA 3CUNA 1WF1A 5KT6A 2B7CB 4DV4F 4ED7A 2KM8C 1R6VA 4GC7A 1DQAA 5D3GB 1K47A 3EXCX 1WF0A 9ATCB 2DRAA 4RBUA 5CD4H 5D6GA 3PFOA 1FTCA 2CQHA 4YUDA 2DY1A 5U47A 1U1PA 1Y5IB 4ETXA 1C0TA 2BNZA 1SH3A 1FXLA 1MW7A 4B3MF 3CC2S 3AJ1A 4NCGA 6FD1A 2FJWA 2LKZA 2V50A 2ZDPA 2BQRA 3VGSA 2ZC4A 3Q24A 2VJVA 3FBBA
chains in the Genus database with same CATH topology
3VEBA 2GPEA 1Q5VA 3QOQA 2K5JA 2JXIA 2FGCA 2K6LA 2BJ7A 2F1FA 1BAZA 1MYKA 2HZAA 3LGHA 1MNTA 2BNWA 3GXQA 2CPGA 1ARRA 1QTGA 3BKUA 3H87C 2HZVA 2CADA 2CAJA 1EA4A 3PHTA 2BA3A 4FXEA 3QSIA 2KELA 2Y3YA 1ARQA 1B28A 2WVFA 1BDTA 3FMTA 1PARA 2BJ1A 2BSQE 3BKFA 1NLAA 3BKTA 2K9IA 4D8JA 2WVBA 4ME7E 3VEAA 2AY0A 2CAXA 3VW4A 1X93A 2CA9A 1P94A 1U9PA 2JXHA 1MYLA 1BDVA 2BJ9A 2BNZA 2NZCA 4HV0A 2WVEA 2BJ3A 2H1OE 2RBFA 2BJ8A 3OD2A 1Q5YA 2K29A 2WVDA 2PC6A 2WVCA 2JXGA 1B01A 3FT7A 2K1OA 1IRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VEB A;  2GPE A;  1Q5V A;  3QOQ A;  2K5J A;  2JXI A;  2FGC A;  2K6L A;  2BJ7 A;  2F1F A;  1BAZ A;  1MYK A;  2HZA A;  3LGH A;  1MNT A;  2BNW A;  3GXQ A;  2CPG A;  1ARR A;  1QTG A;  3BKU A;  3H87 C;  2HZV A;  2CAD A;  2CAJ A;  1EA4 A;  3PHT A;  2BA3 A;  4FXE A;  3QSI A;  2KEL A;  2Y3Y A;  1ARQ A;  1B28 A;  2WVF A;  1BDT A;  3FMT A;  1PAR A;  2BJ1 A;  2BSQ E;  3BKF A;  1NLA A;  3BKT A;  2K9I A;  4D8J A;  2WVB A;  4ME7 E;  3VEA A;  2AY0 A;  2CAX A;  3VW4 A;  1X93 A;  2CA9 A;  1P94 A;  1U9P A;  2JXH A;  1MYL A;  1BDV A;  2BJ9 A;  2BNZ A;  2NZC A;  4HV0 A;  2WVE A;  2BJ3 A;  2H1O E;  2RBF A;  2BJ8 A;  3OD2 A;  1Q5Y A;  2K29 A;  2WVD A;  2PC6 A;  2WVC A;  2JXG A;  1B01 A;  3FT7 A;  2K1O A;  1IRQ A; 
#chains in the Genus database with same CATH topology
 4N5S A;  3AJ2 A;  3MPY A;  2R3V A;  4NCG B;  1H73 A;  3TA0 A;  3QAU A;  2RKI A;  2NLW A;  5ETL A;  3LGH A;  5CYQ A;  4FF2 A;  2K1R B;  2JZ5 A;  2J9C A;  2FVC A;  4DXL A;  2X3D A;  1VQ6 S;  1TUG B;  5F41 A;  3FGV A;  4OL8 A;  2BX6 A;  4B9V A;  1SB6 A;  4J7C A;  2JEI A;  3C14 A;  5IT0 A;  5HAT A;  3HVT B;  3MMA B;  4Y2C A;  4RNF A;  3EUN A;  2HHS A;  1ZZN A;  4IFY B;  1OY6 A;  2AGO A;  3S1T A;  2ZDO A;  4U95 A;  4FXD A;  5HBM B;  2GIF A;  4F3M A;  2EBG A;  5LMN F;  4X4P A;  1ZM2 A;  5L1I A;  1HQU A;  2XEX A;  2YWW A;  4ID8 A;  1KVK A;  1HWK A;  2ZBQ A;  2RNE A;  1B0V A;  2AZ1 A;  2XSJ A;  5H9F J;  1NJZ A;  3MUR P;  1KN6 A;  1TL1 B;  4DL4 A;  2EFN A;  2NUH A;  2R8H A;  4C8O A;  3LAK A;  2AZ3 A;  2M9K A;  1HBO A;  1RIS A;  3KDO A;  2XSJ B;  3SDE A;  4KH1 B;  2OGU A;  4O3S A;  4F0K A;  1HMV B;  3G6X A;  5F0U A;  5HN0 A;  4LT6 A;  3SCL E;  4F0H A;  4DUY J;  3JS9 A;  4M5N A;  3I87 A;  3M6V A;  4X4U A;  3M2V A;  5E2Q A;  2HHP A;  5E3C A;  3U7J A;  2K7K A;  2R7S A;  2MLY A;  4DSE A;  2V2V A;  3IWX A;  5KFN A;  4YR0 A;  2O5D A;  4BLG A;  1SKS A;  4P52 A;  5CCM A;  4GVB B;  2H65 B;  4DR1 J;  2C2D A;  2QZ8 A;  1IBL J;  4HHH A;  3GFZ A;  5IZH A;  2I5J A;  1VQN S;  3L7U A;  5D4O A;  4RU2 A;  4G1I A;  1AXQ A;  2OPP B;  1N88 A;  2UVU A;  2ZWP A;  4CZC A;  2HK2 A;  4ZCI A;  1Q79 A;  5DGB A;  4YY3 J;  4DUZ J;  3H25 A;  4QWC A;  2DXE A;  4S0M A;  2O3D A;  1K8A T;  3ONQ A;  4G1P A;  5IV4 A;  7FD1 A;  4F0M A;  2CJ9 A;  3CB4 A;  4MK9 A;  1RKI A;  3PFE A;  2W8L A;  1F9E B;  1RDR A;  1FE0 A;  5L8R C;  2KZM A;  1ARR A;  2YPZ A;  2VBY A;  3CJQ A;  1NDC A;  1CUL B;  1PGZ A;  3N5F A;  4RR5 A;  1WF2 A;  2MKC A;  3HX9 A;  4DX7 A;  1S0V A;  4F8R A;  4UY8 5;  1FWK A;  1WSR A;  1U45 A;  4WYL A;  4F2S A;  2WBM A;  5E3R A;  1VFJ A;  1Q7Y T;  3SCI E;  3MAH A;  1DUR A;  1ZAV A;  1ZET A;  4EZ9 A;  1OYE A;  4W90 B;  5DM6 Q;  4DG1 A;  3CWJ A;  4L3N A;  3I6P A;  2D7S A;  5KFZ A;  4KFB A;  2IRY A;  3KNG A;  1LK5 A;  2WVD A;  3TZY A;  1AT1 B;  4DU7 A;  3Q2S C;  1UFL A;  4FPR A;  4WFX A;  4KFB B;  4USU A;  2G13 A;  2CQB A;  3H40 A;  2F63 A;  3WC2 A;  1QTM A;  2DXF A;  1RT6 A;  1MNT A;  5B09 A;  3EGW B;  3US5 A;  3GR0 A;  2ZWO A;  4YME A;  2CJB A;  4DV5 F;  2Z2Y B;  3C19 A;  1RT6 B;  4Z7C A;  3HKZ D;  4LMZ A;  4X66 F;  3CIZ A;  3M6W A;  1BY9 A;  9RUB A;  5DQI A;  3BB5 A;  2QMU B;  3ICL A;  3HZE A;  1QAI A;  4ZIT A;  3ILO A;  1VRT A;  1X9W A;  4PWD A;  2UXD F;  1RGV A;  3MOZ A;  1LK7 A;  2AYB A;  5L1J A;  4ECW A;  3O44 A;  2L08 A;  2LEC A;  4O44 B;  1RUS A;  1IBK F;  1VGY A;  2I38 A;  1X5T A;  4PWD B;  3BN7 A;  3DLE A;  3DMJ A;  5A6W A;  2HQC A;  2FJV A;  2BE2 B;  1WHW A;  4C3K A;  4YR3 A;  5GMK a;  2PMZ D;  1XMQ F;  1SC6 A;  3IRX B;  2HK3 A;  2AJ4 A;  3RAX A;  2WK4 A;  4OX9 J;  1HYS A;  2VDH A;  2KJW A;  3VAH A;  3TOQ A;  2OI2 A;  3T1A A;  1R0A B;  4FPI A;  3MD3 A;  2R8G A;  2R2R A;  4USI A;  1WNE A;  1HYS B;  1EZZ B;  2FVR A;  5KFL A;  2CJK A;  3V6H A;  1ARO P;  2MYF A;  1WKK A;  1C1B B;  5E3Q A;  1GMW D;  4PG6 A;  2JJ4 D;  4TY9 A;  3R2C J;  2CZ4 A;  3W1Y C;  1NO8 A;  2UXC F;  2HFS A;  3IN5 A;  1IBM F;  1RSC A;  2HRT A;  1VOM A;  2OLW A;  1S79 A;  5D0H A;  3DOM A;  4LF6 J;  3SQG A;  3CSK A;  3FSX A;  3R5J B;  2YNG A;  3MEG A;  5D0E A;  2V2Z A;  2FC8 A;  5M2R A;  4U7C A;  5GAD U;  3HFK A;  2C2E A;  1FRI A;  5F8I A;  3M8Q A;  2MQL A;  1N0V C;  1BWV A;  3DRP A;  4PQU B;  1N5Y A;  1OY8 A;  1UFK A;  2DGQ A;  4LR9 A;  3KLE A;  5GAE U;  1Y4Z B;  2VOO A;  1Q1K A;  2JC1 A;  3CO9 A;  3M8Q B;  1M1K T;  3C6U B;  4EZ6 A;  4Y65 A;  4FYD A;  3MM5 A;  5IT4 A;  2GAH C;  2B5J A;  3TI0 A;  2WB1 D;  3R8Y A;  1CBK A;  3M8R A;  1JK9 B;  1NSA A;  3TUJ C;  3VVU A;  1G3O A;  3SXL A;  5GME A;  3QGH A;  4R5P A;  2PN6 A;  2LEB A;  2B5J B;  4UOH A;  2DJW A;  2IM0 A;  3K57 A;  4TY8 A;  1QSL A;  1YI2 S;  2IMW P;  4X4V A;  1FVS A;  1X0F A;  4F50 A;  1K0T A;  2MQ8 A;  3CJR A;  2L41 A;  4ZVG A;  2DCL A;  5LMU J;  5G4D A;  2AIR B;  1G4C A;  4YQW A;  4USM A;  1MWQ A;  1S10 A;  1BDT A;  4F4A A;  1PAR A;  4BBY A;  1Y3J A;  1YQH A;  3TX8 A;  2PFD A;  4JP8 A;  4OYB A;  3U1M A;  3CIM A;  3ZTP A;  1N32 F;  2NSB A;  2ERR A;  1AFI A;  4F4W A;  2QT7 A;  1SJ1 A;  4ATN A;  4EK2 A;  4ZVT B;  1U02 A;  1H2V Z;  2QLB B;  2FLL A;  4DV0 J;  4JI7 J;  4LRF A;  4DV2 F;  1EAR A;  4F26 A;  4MIW A;  4B17 A;  3W9J A;  4LFC J;  3NXZ A;  2CUY A;  4MKY A;  1D09 B;  1NHK L;  3MR7 A;  3M6U A;  1T02 A;  4XPC A;  4PXC A;  1NZ8 A;  3MCS A;  2HS3 A;  1H7X A;  5A8K A;  1IM6 A;  3DOK B;  1RTJ A;  2CRL A;  1OG7 A;  5SUH A;  4B9T A;  3S6E A;  5K8O A;  3LAL A;  4WE1 A;  1VBY A;  1FKO B;  2E5I A;  4O3P A;  1N6Q B;  5DG8 A;  2DNQ A;  2O1P A;  4USH A;  2HLU A;  2ZEJ A;  5AJ3 J;  4QIF A;  1B64 A;  4B3S J;  2DR8 A;  4WE1 B;  1PSD A;  3DRX A;  3GMG A;  4WBF A;  4ZN1 A;  3P96 A;  2KHC A;  3TAM A;  4DX6 A;  3MR3 A;  1HD0 A;  2XLJ A;  1D3W A;  1HAR A;  1RB0 A;  4FZV A;  2QSW A;  2BM0 A;  2GVD B;  4KC5 A;  2HVZ A;  3V6J A;  1GXU A;  3EDQ B;  4J9U E;  1AW0 A;  3TAM B;  3JQJ A;  4IFV B;  4LRE A;  4K4V A;  2XZD B;  4RUC A;  3P4U B;  2ADB A;  4RZR A;  1S9G A;  2V8G A;  4QYZ K;  3W66 A;  1P8G A;  5I3U A;  2IBK A;  3KJV B;  3ENW A;  4I4B A;  2PFF B;  4RU9 A;  4F25 A;  1F3F A;  3K8W A;  3CW2 C;  5IXU A;  4DS4 A;  1S9G B;  1XNQ J;  3KJQ B;  5BYQ A;  2QLF B;  1UJ6 A;  2LP4 A;  3R5D A;  4LVO P;  2J8S A;  3ET6 A;  2MZJ A;  4W98 A;  3HFZ B;  4QIE A;  2GV1 A;  3TJA A;  1VQ8 S;  1NB2 A;  2HRY A;  1ZBT A;  3JB9 k;  2C28 A;  3IR5 B;  2B9E A;  1S76 D;  3OXL A;  1AUD A;  1RAF B;  1LEO A;  3ET6 B;  5A8R B;  2DNY A;  5KT3 A;  2DVI A;  3DM2 A;  4AD6 A;  1WEY A;  3PKY A;  3UQS A;  1R8A A;  2VAS A;  5FJ4 A;  1N36 J;  2HAF A;  1DAR A;  1KSP A;  2HBQ B;  3T3F A;  2VQF J;  2WVF A;  3W2V A;  3CPW R;  3DM2 B;  4PPD A;  2QYC A;  3IR7 A;  4OFZ A;  1LWC A;  2EFV A;  4QZV B;  1RWK B;  4ZJQ A;  2IAJ A;  2CPF A;  2Y1R I;  3W5X A;  1VLO A;  4DPW A;  1RTD A;  5E33 A;  4OZN A;  3W64 A;  2XQC A;  1VS3 A;  6AT1 B;  4CRJ A;  4ZLP A;  2IAJ B;  2C3M A;  1I94 F;  5DET A;  1HNI B;  2HQI A;  1AZS A;  2J6S A;  1OPI A;  1BQX A;  1UWB A;  3KFW X;  3E51 A;  4ZVS B;  3W9H A;  3H2U B;  5ETR A;  1JLA A;  3MEC A;  3BH6 B;  4EO6 A;  2E7X A;  3EPI A;  1FRM A;  1GFW B;  2G0C A;  2DEI A;  1WI8 A;  1EQM A;  1RQ0 A;  4YEA A;  2HNZ B;  2ZVI A;  1RA6 A;  1VQP S;  2M8H A;  1KOO A;  4YB6 A;  3QWU A;  2V0N A;  4HVZ A;  1FJG F;  4P7T A;  1X4H A;  3VAG A;  2GVZ B;  4DI6 A;  1F1B B;  4RBV A;  1TV6 B;  1T8E A;  1X4D A;  1KDN A;  2RH3 A;  2J9D E;  3Q23 A;  2DO0 A;  4DPT A;  1D9F A;  2ZD1 B;  2MKH A;  1Y3K A;  8AT1 B;  3CVK A;  3AB4 B;  5DZ6 A;  1FES A;  1S99 A;  4DR7 F;  1V5I B;  2V63 A;  2ZE2 B;  2HND A;  3C8Y A;  5T41 A;  3R97 A;  1NK6 A;  4MKB A;  1UJ4 A;  2YNI B;  3SI8 A;  3BSA A;  2F7V A;  3ZNU A;  2HND B;  4MYT A;  4JI0 J;  1OQ6 A;  2DRD A;  3VGU A;  2N3O A;  2DGT A;  2HVD A;  3NAI A;  1F5C A;  2KT3 A;  2LQ8 A;  1NCL A;  1VC5 A;  2UUT A;  2VBZ A;  1PJ6 A;  4NYP A;  3I32 A;  3BZQ A;  2OPQ A;  4NLD A;  3FCH A;  3OSP A;  2DHG A;  1CG2 A;  2OMO A;  4UY8 T;  1RWU A;  1RLD A;  2BQ3 A;  4UZB A;  3FZB A;  4OX7 A;  1HPZ A;  1S0O A;  2OPQ B;  4HTJ A;  1IBC B;  1IWA A;  3V4I B;  3JTN A;  1ZH5 A;  4J9S A;  2PMW A;  1LXJ A;  2VFT A;  1DBD A;  1L3V A;  3POT B;  3HSG A;  1MN9 A;  4LFB J;  3DLJ A;  1HPZ B;  2YH0 A;  3KUH A;  2LFV A;  2ZFH A;  2F9D A;  2E1A A;  1S57 A;  3CNQ P;  3UN3 A;  2DR9 A;  1K1S A;  2JXH A;  2YNH A;  5HRO A;  1YJ7 A;  1NEE A;  1UP1 A;  1HWL A;  2W4C A;  3D54 A;  3C15 B;  2HIQ A;  3KUE A;  4UUW A;  3GCW P;  2YWK A;  2IJR A;  3CUL A;  2XCP A;  4LSL A;  3M2R A;  3HSZ A;  1RYS A;  1Y0H A;  2NPI A;  4DSL A;  4QR0 A;  4DR6 F;  3GV7 B;  2K6L A;  4ZMM A;  3D0H E;  1MYK A;  4JB8 B;  5CZV A;  1EET B;  1DTT A;  5D4P A;  3RU0 A;  3ZZU A;  4DUY F;  1UZD A;  2BMB A;  5E41 A;  2UUW A;  2XZW A;  5DQH A;  4MAK A;  4M8L A;  2LMI A;  2VG6 B;  4YHH J;  2C42 A;  2HHU A;  4WTY A;  3PZP A;  2BAN A;  1XJW B;  1B3T A;  4J9Q A;  1UMJ A;  4DR1 F;  3SZ2 A;  1QUP A;  2HHH J;  3HKW A;  2AHO B;  1IBL F;  5KG4 A;  2BAN B;  4OZ5 A;  4DFK A;  4OHX A;  4V19 J;  2C2Z B;  2W2M P;  2XYH B;  4C4W A;  4C0O C;  2DCU B;  1JXL A;  4DUZ F;  5F3Z A;  4IG0 A;  3ILI A;  7FDR A;  3LPE A;  1MLA A;  3W61 A;  1LKZ A;  3MZI A;  4CLS A;  1WD6 A;  3H4B A;  1HR0 F;  4JBC A;  2YXL A;  2FHO B;  1FD2 A;  5D78 A;  3A3P B;  4IG0 B;  2F8M A;  2F4V J;  1WAC A;  2IM2 A;  4I7F A;  1EB0 A;  2D74 B;  1PO6 A;  4ECV A;  1S6P A;  4H4M A;  4C8Z A;  1UA1 A;  1HL6 A;  2IC3 A;  4I7F B;  4TN2 A;  1U1O A;  1X5O A;  2DNG A;  2LQ5 A;  3MI7 X;  4H4M B;  1VBZ A;  2BAC A;  2IC3 B;  1Y5N B;  5A76 A;  2XNR A;  3ISN D;  1T3N A;  4JV2 A;  1N5V A;  5DDQ C;  1Q78 A;  1TTH B;  3IG1 B;  3W7B A;  3TZZ A;  5J2P A;  5D0R A;  2XO6 A;  3QPI A;  2QYG A;  3GJQ B;  3GFX A;  1FK9 A;  2D69 A;  3D6F B;  5E5N A;  1YJ9 S;  2M2B A;  2JVR A;  4LQ9 A;  4C98 A;  2KDO A;  3I55 S;  5J2P B;  3QJL A;  3H42 A;  4RUB A;  2VG7 A;  1FK9 B;  3TVY A;  1WSV A;  3FUY A;  3FEZ A;  4LRB A;  4PXE A;  4CM2 A;  1VDH A;  5IC6 B;  1WDD A;  4ZPT R;  5KFR A;  4DV3 J;  4BDP A;  4A8K A;  3VAF A;  5IT9 Y;  2OSQ A;  2POK A;  4V19 X;  1U7L A;  2MXY A;  2ZH1 A;  3M05 A;  5EHH A;  3MD1 A;  1IR1 A;  3FMB A;  1FTR A;  3CJK B;  1XQI A;  2VPX B;  1Q4R A;  4L75 A;  2MQO A;  1ROF A;  2WVB A;  5AE2 A;  1FEE A;  3R7B B;  2JEG A;  5T7L B;  4CT8 A;  3J7A 1;  3TJ8 A;  1H6K X;  3K0J A;  3I96 A;  2E5J A;  4ENO A;  2AEJ A;  1XIQ A;  4V1A k;  4WU3 A;  3W65 A;  2V68 A;  2MHN A;  1BE4 A;  1RAG B;  2RF2 A;  3FEY B;  4E8U A;  4OX9 F;  3QZ7 A;  5I3Q A;  2MQP A;  2IRU A;  1NPK A;  1RAI B;  1X5S A;  2GC8 A;  4LRA A;  3ZTQ A;  2HKE A;  1OO0 B;  4TYB A;  2OH2 A;  1M1H A;  2F65 A;  2CVE A;  2V4Q A;  3TP2 A;  2DEJ A;  3OR1 A;  2IRX A;  2Y8Y A;  2V2Q A;  1IKV A;  2VH7 A;  4L74 A;  4QU7 A;  3OR1 B;  1ZM4 A;  1RT4 A;  2MQN A;  4LF6 F;  2X1G A;  5F9N A;  4LBI A;  2ZH8 A;  4N77 A;  4N41 A;  4NLQ A;  1ZYQ A;  3C46 A;  4HAC A;  5K8N A;  2ACY A;  1KQS R;  3W8G A;  1S77 D;  1HD1 A;  1IQZ A;  1GMV A;  4AL6 A;  4YB5 A;  3TR5 A;  3QRQ A;  2JLG A;  1YBA A;  2ZH9 A;  5LSR A;  4HAC B;  3VQT A;  1NK9 A;  3CO0 P;  1S6O A;  2LDI A;  3B8H A;  1S12 A;  3GB0 A;  4DN0 A;  3BPD A;  2AX0 A;  3DLK B;  2XHC A;  2E1P A;  4I64 A;  4X4Q A;  1YIJ S;  3CD7 A;  1FCA A;  4CLT A;  2RIL A;  4CP5 A;  5F8L A;  4IG3 B;  1TL4 A;  3UO0 A;  1V3Z A;  1S9E A;  1B01 A;  1M5S A;  4ZVF A;  1KLM A;  1TR0 A;  1SPB P;  4E2F B;  2DKO B;  5IOL A;  4ZCL A;  4FF4 A;  2IIH A;  2MZT A;  2MY7 A;  1TUV A;  1XNR J;  4HDG A;  2IVY A;  1KLM B;  3EZO A;  1OIA A;  4Y3C A;  4URG A;  3V6D A;  2FY1 A;  2B6A B;  5LMU F;  3AOA A;  4EYI B;  4LRC A;  3HXM A;  3RGI A;  3M7V A;  2KEL A;  3HF5 A;  1R27 B;  5FDL A;  1R43 A;  3Q8S B;  4QWE A;  3H59 A;  4GKJ J;  4RW7 A;  3ZO7 A;  2ROG A;  3BPS P;  4RLE A;  1QSY A;  1WDT A;  2FVP A;  1SUQ A;  3CCQ S;  3V81 B;  4RWX A;  1IR0 A;  3W8P A;  1H38 A;  2R7U A;  3QGI A;  4JI7 F;  3CDU A;  2IDE A;  4YFU A;  2GX8 A;  1SUQ B;  2VQE J;  1T03 A;  4NPO A;  1VRU B;  2DNN A;  3CTR A;  4LFC F;  1S1X A;  4KHR A;  3IS9 A;  1A0O B;  1UVM A;  2HBR B;  4WFY A;  1UTA A;  1FRX A;  2FVS A;  3NAH A;  2RQK A;  1T03 B;  3ENA A;  4ZLJ A;  4NLS A;  2XGP A;  1KHW A;  2BUN A;  2VFV A;  4CYU B;  5HJX A;  4NI2 A;  2QLX A;  1S1X B;  3E3X A;  5L1K A;  2CQC A;  2AQ4 A;  2OEL A;  3AFG A;  4RW9 A;  4ZCM A;  4PAB A;  3PIO Q;  4F4Y A;  3LW5 C;  1WC6 A;  3LGM A;  1OSC A;  3HHD A;  5AJ3 F;  1U1M A;  4LQ3 A;  1VQK S;  3D1O A;  4B3S F;  1FVQ A;  1NH7 A;  5LXR A;  2F8H A;  4RBT A;  3V2U C;  2JBV A;  2I6W A;  1UEU A;  4DEZ A;  1P9Q C;  3PW2 A;  2EPI A;  2YKN A;  1RT5 A;  2FHJ D;  4ME7 E;  2K7J A;  1DZ5 A;  2OPS B;  3AJD A;  4CT9 A;  1GTH A;  1J5E J;  1RT5 B;  2UU9 F;  1KFD A;  2WB4 A;  3PEJ A;  3QID A;  2F8E X;  1R8C A;  1YJN S;  1TL7 B;  2PO4 A;  1MSW D;  3AXK A;  3H0P A;  1CJK B;  3PYG A;  1RWV B;  4JI4 J;  2CDQ A;  4O3Q A;  4B9N A;  3WIU A;  1HIY A;  3OTO F;  3BSC A;  1MRO B;  3MEE B;  5DJB A;  5JUM A;  1IM4 A;  3N79 A;  2B9Y A;  2GHV C;  1BLU A;  5K14 A;  3VGV A;  2P9E A;  3BGU A;  2HLT A;  2FGO A;  2M0G B;  2X3G A;  3OJS A;  4X4S A;  2FZK B;  1N36 F;  4HEA 9;  4ZS6 A;  4ES1 A;  4P73 A;  3DN9 A;  2VQF F;  3WZ0 A;  4ECY A;  5K14 B;  1TK8 A;  3K5M A;  3M8Z A;  4ZHR B;  2NXE A;  2CQI A;  2XMM A;  1V5V A;  1DHM A;  4K2X A;  5B0G A;  2VC1 A;  4Y34 A;  2XZT B;  3JSB A;  3ZNJ 1;  4XTT A;  2L9N A;  3DOL B;  5C42 B;  4IO9 Q;  2PII A;  2FJB B;  4URS A;  4CLL A;  4Q8F A;  4PAA A;  1RU1 A;  1RHR B;  2ZM6 J;  1UEK A;  2KRB A;  4ECZ A;  1YRT A;  3BN4 A;  2YKO A;  1XBW A;  4DF4 A;  2IM3 A;  3HZG A;  3MPW A;  4RW6 A;  2MJN A;  3G86 A;  2CZV C;  2C3U A;  4ZVH A;  3HM9 A;  4A8X A;  3W2W A;  2LA6 A;  5EWF A;  4RW6 B;  2BJE A;  1T9U A;  1FHT A;  3QSY B;  4IQM A;  1S1W B;  2W2O P;  1VIO A;  1W25 A;  4B08 A;  4ZPB A;  3W2W B;  4G6V B;  3R1L A;  3FRZ A;  2WBR A;  2QA2 A;  1JX4 A;  4M5L A;  1FKP A;  5J2N A;  2YBV A;  3KJN B;  1TKD A;  1B7Y B;  3NNA A;  2K8G A;  2KVI A;  2E9T A;  2KL8 A;  4Q8E A;  2HNY A;  7AT1 B;  3BO3 A;  3GV8 B;  3VEA A;  2LU2 A;  1RT7 A;  3CCT A;  3TVK A;  2W9B A;  2B9W A;  4P2M A;  2B8P A;  3GYX B;  4O4R A;  1I51 B;  5ADZ A;  2MJU A;  2OHD A;  4ZVO B;  4OJ3 A;  2N4C A;  4Y2I A;  4DMZ A;  4KH0 B;  1KQF B;  4HI2 A;  3PX6 A;  5ETS A;  2V69 A;  3ETM A;  1U1Q A;  5KFJ A;  3UVJ A;  4KBI A;  3NP5 A;  5IWA J;  2Y1J A;  1ZS6 A;  5E3P A;  2GGP A;  3HHL C;  4RNM A;  3O5T B;  1SIZ A;  4J9P A;  2J0X A;  4OHZ A;  5IS2 A;  5GAH I;  3R1H A;  4ALZ A;  4KPY A;  3D3C J;  3EPG A;  3SSR A;  3N0V A;  2ADC A;  1UFW A;  2XNQ A;  1RTI A;  3NGU A;  1R89 A;  2GGP B;  1NKE A;  1RK8 A;  1TKZ A;  4I2P B;  4FXV A;  3ELH A;  4EI2 A;  1VQ5 S;  3PW0 A;  1C0U A;  1MMD A;  3ULH A;  3PRB A;  1QTN B;  1NME B;  1RAB B;  4QBU A;  1RCX B;  4DS5 A;  5ETQ A;  2MB0 B;  5GAG I;  3RAM A;  4USJ C;  5KFC A;  3NNE A;  1VRQ C;  3PIP Q;  3GIL A;  3EDR B;  3SCJ E;  1R7I A;  2ZZM A;  5KFV A;  1G6B A;  5AE3 A;  1FDN A;  1D1U A;  4MMO A;  4AUK A;  3R6G B;  2Q66 A;  4E98 A;  3TEG A;  3MPU B;  1C4A A;  1CJU A;  3OLA A;  1HWI A;  3NG8 A;  3RG6 A;  4NLV A;  5IT9 U;  3EVW A;  1H74 A;  1IKX B;  5HVG A;  1RP5 A;  4FS1 A;  1FDD A;  2V6A A;  2M4M A;  3F0N A;  1QD1 A;  3MED A;  2G1D A;  2R2T A;  2W9C A;  2RML A;  2FHM A;  3MMB A;  1HA1 A;  2KZZ A;  3Q8U A;  1CEZ A;  3MED B;  4NX9 A;  4QR1 A;  3JAM Y;  3ISN C;  2J7K A;  3LF0 A;  1CJT B;  1HBU A;  5HP1 A;  3U27 A;  2ASD A;  3BO2 A;  2QIF A;  3Q83 A;  2R8J A;  3FZ2 A;  4A48 A;  2QJ3 A;  3DLG A;  4ECX A;  5KFI A;  3PW5 A;  2XMT A;  4OZL A;  1YZ6 A;  3RJM B;  1V3S A;  4YHH F;  2N82 B;  2VBW A;  1X7V A;  1URR A;  3DLG B;  4PXB A;  4JI6 J;  4X65 J;  4NLX A;  1VBK A;  4NMX A;  2HHH F;  5AE1 A;  2Z2M A;  3BO4 A;  1JLF B;  4EBE A;  2CAX A;  3OHB A;  4PG4 A;  3GYN A;  1JJC B;  3LOU A;  1U48 A;  2LU1 A;  1URN A;  5K5M A;  1L3S A;  3J7Z 5;  4F02 A;  4WZM A;  2MKS A;  1SV5 A;  1EKR A;  4KTQ A;  3MOJ B;  1UVJ A;  2GQQ A;  1VR6 A;  5BJR A;  5DLF A;  1JJ2 R;  2MKJ A;  4FDF A;  2F4V F;  3M8Y A;  4LIW A;  4OHW A;  4IYQ A;  2KT2 A;  4DJB A;  5LT5 A;  1XC9 A;  4X2B A;  2HSE B;  4RNH A;  1PIL A;  4OI0 A;  4ZOS A;  4DL0 C;  3BBF A;  4JI8 J;  2DGW A;  3BKU A;  4HH1 A;  3CCE S;  3WHI A;  2ASY A;  2VOP A;  3D7S B;  4DBQ A;  3MTJ A;  3D6M B;  1D9A A;  3UWT A;  1TP7 A;  3FCV A;  2BE7 D;  4DSK A;  2NZ4 A;  1B0P A;  1VQL S;  3NKY A;  2NRE A;  4ICL A;  4EWT A;  4F04 B;  1S7H A;  3LGN A;  2JLF A;  3BRE A;  2GCF A;  2ZNY A;  2V4J A;  2RU9 A;  3OTD A;  3H2V E;  4DU8 A;  4WP9 A;  3HVA A;  3VAL A;  2HQG A;  1GX6 A;  1NJI T;  3KK1 A;  2V4J B;  4ETZ A;  2BKN A;  3TX0 A;  1NBE B;  3OTE A;  1BC6 A;  4L72 B;  3A3O B;  5KTQ A;  1AUS L;  4KE5 A;  5ITH A;  1YIT S;  3QO9 A;  1YWX A;  3M2U A;  4H54 A;  3QLH A;  4DV3 F;  3G71 S;  3UCU P;  1SKW A;  1JLQ B;  2YQ0 A;  4DV5 J;  2HIY A;  4NLT A;  3R27 A;  4I68 A;  4A8S A;  5JJB A;  2P2C B;  3EXY A;  1FXR A;  2C2N A;  2XYP B;  1SIW A;  2B56 A;  5J2Q A;  1SJR A;  3RBZ A;  5B7W A;  1CQN A;  3E8O A;  5CYM A;  2GJF A;  1W26 A;  2J7U A;  4CCH A;  2OEM A;  4K0K F;  2ZHO A;  3JSM B;  5J2Q B;  5CAB A;  2R7O A;  2VL1 A;  3RRH A;  1PC5 A;  2MZS A;  1U2R A;  5HMZ A;  3QJJ A;  3UE2 A;  2HHQ A;  3MMC B;  2GHP A;  1CC8 A;  3RUB L;  2QL7 B;  4WPA A;  4DX8 H;  5KG5 A;  2E7W A;  2X1B A;  4WCE Q;  3HHL A;  2K1O A;  1GMU A;  2P5V A;  2EC0 A;  2VDI A;  4KV8 B;  2BRK A;  4HI1 A;  4OZ1 A;  3PEH A;  4ED0 A;  1U24 A;  3I5B A;  3GYG A;  4P75 A;  4ECU A;  3I82 A;  3K5L A;  2NS1 B;  3HHL B;  3SYZ A;  2LVW A;  4Y2M A;  2WCX A;  2J7W A;  3AAW B;  2OSR A;  1PAE X;  5A0Y A;  1H2T Z;  3M8P A;  2FLO A;  2WZ1 A;  3A8E A;  2ROE A;  4L3K A;  4RW8 A;  1S1T A;  2BA3 A;  2G0J A;  1TFY A;  4HL9 A;  1TK0 A;  3OFG A;  3N5B A;  3DRY A;  1YZ7 A;  1TMJ A;  3VV2 B;  3MM8 A;  1JNR B;  4XAK A;  2CWK A;  3X1L B;  2QC3 A;  2EFO A;  2H4W B;  1S1T B;  1NLK L;  1RLC L;  3BV8 A;  4CH1 A;  1WOP A;  1X93 A;  2G0I A;  1EP4 B;  1NDP A;  1BHN A;  1DTQ A;  4KGV B;  2Q3P A;  3OR2 B;  1FDA A;  5DGA A;  2CJX B;  2BEF A;  1E6V A;  2W7A A;  1JXV A;  5B0C A;  4K4Y A;  3H5X A;  1PAU B;  2KTQ A;  1RA7 A;  3AB2 B;  1UET A;  1R0B G;  4X84 A;  2OFG X;  2WSC C;  4TU9 A;  3M32 A;  3PR4 A;  4FYV B;  4OV1 A;  1R8B A;  2E9Z A;  3PAC A;  1FWP A;  2K3I A;  4NCB A;  3OV7 A;  1XNR F;  2CNK B;  3DRS A;  2VHG A;  5C24 A;  2KI2 A;  2ZH6 A;  3KLG A;  2RT3 A;  5B0F A;  2VA2 A;  4QWD A;  2MMY A;  1UVN A;  3I0R A;  2W24 A;  1TKX B;  2MLX A;  4OI1 A;  2M3D A;  4ED2 A;  2E66 A;  1UVI A;  4GKJ F;  4KGZ B;  3QRP A;  2GIQ A;  1N32 J;  2YH1 A;  2G1H A;  4J9K A;  3VAJ A;  3GPA A;  4NLU A;  2YKM B;  2DBB A;  3FNN A;  2VQE F;  2FIU A;  1PYT A;  1T05 A;  2YX7 A;  1DQ9 A;  1DFD A;  4CLZ A;  1SJ4 P;  3CJ3 A;  3CC4 S;  1FEH A;  3MCM A;  2BDP A;  1YX2 A;  1H0H B;  2BZ2 A;  3NEK A;  3PJX A;  3G8T A;  2CJA A;  3GON A;  5KFO A;  1O8B A;  2X1F A;  1IQT A;  4CO2 A;  2FB0 A;  2VUG A;  4HHU A;  1AFJ A;  2EW9 A;  2OUG A;  4FP9 A;  4WF9 Q;  2AV5 A;  1LW2 B;  5AXL A;  3IAM 9;  4QIV A;  1NKB A;  5LJ3 Y;  2FTR A;  3QT5 A;  5HK4 A;  4NLY A;  2Z0G A;  4NLG A;  2W7O A;  3FMT A;  1VHI A;  4LR7 A;  5L46 A;  1KEK A;  1JB0 C;  1R31 A;  1WEX A;  5B0A A;  2H54 B;  3GLJ A;  2V9W A;  1J5E F;  2B4P A;  4A46 A;  2HUR A;  3PNI A;  4K5S A;  2R2S A;  2EEY A;  1CC7 A;  1NK8 A;  3T6B A;  1RHJ B;  1WEL A;  1N5T A;  3HDS A;  2CQ2 A;  4PG8 A;  2CJQ A;  4YDX A;  2ZBC A;  4YB1 P;  3NS6 A;  2Q6C A;  1I6J A;  1A6L A;  3MM7 A;  4P7V A;  4IDK B;  4DHV A;  2Q2K A;  5KT4 A;  2JX2 A;  4U6P A;  2YWH A;  2XBP A;  2BJ7 A;  3EGV A;  1JQG A;  4ZPC A;  4QPT A;  1NH8 A;  2A0F B;  3HD2 A;  2C2M B;  3OVS A;  4MIA A;  5IV3 A;  3DHX A;  4A8W A;  3ZZZ A;  2QLW A;  1NHV A;  3FKB A;  3ZTS A;  4KKO B;  4LSN A;  2AGQ A;  5J1E B;  3FJ2 A;  1YJU A;  4UUX A;  4OMF G;  1D8Y A;  2M5Y A;  4NEY A;  1YJW S;  4IOC Q;  4OYO A;  4EGL A;  2M52 A;  4NLR A;  3JAM U;  2C22 A;  3OVA A;  4DQS A;  3BKT A;  1N54 B;  4HR2 A;  4C11 A;  4J9R A;  4BC7 A;  2ZM6 F;  2HWI A;  3IP0 A;  3TA2 A;  5KT2 A;  4DQQ A;  2V67 A;  2OIH A;  4F2R A;  3GIK A;  2HMI B;  3F41 A;  4ZPV R;  1KWM A;  4DR5 F;  2XGQ A;  2PDA A;  4A47 A;  2J6T A;  2A2B A;  5KG7 A;  4ECT A;  3MR6 A;  2HPU A;  4RWW A;  2Z4P A;  3DC2 A;  3IO1 A;  2EFP A;  2U2F A;  5A6P A;  1QY7 A;  2FGC A;  1FJG J;  1AYE A;  2BBE A;  1B99 A;  4B3T J;  2EKN A;  3KMS A;  1S7I A;  1LFW A;  2DNM A;  2CPI A;  3M30 B;  1LW0 B;  4K4S A;  2QL5 B;  3ITH B;  2ILY A;  4FXE A;  4KR0 B;  2BW2 A;  3J7Z T;  3N6N A;  3MR2 A;  4D3G A;  1Q16 A;  4WKY A;  4ECR A;  4PEO A;  4DR7 J;  3BGR A;  4ZA1 A;  3KKF A;  1BQN B;  2VIC A;  4KPC A;  4CDI A;  4NLP A;  5ETN A;  3D6T B;  1RBL A;  4FKY A;  1Q16 B;  2ZH4 A;  3WX8 A;  3BGR B;  2XHW A;  1YKW A;  2VZ9 A;  1MYL A;  5IWA F;  2HG4 A;  5H1S V;  3HO1 A;  2PD1 A;  2K1R A;  3IGN A;  4ELU A;  4UQG A;  2AYG A;  4O0I A;  2GAG C;  4P74 A;  1Z1Z A;  1L3U A;  5GAH U;  2DNZ A;  4OJG A;  2W4D A;  3UDV A;  2BQU A;  4P9S A;  2UVV A;  4AT1 B;  3PDN A;  4W4M A;  2UXB J;  2FHJ A;  2HQD A;  2K3K A;  3HVT A;  3MMA A;  3JQM A;  4TLR A;  1RWP B;  4IFY A;  1R8H A;  2DGO A;  3GII A;  3CD6 S;  4B9M A;  2IJF A;  4MJK A;  3RB4 A;  5HBM A;  3NRB A;  1VC0 A;  4WK1 A;  2RDD A;  3Q8V A;  1ZA1 B;  5DG9 A;  3VAK A;  4DF8 A;  5GAG U;  3DKD A;  3TZW A;  2HHX A;  4NXN J;  5F9L A;  2KFZ A;  2DR6 A;  3MPD A;  3GSD A;  3GG0 A;  4OYA A;  4PUO B;  4M94 A;  2YWF A;  1U6B A;  1TL1 A;  3OTC A;  3GTY X;  4L73 A;  1EQ0 A;  3PX0 A;  1FFS B;  5ETT A;  4TU7 A;  4BWM A;  3ZZR A;  5HL7 Q;  2B0G A;  3IR6 B;  5CQG A;  1WTF A;  1OYD A;  2YQ3 A;  3H4D A;  3RR8 A;  1R3N A;  2LDY A;  1SC1 B;  1WEZ A;  1HMV A;  4FYW B;  4I1T A;  2E29 A;  3QMQ A;  5KT5 A;  4DWI A;  4DR6 J;  3G6V A;  3C2P A;  2V8P A;  5F8G A;  2QX0 A;  3ZTR A;  2GZO A;  2LYV A;  3CF5 Q;  3L7P A;  5BYR A;  1K9M T;  3UR0 A;  1C4C A;  3M9O B;  4N56 A;  4LFA J;  2ZHA A;  1TEL A;  1S1V B;  4K4T A;  4GVB A;  5HVF A;  2X1A A;  3A4T A;  3WC0 A;  3C16 B;  2GNK A;  1GX5 A;  4R8U B;  4JI6 F;  4X65 F;  2OPP A;  1BGX T;  3IGV A;  2AEM A;  5DO2 A;  1IWG A;  2ACM A;  2Z2L A;  3KYL A;  3FDS A;  3S8S A;  1HBN B;  4KY3 A;  5ETK A;  1HI8 A;  1KON A;  5CA5 A;  1M5P C;  4ZP9 A;  3F44 A;  1RAA B;  3AD8 C;  3MWB A;  3MUT P;  3Q86 A;  2CQP A;  1RHQ B;  3DXB A;  3RBE A;  1FO1 A;  3HHN B;  4OI4 A;  2MZQ A;  2RBF A;  1R8P A;  1LV5 A;  3HLU A;  1CUL A;  4YDD B;  1XWL A;  1HR0 J;  2PE8 A;  2JVO A;  4F4X A;  5KFY A;  4KT0 C;  1RBA A;  5HI7 A;  3JQK A;  1TVR B;  2E5H A;  3NL0 A;  3BBB A;  2XS2 A;  4QWB A;  3NS5 A;  1RT1 B;  1BUX A;  4LF4 F;  1UEV A;  4U96 A;  3LTO A;  4I67 A;  3JTP A;  4JI8 F;  2F1F A;  3B6B A;  2HZA A;  1C1C A;  3BS9 A;  4OLP A;  2IA0 A;  2VKR A;  4FNH A;  3IWN C;  4NCA A;  3QFW A;  1JJH A;  1MWZ A;  3CDA A;  2CAD A;  3PYE A;  3T9Z A;  2EK1 A;  3QT6 A;  1C1C B;  2HVE A;  3NBP A;  3KHR A;  1G2E A;  4DQI A;  3UCG A;  4R25 A;  1MU2 B;  2KFN A;  3UD5 A;  4ZP6 A;  4ZDN A;  2XLI A;  4IR9 A;  2MKK A;  3DI6 B;  4DR4 J;  3OQ2 A;  2MDA A;  4J91 A;  3NBP B;  4J90 A;  2DIT A;  3SV3 A;  4GKK J;  2L48 A;  1UKU A;  2HWH A;  5SZT A;  1VMB A;  3NMR A;  1B0T A;  1YVF A;  3KDN A;  3R6L B;  4C0H A;  3GZ7 A;  1PJ7 A;  2XY6 A;  4OI6 A;  4C6A A;  2JXG A;  4NRT A;  3NGR A;  1FDB A;  4ZPW R;  1RWO B;  1HQ2 A;  2GIR A;  3CXC R;  1RHU B;  4OJ1 A;  4ED4 A;  3QOQ A;  2ZKU A;  4LIR A;  5ETM A;  3CCV S;  1VBX A;  4N8N A;  3AOD A;  1FI4 A;  2RQM A;  4O44 A;  1X4E A;  4RKU C;  2RRA A;  2IHR 1;  2BE2 A;  4KIA A;  1WC5 A;  2D3U A;  1KTV A;  4K50 A;  3U1N A;  1YLX A;  5DS7 A;  1J5O B;  5EN1 A;  3IRX A;  3I4P A;  2C2R A;  3I0S B;  1QM9 A;  3EM1 A;  1T9W A;  1O51 A;  2H5J B;  5HLF A;  2DGS A;  1LWF B;  2RUG A;  3MFH A;  3EE3 A;  1P6T A;  2MKI A;  1R0A A;  1N5Q A;  1R0C B;  2XMW A;  2XI2 A;  4QJV A;  4LF8 J;  2CPD A;  4HH0 A;  5HLF B;  1WC4 A;  1C1B A;  3KG4 A;  3QT7 A;  2VJU A;  2OD6 A;  3HFV A;  2HFO A;  4CO4 A;  2MZ1 A;  4ES3 A;  2ZIT A;  5KFW A;  4NLO A;  3ENQ A;  1I3O B;  1IXK A;  2XWX A;  2Z56 B;  4UOG A;  3UDE A;  4ZLL A;  2KXN B;  4GO5 X;  3KWM A;  2LXI A;  2G2Y A;  1T3O A;  4KO0 A;  1TAU A;  2FZC B;  4PQU A;  3M1V A;  4DFJ A;  4EO8 A;  4OZ3 A;  5CD4 A;  3I4H X;  2V8V A;  3CCJ S;  3CD0 A;  3S7R A;  5KG0 A;  3BGF A;  4JYA F;  4M5J A;  3C6U A;  1B7F A;  4FVM A;  3H5Y A;  1KHV A;  4KO0 B;  4IO1 A;  1X4F A;  1X60 A;  4Y2A A;  3I31 A;  3M1V B;  3DDK A;  1TMM A;  1HBM B;  1XR5 A;  4UOF A;  2MST A;  2H3A A;  3P3D A;  2FLP A;  2RDJ A;  5DG7 A;  5KFM A;  2AY0 A;  1VIX A;  3VGT A;  1K73 T;  1QVF R;  3C6T A;  1WTB A;  2J9E A;  2VG5 A;  2YTC A;  1FRJ A;  1M1G A;  1RBO B;  3RW6 A;  1PJ5 A;  2GMH A;  1IN0 A;  3C6T B;  3LAN A;  2R42 A;  2VG5 B;  2H3E B;  4NXM J;  2AGP A;  3TNV A;  5AT1 B;  1JWW A;  4NOH A;  4N7T A;  3KOA A;  3T1H J;  1U26 A;  4PPZ A;  4WP8 A;  4EU0 A;  2V2K A;  5BXI A;  2IMO A;  4OI2 A;  2OML A;  3IWL A;  3MGJ A;  1F9H A;  2XMV A;  1Q8L A;  4F7V A;  5CH7 B;  3DGP B;  2EXU A;  5J1N A;  4DQR A;  3KXD A;  1Z2L A;  3Q2T C;  2Z57 B;  3D2W A;  3CDB A;  4JI1 J;  4NZ6 A;  3HD1 A;  2HVI A;  3LPY A;  3KNA A;  3MM6 A;  2UV8 G;  4QU6 A;  1U2F A;  3OXG A;  1REV B;  1HHT P;  2CPX A;  1TL3 A;  2WON A;  3BYR A;  2QA4 S;  2VOD A;  3MAQ A;  4QW9 A;  4Q45 A;  4M5M A;  3MM6 B;  1KD1 T;  3THV A;  1NND A;  2JH3 A;  2IPO B;  3R5C A;  1TL3 B;  1Q0N A;  1QDU B;  2WON B;  4OIX A;  4ES2 A;  1NSQ A;  2Q43 A;  1KKH A;  2DNP A;  5I4M A;  4OYM A;  2MTL A;  4KSE B;  5J2M B;  2G9O A;  3HK2 A;  2W01 A;  3DOK A;  4RW4 B;  4G3I A;  5KOX A;  2OEJ A;  2KKH A;  2VV5 A;  5B0E A;  3Q8P B;  1FKO A;  1Y10 A;  5B0D A;  3EVO A;  2DT9 A;  3BQ2 A;  1N6Q A;  2YQ1 A;  4TXS A;  4KGM A;  2GQ2 A;  4I56 A;  2CKW A;  3DDI A;  3MMJ A;  3A8J A;  3FT7 A;  2BXJ A;  2CG4 A;  4IH5 A;  1S9F A;  4M5G A;  2GVD A;  1Y11 A;  2VON A;  4LF7 J;  1HFE L;  3Q8R B;  2HBY B;  4IFV A;  3RTV A;  3J81 Y;  4EBC A;  5ETV A;  4EBD A;  1BWE A;  4IRK A;  4BWJ A;  4LF5 F;  4H4O B;  3H87 C;  3DU6 A;  3KJV A;  4K5R A;  2R9L A;  2CAJ A;  3H5S A;  3BH7 B;  4UW2 A;  4C8Y A;  1D9D A;  3MAA A;  1CS4 B;  1IKY B;  4O3R A;  2UU9 J;  1YHQ S;  2J0S D;  3NCP A;  3SIP B;  1XMB A;  4PKD B;  4CTA B;  1E6Y A;  2F3J A;  3MAA B;  2HHV A;  1FFG B;  1FX4 A;  1VC6 A;  3EMT A;  5A8R A;  3BSN A;  1Q8B A;  3MR5 A;  1E6Y B;  4Y28 C;  3OTO J;  2XO7 A;  1K0V A;  2W2Q P;  4C3L A;  1HQE A;  2N3L A;  4Z7Y A;  2E7V A;  2ROP A;  1M90 T;  2WVC A;  3DYA B;  3TWZ A;  4M5H A;  3RAQ A;  2F9J A;  4CI0 B;  4IH7 A;  3K5P A;  1N33 J;  3L3C A;  3TUZ C;  1HQE B;  1OY9 A;  2DHH A;  4TYA A;  4JI3 F;  2Y1I A;  3HI9 A;  4MKA A;  5IC4 B;  4AQY F;  2P9G A;  1XN9 A;  3KK3 B;  1DY3 A;  3PM9 A;  5CCL A;  1GH8 A;  3AQO A;  4DZ6 A;  2VFR A;  2P8I A;  2NUU G;  2DHS A;  3QSI A;  4KJI A;  5J1P A;  1HNI A;  1WHV A;  1GNK A;  2AT1 B;  4DCP B;  4AAI A;  1KBR A;  2ZZT A;  1M5K C;  2QO3 A;  1H3D A;  2XUL A;  5FD1 A;  2FJX A;  4RO0 A;  2GJ2 A;  3K89 A;  1HWU A;  3RRK A;  4IOA Q;  1C2P A;  4ZJO A;  1U0S A;  2PI5 A;  3N01 A;  1NU4 A;  1RZM A;  3CDE A;  2HNZ A;  2BM1 A;  2CG8 A;  3VVT A;  4ID5 B;  4NA2 A;  2COL A;  1VQO S;  2PEB A;  2WOM B;  3A1Y G;  3O1L A;  2GVZ A;  1XTZ A;  1TV6 A;  1HNW J;  3PYD A;  3P5T L;  5CXT A;  4FYX B;  2ZD1 A;  2EFQ A;  4B3T F;  2DH9 A;  3DCA A;  1OS5 A;  3T5L A;  4DPY A;  4JOU A;  2YVS A;  2ZE2 A;  2IYG A;  1ITP A;  3C3L A;  5EWE A;  4P10 A;  3FFI B;  4OI3 A;  2MGZ B;  2YNI A;  2PSZ A;  1GT8 A;  4ZK7 M;  5A8W A;  1J27 A;  5L1L A;  1YTY A;  4AYB D;  2HEK A;  1QE1 B;  2VD3 A;  3G82 A;  4M5D B;  5B0B A;  2ZHB A;  5KFE A;  5GMD A;  3R7N B;  5A8W B;  3VQS A;  2H1Y A;  4O3N A;  3RR7 A;  5F8H A;  1F9F A;  4LBP A;  4N47 A;  4MFB B;  3G82 B;  4ER8 A;  1WKL A;  2GO8 A;  2PEH A;  4ZVE A;  3AD9 C;  3N28 A;  5AXN A;  5D77 A;  3ZZO A;  3AH6 A;  1T9X A;  3VR1 A;  4FS2 A;  1Z2Z A;  2XYG B;  5F8N A;  3A13 A;  3V4I A;  2APO A;  2UXB F;  1PYO B;  2LQJ A;  3POT A;  2DIU A;  5EWG A;  3LJP A;  4KB7 A;  4K4U A;  1R6Y A;  5CZX A;  1NPP A;  2Y0S D;  3HUL A;  3GXQ A;  2J0Q D;  2A10 A;  2ABY A;  2IY5 B;  1DAX A;  1IKW B;  4NXN F;  3CJ2 A;  3C15 A;  5HJY A;  1S6Q B;  1TFW A;  1DLO B;  4ZP8 A;  2KJV A;  3B78 A;  2C3P A;  2HFV A;  1B70 B;  2FJD B;  3RRG A;  4CLU A;  1HNX J;  2MY8 A;  4ERD A;  2KH9 A;  3RBX A;  1T94 A;  4U8V A;  5D4L A;  5E3A A;  3AQP A;  5KFP A;  1SH2 A;  1YDL A;  4QCL A;  2JEF A;  3PXG a;  1EET A;  3S01 A;  3ETO A;  3LP0 A;  2DGX A;  2HYI B;  1RHK B;  4B9U A;  4LRV A;  1U47 A;  4CO0 A;  2GQC A;  2N7Y A;  5K20 B;  4U7U K;  1DJ0 A;  4WYW A;  3CJT A;  3ZZY A;  4ANC A;  1JIH A;  2VG6 A;  3LP0 B;  1Q8K A;  5L9X A;  1UW9 A;  2MEW A;  4M5K A;  4U8Y A;  1N56 A;  4LFA F;  1PBA A;  2L9D A;  4DPO A;  1Y5L B;  4NA1 A;  4FXW A;  1NB7 A;  1FKA F;  4JUZ A;  3J7Y I;  3HHL D;  4B9S A;  1C0T B;  2R2U A;  4WIQ A;  2YX1 A;  4NA3 A;  4B02 A;  3QAT A;  3BF4 A;  3BBC A;  1MML A;  1SJ3 P;  1QAJ A;  4FBU A;  1NSP A;  2RDI A;  2BOA A;  2ZOG A;  2CZ9 A;  1APS A;  4D8J A;  4CH7 A;  1PYS B;  2OFH X;  4K59 A;  4DCO B;  2RKI B;  1Q7L B;  2V4R A;  2EFG A;  3EZ5 A;  2R7Q A;  5CYQ B;  4M95 A;  3K59 A;  4LUB A;  5FLX Y;  4O0N A;  1XMO J;  4WXO A;  2DIV A;  3PV8 A;  4IUF A;  2KXH A;  2ASJ A;  2H1O E;  4ILL A;  1BXN A;  5DQG A;  4P71 A;  1S97 A;  2NSC A;  3D1H A;  5DDO C;  1WOR A;  2B4V A;  2H51 B;  2W4P A;  1GXL A;  4GC6 A;  3C14 B;  2DNR A;  2WAQ D;  3L9Z A;  2FY8 A;  2GHW A;  2RU3 A;  3CCZ A;  2C1E B;  1VJQ A;  3P8B B;  2QMW A;  1SBR A;  2G2Z A;  2D9O A;  3EJM A;  2XWY A;  1S72 S;  5DDP C;  1HNZ J;  1T0T V;  1HQU B;  2HFN A;  2HHT A;  3IG1 A;  3F73 A;  1IJE B;  4CIO A;  2R4F A;  3OPK A;  1N48 A;  3PKM A;  2DNK A;  1NKC A;  5HQ8 A;  1FRL A;  3BKF A;  3H7H B;  3MM9 A;  3P49 B;  4DR4 F;  2DO4 A;  3EGZ A;  2XY5 A;  4WXW A;  4GKK F;  3GIR A;  2YWG A;  1HBO B;  3MM9 B;  3SDE B;  1TU0 B;  1QAX A;  4ZCK A;  4OYP A;  3CJ4 A;  4DR3 J;  2XMJ A;  3KG1 A;  1Q86 T;  4QIW D;  1UA0 A;  3KTQ A;  4CLW A;  1FJE B;  4AND A;  1BD6 A;  1T9T A;  1X4G A;  4USV A;  4TKT A;  5M2U A;  3K2Y A;  5F8J A;  2QMX A;  3M2V B;  4K7Q A;  4DFM A;  3CJK A;  4NLW A;  4MIB A;  3R7S B;  3LP2 A;  2KOE A;  3W5Z A;  4U7U D;  5T7L A;  2HWT A;  5KFA A;  1RHM B;  2I5J B;  3LP2 B;  1GK8 A;  1SKU B;  2XCA A;  3GJS B;  5K8P A;  1RAH B;  3TAQ A;  1H98 A;  1VQ9 S;  4K0K J;  1F5B A;  2IM1 A;  4AL7 A;  5KFX A;  4WII A;  3D4J A;  2HFU A;  5LSO A;  4K8R A;  4G1Q A;  1HI1 A;  3VW4 A;  2KG1 A;  3J81 U;  1S0M A;  2UZA A;  4LF8 F;  4LF9 J;  2XC9 A;  3MEK A;  1WI6 A;  4G1Q B;  1ZM3 A;  2V9K A;  1XR6 A;  2HQ3 A;  2ZC3 A;  2DPJ A;  2BJ8 A;  4J9M A;  3C66 A;  2ZH7 A;  5D8H B;  3QYY A;  2KXF A;  1L3T A;  2LLZ A;  1UCN A;  3RYL A;  2VA3 A;  2ILZ A;  4FNI A;  3UW1 A;  1VI7 A;  1HWJ A;  3OL6 A;  2GML A;  1EKS A;  2R7X A;  1NK0 A;  4DG1 B;  4URQ U;  1RYR A;  1RWX B;  4WWS A;  4C8K A;  2X51 A;  2KYX A;  4N8O A;  2QV6 A;  3NGS A;  1EAY C;  2SXL A;  3DLK A;  4Q5V A;  5G0R A;  5EX0 A;  2RSQ A;  4I69 A;  2QSF A;  1HNV A;  1RAC B;  1YJR A;  3JYT A;  4IG3 A;  3J7A N;  2MHE A;  1NRK A;  4LF1 A;  5G0R B;  1HNV B;  4PR6 A;  3CCR S;  2EK6 A;  3JYT B;  1RT2 A;  1NDL A;  1G1X A;  2NYH A;  4NXM F;  4AXJ A;  3BR9 A;  4ZKA A;  2P6T A;  3NS7 B;  3LQV A;  3T1H F;  3PO4 A;  4LR8 A;  2B6A A;  2WVE A;  1PBU A;  1LWE A;  1RT2 B;  2FPH X;  4P2X A;  3OXF A;  1NAQ A;  1HKA A;  4XDD A;  4NYZ A;  5HAN A;  1VCT A;  1VRT B;  4TVA B;  2KM8 B;  2W8K A;  1LWE B;  2HFZ A;  3KLF A;  3R5G A;  4JI1 F;  3QGG A;  4QW8 A;  3V81 A;  4PYA A;  4I6Y A;  4DV6 J;  2C2O B;  2OPR A;  1O6X A;  2AN7 A;  3DLE B;  3DMJ B;  4OYZ A;  3R5B A;  3KLF B;  1SC4 B;  4CM0 A;  2ZOM A;  3LH2 S;  4ED8 A;  3IA0 A;  3K58 A;  1WOO A;  1VQ4 S;  1P1T A;  2OPR B;  3GJR B;  3SCK E;  4C48 A;  1VRU A;  2DH7 A;  4ITS A;  1ZPW X;  4DN9 A;  2PA3 A;  2DHA A;  3QJP A;  5CHC B;  1RI7 A;  2H5I B;  1GEH A;  4GRS A;  3FCW A;  2FVQ A;  5D0G A;  4CYU A;  1S4F A;  2NXJ A;  3G8Q A;  2GW8 A;  2P6S A;  2DGU A;  3E01 A;  2GS8 A;  2NCK L;  3RW7 A;  5KFB A;  1O5J A;  3L95 X;  1OPZ A;  3GCX P;  1X0P A;  2BJ9 A;  4JI2 J;  1FE4 A;  3GFY A;  4ZVR B;  3CJ8 A;  3E01 B;  4HV0 A;  4KYZ A;  4HDH A;  4NZ7 A;  3DOM B;  3SQG B;  3IXQ A;  2YNG B;  3UN5 A;  3GP9 A;  3IRW P;  3MEG B;  3BQ1 A;  4DL5 A;  4CNY A;  3HSJ A;  2R7R A;  4LF7 F;  1KOH A;  4I2Q A;  1Y00 A;  3NCQ A;  1VK3 A;  3DRP B;  1B4S A;  1N5Y B;  2RQ4 A;  3FVY A;  2IVM A;  2OPS A;  3A3N B;  1FWL A;  3KLE B;  2DR5 A;  4C97 A;  4O23 A;  1VHF A;  4I2Q B;  2H5E A;  3SV4 A;  3OT9 A;  2UUC F;  3MM5 B;  2BVZ A;  3OL8 A;  1TL7 A;  4LJM A;  4EYH B;  3PHT A;  1UJ5 A;  3MTK A;  1CJK A;  4MK7 A;  4ZN3 A;  3RB6 A;  1ARQ A;  3K5N A;  2Y8W A;  1H2U X;  2Z8Q A;  5F3T A;  3W62 A;  2AX1 A;  3OFH A;  5HO4 A;  4R5P B;  2VFU A;  5I3P A;  5KAK A;  3D68 A;  4DSF A;  1YRU A;  2JHE A;  4TY8 B;  1MRO A;  3MEE A;  3GE9 A;  4FF3 A;  2LA4 A;  2C3O A;  3PVX A;  2HW3 A;  2O01 C;  3E2E A;  8ATC B;  1TUW A;  2DXD A;  2AJ2 A;  3UN2 A;  2D3Z A;  3IM8 A;  4OQJ A;  4C8L A;  4ZHR A;  1N33 F;  4Q7A A;  1KRP A;  2GA7 A;  3QGP A;  2RHQ B;  4PG7 A;  3IBC B;  1OMS A;  2AW0 A;  2ZJR Q;  4RX6 A;  3SSQ A;  3DOL A;  4JI5 J;  5C42 A;  2DH8 A;  3R3T A;  1BAZ A;  3HJF A;  3GJT B;  1FJ7 A;  3M6X A;  2BNW A;  5H9E J;  4C9D A;  3PYF A;  1MNE A;  2HZV A;  2R7V A;  2QA1 A;  2G4B A;  5KFQ A;  1B28 A;  5JVG Q;  2BSQ E;  4QWA A;  3N9U C;  3O2I A;  3OUY A;  5A8K B;  2CQ3 A;  2E1C A;  4P72 A;  1UAW A;  3QQC D;  1RTJ B;  2QTW A;  4ANE A;  3MUV P;  1RWN B;  4DR5 J;  3UDL A;  3SSS A;  3OUY B;  1S1W A;  4A8O A;  4A8Q A;  3O6Q A;  1ZTW A;  3A8K A;  2K2P A;  1K1Q A;  1YG0 A;  5E0O A;  4OHV A;  2AJF E;  4OJH A;  2QGF B;  1HNW F;  1V9O A;  2A3J A;  3NWR A;  2XLK A;  2F5G A;  2A18 A;  4IOB A;  5C5J A;  1Z4U A;  2EG2 A;  5D4N A;  4DV7 J;  3FC9 A;  3QWP A;  5E7O B;  4O4G A;  1KLN A;  1OHN A;  3KHG A;  3RBD A;  6FDR A;  5FLX U;  3U02 A;  3J81 j;  4Y00 A;  2A2D A;  3DHW C;  4PG5 A;  5I3U B;  1XEZ A;  2X7I A;  2BAB A;  2V94 A;  2AEF A;  3NOG A;  4O4G B;  2GJI A;  3RB3 A;  2DY9 A;  2RS8 A;  1IUJ A;  2YKQ A;  1EA4 A;  4WKR A;  3D28 A;  3CJ5 A;  3EWG A;  4K2J A;  2BJ1 A;  3D66 A;  1LFP A;  4U67 Q;  1P1L A;  3M9M B;  2LXF A;  3W9I A;  1RE1 B;  3K5O A;  3V6K A;  2OD4 A;  2VPZ B;  2B8Q A;  2AJQ A;  2QEX S;  1RXO B;  4ILR A;  1U25 A;  3GG1 A;  4I2P A;  3D1Q A;  2ZJQ Q;  2R8K A;  2ZBP A;  2OEK A;  2RVJ A;  2NR0 A;  2L3M A;  4KGK A;  4U9R A;  4YOE A;  3W2V B;  3WQP A;  3UNG C;  2ZH3 A;  4FN5 A;  1SH0 A;  2K29 A;  5H9F K;  1IJF B;  2PC6 A;  3WDO A;  3QIP A;  3IR7 B;  3UCZ P;  2NYI A;  1LWC B;  1MWY A;  3OL9 A;  2Q1L A;  5KFU A;  3DLH A;  3MFI A;  3R9L A;  1AA1 B;  1NPR A;  4HYK A;  2E1R A;  3QIP B;  3BEG B;  4K4Z A;  5HVH A;  1RTD B;  4B9L A;  1CVJ A;  3H5U A;  4AFF A;  1IKX A;  5IFM A;  3ZXW A;  1AZS B;  2F4F A;  3GIM A;  1O0P A;  3T1Y J;  1UWB B;  1Y9O A;  3SFG A;  3HT3 A;  4NZ0 A;  4TU8 A;  4RJV A;  2BE9 B;  1HNX F;  3OSN A;  2WSE C;  2B4U A;  4MT1 A;  1JLA B;  3MEC B;  1FF2 A;  2CPJ A;  1U8W A;  3TAN A;  1G7C B;  1TL5 A;  1CJT A;  2XSF A;  2Q79 A;  4QQB A;  1U8S A;  2Z30 B;  5GVQ A;  1RTZ A;  4NML A;  5HSP A;  3KLH A;  2I1R A;  4P6Q A;  1RU2 A;  3BSO A;  1JLB A;  4IQX A;  1NSK L;  3FBE A;  3H8Y A;  1KVI A;  1UPM B;  2DTJ A;  5HQL A;  2UUA J;  3KLH B;  4Q0B A;  3OHA A;  1CJV A;  1N4L A;  2FC9 A;  1JLB B;  3WBZ A;  2VC0 A;  4IR1 A;  3VZI A;  3J7Y U;  1JLF A;  3TAP A;  4OX6 A;  4X64 J;  4J37 A;  4Q0B B;  4DCJ B;  1SQE A;  1CJV B;  1ZAX A;  1KC8 T;  4Q2M A;  3T6J A;  3T41 A;  3TQ1 A;  4USW A;  2RHS B;  1ULR A;  4KRW A;  4DR2 J;  5ETP A;  4G65 A;  4DZD A;  2RAQ A;  1F0X A;  4OX8 A;  1WG5 A;  3ISZ A;  3D5M A;  3HP6 A;  2BOP A;  2UUB J;  4WU2 A;  3KJF B;  2BKO A;  5T14 A;  3ZZT A;  3K17 A;  3IBF B;  1XMO F;  5THW A;  2BJD A;  3PTW A;  1F6T A;  4ECQ A;  1S59 A;  2ZJP Q;  3DRR A;  2CQ1 A;  3OJU A;  3T5K A;  1HLW A;  1FNM A;  4J5O A;  2H48 B;  3DRR B;  4LF4 J;  2MQM A;  4JV0 A;  2KB2 A;  3LWM A;  1SL1 A;  1U1K A;  4P2S A;  2JWN A;  1Y7P A;  1HNZ F;  4ED3 A;  2YNH B;  5HRO B;  2ZZN A;  1GXT A;  1T9V A;  2IJN A;  1JXE A;  4CLY A;  3CJ0 A;  2PMH A;  2J0W A;  4LSL B;  3M2R B;  4ELT A;  2E1M C;  4ZP7 A;  2LQB A;  2AJ0 A;  5L38 A;  3PCO B;  2NQP A;  2FLN A;  3VF0 B;  1FFW B;  2YKA A;  2PI4 A;  3QBC A;  2BW7 A;  4CNZ A;  1PKU A;  4DR3 F;  1WG1 A;  1DTT B;  3VAM A;  1VLY A;  1T95 A;  4OYX A;  1JLQ A;  1HHQ A;  4IKA A;  4ZJL A;  3PY8 A;  3JTO A;  2AKW B;  2V5H G;  3EGN A;  1NDK A;  5CYJ A;  3THP A;  2D41 A;  3ZC4 A;  4LVN P;  4NYO A;  2DK2 A;  3SEO A;  5IM0 A;  4ZVP B;  2MZR A;  4USK A;  4XIU A;  2BKP A;  4WK3 A;  2JFK A;  3W3S A;  3TUP A;  2R7W A;  1NZA A;  1M5O C;  3JSM A;  2WSF C;  5IM0 B;  1X4C A;  4YY3 F;  4DLE A;  3I5C A;  4UST A;  2KT5 A;  1I5O B;  4F36 A;  2CPG A;  3MMC A;  1FRK A;  3IMQ J;  2JOQ A;  3TJ9 A;  2CQ4 A;  4WZQ A;  2B43 A;  4CQ1 A;  2HRU A;  3UDC A;  2QFI A;  2YPY A;  2ZNZ A;  4J9N A;  4LF9 F;  1ZAW A;  4KAI A;  3KUG A;  2W1B A;  3UR3 C;  1SQG A;  4KV8 A;  2CNL B;  2E5L J;  4TNO A;  4N76 A;  5HAO A;  1ZTT A;  2VU5 A;  1W7W A;  2EI5 A;  1S6P B;  2CQG A;  4DPX A;  4JV1 A;  5HMX A;  3NY0 A;  1NXI A;  5KFH A;  4B3O A;  1NM2 A;  3MHY A;  3D0I E;  2CJY B;  2YWE A;  1F3V A;  3HT0 A;  4HT7 A;  3P5B P;  3BJY A;  1S48 A;  2B4O A;  2VPW B;  5C2C A;  4I6A A;  3L4B C;  3HHK A;  4B3O B;  3SMZ A;  2ATL A;  3GIJ A;  2GPE A;  1KNZ A;  5C2G A;  4DV1 J;  3B54 A;  2MLZ A;  3UFC X;  1MMN A;  3TA1 A;  2O66 A;  4Q44 A;  4JYA J;  1EP4 A;  4ZVQ B;  2KN4 A;  4H4K C;  4KHP J;  2VPY B;  1PC4 A;  1QVG R;  3OR2 A;  5L39 A;  1SL0 A;  1QTG A;  3Q0A A;  3HJV A;  3IBW A;  2YKP A;  3D67 A;  5ETO A;  2XTJ P;  3Q89 A;  4DPU A;  4Y0F A;  1X5P A;  2IDL A;  1SKR A;  5LL6 d;  3KLV A;  3LWL A;  5KT7 A;  2VG7 B;  2AJ1 A;  3NMA A;  1W2I A;  2LEP A;  1SJF A;  1ACM B;  2CA9 A;  1KFS A;  1EHW A;  2ALY B;  1P94 A;  4RL1 A;  3DXS X;  3AA8 A;  2ATC B;  3HCX A;  2C3Y A;  3KMQ A;  3QFH A;  3PR5 B;  5KFG A;  1TKX A;  1WKJ A;  2LEA A;  3OW2 R;  3NGD A;  4TQR A;  2D3O R;  3U1L A;  1SI9 A;  2FUG 9;  4DV6 F;  4MK8 A;  5D15 A;  3G87 A;  2NPF A;  4CLK A;  1AB8 A;  2LXU A;  2JXI A;  3G6Y A;  2YKM A;  5MLC V;  3TEH B;  4M63 A;  4OYW A;  2CPZ A;  4X4R A;  4BS2 A;  1RCO B;  4WFZ A;  4BHQ A;  3KLI A;  2RF2 B;  3EZU A;  3I5A A;  2XG8 A;  3CMQ A;  3H98 A;  3D3B J;  3GWC A;  3NWG A;  5CAA A;  4GO7 X;  3MF5 A;  4HLB A;  3KLI B;  2DNL A;  1T11 A;  1U6F A;  3BR8 A;  2EG1 A;  3CT9 A;  4PCQ A;  3T5H A;  1LNQ A;  1IKV B;  4OZ2 A;  4F4K A;  4FBT A;  1X4A A;  4UOC A;  4JI2 F;  4IRD A;  1U4B A;  1XK8 A;  1RT4 B;  1LW2 A;  2J9D A;  4ZIV A;  1VQ7 S;  3KHL A;  3CME S;  3GV5 B;  4X62 J;  1RAJ A;  1UVK A;  1U1N A;  2XS5 A;  4DX5 A;  1F2G A;  1NK5 A;  2IFX A;  3DFE A;  3H2L A;  3CCL S;  4DL2 A;  3CJS A;  3GSI A;  3N4W A;  1H7W A;  4LF5 J;  1CLF A;  2GO9 A;  2J8A A;  3ADA C;  1U1R A;  2QL9 B;  1LQ9 A;  1IVZ A;  1KR4 A;  4DUT A;  1Q8I A;  2IVF B;  3DNC A;  1FA0 A;  1Q81 T;  1S9E B;  1WUU A;  3W60 A;  2CPY A;  4C2M A;  3NNH A;  3V4M A;  1QLN A;  2FYX A;  3J80 Y;  4YB7 A;  3CD5 A;  4IDK A;  3DDN A;  4PWW A;  3OVB A;  3V6D B;  3VTI A;  2A6O A;  1RTH A;  3HVR A;  5BR8 J;  3CDW A;  1KQK A;  2ZOF A;  2KFY A;  3NGT A;  1WC1 A;  4EMD A;  1FT8 A;  2AYM A;  4I6W A;  4HHJ A;  3TVZ A;  1UL3 A;  3VHQ A;  1RAD B;  1RTH B;  4JV5 J;  2RJZ A;  5FDL B;  2EKY A;  3TYT A;  3D6H B;  4KKO A;  5J1E A;  2OKQ A;  4RW7 B;  3IFE A;  1H72 C;  4DV0 F;  2KO1 A;  2OJ3 A;  4JI3 J;  5KG1 A;  3G8S A;  4AQY J;  2YY3 A;  3VEB A;  4JI5 F;  2QA4 G;  1UW4 A;  1W2B R;  1HW8 A;  3B82 A;  3TAR A;  1PCA A;  4PYD A;  4B3R J;  3A12 A;  2I8E A;  3QNW B;  3G2X A;  3AA9 A;  1FJC A;  3I9Z A;  3THT A;  2HMI A;  1N34 J;  4KGX B;  3IS9 B;  1WHX A;  5DRK A;  2WRM A;  3Q22 A;  1N0U A;  2UVW A;  4NI2 B;  1K44 A;  4UT4 A;  4CO5 A;  3EYZ A;  3OL7 A;  3LP1 A;  3QT8 A;  4UF4 A;  4RW9 B;  2CYY A;  1ZOT A;  3EIC A;  4NE9 C;  4C8N A;  4WP3 A;  3B4D A;  3LP1 B;  3MDF A;  4L6V 3;  1ZM9 A;  3R5A A;  2B3T B;  3IAS 9;  2NZC A;  3ILL A;  3TQE A;  1WC0 A;  2DNO A;  3KG0 A;  3M30 A;  1LW0 A;  5FII A;  2RRN A;  1EIY B;  2IYI A;  2ALZ A;  3W5Y A;  3ITH A;  1N8R T;  3G96 A;  3VZH A;  2AWZ A;  4DV7 F;  2I9S A;  5EX3 A;  3DLB A;  3CGI A;  2MQQ A;  2YKN B;  1ICE B;  3NCR A;  3LAM A;  1XNQ F;  1GMW A;  1VQS A;  5DZ7 A;  2D1C A;  1YK9 A;  1BQN A;  1YJV A;  1KS2 A;  3JXO A;  2ZH5 A;  5KOW A;  3BM7 A;  5B08 A;  2QFJ A;  3VWS A;  3UPF A;  3LA0 A;  4AE5 A;  3OTB A;  4X4O A;  4H4K A;  3PRV A;  1N52 B;  2G2O A;  3RZA A;  4LBH A;  4C8M A;  2FJE B;  2VF3 A;  4FKX A;  3T19 A;  3M9N B;  2CQ0 A;  2KVQ E;  2N4D A;  3X3U A;  2BA9 A;  4QYZ J;  3PHE A;  3N6L A;  1TKT A;  4Y2K A;  4BC9 A;  2QN6 B;  1N5S A;  4LSZ B;  4ILM A;  4GMK A;  3CCU S;  2P9C A;  1TKT B;  3D9B A;  2KRR A;  2W7P A;  5LM7 E;  4TQS A;  5BYS A;  3HMJ G;  1Q5Y A;  1J2V A;  3M8S A;  1SJQ A;  1T7P A;  2ZUA A;  4RUA A;  4FVC A;  4DSI A;  4XDC A;  2HQF A;  4J9V A;  1S49 A;  3KHH A;  4QYR A;  4EUV A;  2K5J A;  2W25 A;  2Z58 B;  2W2N P;  2L9W A;  3L09 A;  3TZX A;  2M70 A;  4PUO A;  1OQ3 A;  3M8W A;  1KVJ A;  1LOU A;  1L5U A;  1HW9 A;  1Q53 A;  2GMJ A;  5C25 A;  1RJJ A;  2VIH A;  3T1Y F;  4K4X A;  3AY0 A;  3AHP A;  1KTQ A;  5LXY A;  4QOT A;  2AYE A;  3PX4 A;  2IBO A;  2CPH A;  5C25 B;  2XB2 D;  1TZ0 A;  3VCD A;  4CO3 A;  4AL5 A;  1JLC A;  4NL5 A;  3ENV A;  4DV4 J;  4ZPD A;  3FMW A;  2EC2 A;  1M0S A;  3EVM A;  1JLC B;  1FKP B;  5K8M A;  5J2N B;  3P6Y C;  3LUY A;  2KKE A;  5JMN A;  3PJ9 A;  1X9M A;  1S1V A;  3QZ8 A;  3SQO P;  1M5H A;  2MSS A;  2UUA F;  1JLE A;  3C16 A;  2EVZ A;  3MXH P;  4R8U A;  2EWH A;  2HNY B;  2M8D B;  4AXI A;  1SVD A;  2JLE A;  4F67 A;  4PWU A;  4B3M J;  2A2C A;  1RT7 B;  2W9B B;  4X64 F;  2E9R X;  4NWB A;  4JI0 F;  1JLE B;  1OSD A;  1HBN A;  4CLP A;  1QAY A;  3QRR A;  4DLG A;  3UVJ B;  4DDF A;  4DR2 F;  2RB7 A;  1V3R A;  3O3L A;  1S1U A;  1U6Z A;  4NRU A;  4QIG A;  1A9N B;  1NUE A;  3FQK A;  2IA6 A;  3ZZP A;  2UUB F;  1S1U B;  1RTI B;  3PW7 A;  4M1K A;  1TKZ B;  3TRG A;  4DOZ A;  4QR2 A;  5K9F A;  1GQE A;  3CED A;  2KHD A;  1TVR A;  4LFB F;  3L7O A;  1ZA2 B;  1RT1 A;  1FNO A;  1C0U B;  4R0E A;  2DRB A;  3TW0 A;  2M7S A;  1VIS A;  4A8Y A;  4YR2 A;  3CMA S;  2O67 A;  4WFB Q;  2H9Z A;  5I42 A;  3ZTO A;  2HZC A;  2R7T A;  2JL9 A;  1EX8 A;  5LMN J;  3G9C A;  2JRS A;  5LOQ A;  1CSJ A;  5I42 B;  1MU2 A;  4C7Q A;  3DI6 A;  1CJU B;  2H4Y B;  1UZH A;  1FNX H;  3NGK A;  1F60 B;  1YJT A;  2AMC B;  2FJA B;  2M88 A;  5A2Q Y;  3UD3 P;  2JEJ A;  1CQM A;  1TK5 A;  3RB0 A;  4CLF A;  3DGV A;  2W9C B;  2FHK A;  3MMB B;  2BYC A;  1DRZ A;  3DLL Q;  2FZG B;  1NLA A;  1HBU B;  1MN7 A;  3OFF A;  4ZPA A;  5HP1 B;  2FQQ B;  1Q82 T;  5DLG A;  2CVI A;  3VAI A;  1RT3 A;  1TAQ A;  4UQT A;  2B51 A;  2RQC A;  2ZUG A;  4PRF A;  2OTL S;  2NXC A;  2NXN A;  1U9P A;  3K7R A;  2BV3 A;  1ELO A;  1RT3 B;  3JSR A;  3LO3 A;  3M4X A;  2XMA A;  5JVH Q;  1IR2 A;  4YP3 A;  2E5G A;  4E0D A;  1VYA A;  4DL6 A;  2ZVS A;  3BGL A;  2Z2Z A;  1S6U A;  2OAU A;  1ZZF A;  1UPP A;  1P9Y A;  1L3K A;  1PG5 B;  3OFE A;  1J5O A;  2DNH A;  3I0S A;  3HSD A;  4J9L A;  1LWF A;  2WHO A;  4C3M A;  3FSY A;  2DB1 A;  3HVW A;  4WJB A;  3HHE A;  3BYP A;  1HI0 P;  1QSS A;  2YNF A;  5IQ6 A;  1SV5 B;  4F3O A;  4DFP A;  2OO4 A;  2AD9 A;  3P45 B;  2D3O 1;  2LCW A;  4WFA Q;  4Q2L A;  1YBT A;  2YNF B;  2C2K B;  1S5Z A;  5MAO A;  3PRD A;  2CNN B;  3CE8 A;  4YN3 B;  2E5L F;  2LQ9 A;  4IH6 A;  1SL2 A;  2DPI A;  2XMU A;  3I56 S;  2XS7 A;  4XO0 A;  5F8M A;  2CPE A;  3FRY A;  2GFF A;  5LJ5 Y;  1XER A;  5HMW A;  3FSI A;  2HBZ B;  3A8I A;  3HPO A;  3AOC A;  2CWX A;  5DM7 Q;  4L76 A;  1I1G A;  1JMT A;  4HT5 A;  2NXU A;  1NJY A;  1TQL A;  3J80 U;  1HBM A;  4DV1 F;  1UWA A;  3FBC A;  3EX7 B;  4ICL B;  2Y9H A;  5AXK A;  1WG4 A;  4DQP A;  8RUC A;  4WTO B;  4KHP F;  2BRL A;  2CQD A;  1VJW A;  4XK8 C;  4EFA C;  5KFD A;  2XY7 A;  3V5R A;  4A8M P;  2CFX A;  2RUS A;  4TLQ A;  1KQG B;  3KK1 B;  1MG7 A;  4DL7 A;  1RWM B;  3H90 A;  4HKQ A;  3R2D J;  2OP5 A;  3QO9 B;  4C0B A;  3IM9 A;  4X66 J;  4MKV A;  3M2U B;  3QLH B;  1WWH A;  1BMQ B;  3DGP A;  2UXD J;  3FEX B;  3DU5 A;  1VQY A;  4RNN A;  4PZV A;  3GR1 A;  2RIJ A;  1NJX A;  1IBK J;  2CIM A;  5IQQ A;  2QLJ B;  1LWX A;  1REV A;  1U49 A;  1SIW B;  2D9P A;  2DIS A;  5JXS A;  5CYM B;  4DL3 A;  3MCO A;  1XMQ J;  2RRB A;  2VKZ G;  3NLC A;  1REG X;  3GQC A;  2V8D A;  2U1A A;  2BR0 A;  3OBI A;  1Q95 G;  5J2M A;  2WW8 A;  4KHM A;  2OTJ S;  4A8F A;  4ED6 A;  3TO8 A;  4RW4 A;  1YBU A;  4D3H A;  1RWW B;  1F5A A;  4CH0 S;  3WX4 A;  2W2P P;  5KFF A;  2UP1 A;  1D0E A;  1U09 A;  4OLO A;  4QPX A;  2HGN A;  2F40 A;  2XI3 A;  2UXC J;  3ZZ0 A;  1YRX A;  1IBM J;  3FBF A;  4P2F A;  4X4N A;  1V6H A;  4CWB A;  3BQ0 A;  4MTP A;  4W92 B;  1X31 C;  5GAD I;  1PIE A;  2VBX A;  2MKY A;  1F2H A;  2PA8 D;  4F3Q A;  4O3O A;  4X62 F;  2E44 A;  1YSJ A;  5A0Y B;  5GAE I;  3M8P B;  2HS0 A;  3D0G E;  4DSJ A;  4OHY A;  2QG9 B;  2JNJ A;  4RW8 B;  4H4O A;  3Q8Y A;  4PQA A;  2KU7 A;  2WW4 A;  2V8H A;  2KG0 A;  5DDR C;  5AXM A;  4J9O A;  3MM8 B;  1CPZ A;  3NOC A;  3UNY A;  4Q43 A;  1CS4 A;  1IKY A;  1RKJ A;  2B7B B;  1LXN A;  1NHU A;  2RE1 A;  1Q5V A;  1SXL A;  1NK7 A;  3G5O A;  1DTQ B;  1QJH A;  2UUC J;  5KG3 A;  4RPF A;  3MPV A;  4CTA A;  2ZBI A;  1E6V B;  2JSX A;  3Q8Q B;  5KFT A;  2UVR A;  1U1L A;  1A7G E;  1HHS A;  1RAO A;  2VFS A;  3M32 B;  2YX4 A;  2HVH A;  3I9V 9;  5H9E K;  4OZ0 A;  3PJW A;  2RS2 A;  3BDE A;  3DYA A;  2XM3 A;  2DYA A;  3DRS B;  3B4M A;  4UZC A;  5L9N A;  5C24 B;  1JKH A;  2K06 A;  3PO5 A;  3GFH A;  3FK4 A;  4K4W A;  3KLG B;  5HMY A;  3CCS S;  3CCW A;  3NO7 A;  5BR8 F;  4PXD A;  1EJ7 L;  1FX2 A;  2I2Y A;  4F4Z A;  1JKH B;  3I0R B;  4X4T A;  4FF1 A;  1D8Z A;  4IRC A;  4JV5 F;  2A1B A;  4BCA A;  4I0W A;  3PG9 A;  4Z37 A;  3KK2 A;  1WHY A;  3KK3 A;  1U2C A;  3UI3 A;  4DV2 J;  3OLB A;  4GVL A;  4MJW A;  3PW4 A;  3BGO P;  1BQM A;  1IRQ A;  3KK2 B;  2B9X A;  4OYI A;  4B3R F;  1WOS A;  2ZBR A;  5EUH A;  4MH8 A;  5EDW A;  5C7P A;  1T05 B;  3JSY A;  1P27 B;  2Y0B B;  1N34 F;  1BQM B;  5LSL A;  1RAE B;  1SQF A;  2ZKT A;  1FRH A;  5KFK A;  2JC0 A;  4CO1 A;  4ZIW A;  1X4B A;  1JLG A;  2J5A A;  1S4E A;  4Z2X A;  4ID5 A;  1ZPV A;  3WIV A;  3G4S S;  2Y3Y A;  2WOM A;  3AXM A;  4ELV A;  3AOB A;  4RUH A;  5EGY A;  1YGY A;  1JLG B;  3CC7 S;  3TUI C;  1S0N A;  3NNC A;  3QAE A;  2QE5 A;  2DHX A;  5KG2 A;  4NEZ A;  2Q6B A;  2AP6 A;  2PGC A;  4WFN Q;  4LRD A;  3CCM S;  1KP6 A;  2BJ3 A;  1NJW A;  4RNO A;  1X8D A;  1OWX A;  3OD2 A;  1XR7 A;  4ECS A;  1OJ4 A;  2RD5 C;  3FQL A;  2HHW A;  2DD8 S;  2R8I A;  2AU0 A;  2QRR A;  3FFI A;  2MGZ A;  1FER A;  4KQZ A;  2ZH2 A;  1WC3 A;  1T9Y A;  1DQ8 A;  4JI4 F;  1QE1 A;  2HGL A;  4M5I A;  1FXD A;  2N7C A;  3T9N A;  2HS4 A;  4M5D A;  4UTG A;  2UV8 A;  2CNO B;  2HAI A;  5HQM A;  5KG6 A;  5RUB A;  3AT1 B;  3W63 A;  4OV6 A;  2MPU A;  3UD4 P;  3K8V A;  3G6E S;  4EEY A;  4MFB A;  2ADL A;  1WJ9 A;  3MUM P;  4HTI A;  1JJ4 A;  2I0X A;  1SC3 B;  2HGM A;  2EBE A;  1X9S A;  1SCJ B;  3BDP A;  4ED5 A;  2W9A A;  5M2P A;  4ZLN A;  3MM7 B;  4A4J A;  4ED1 A;  2K9I A;  1GTE A;  3ZFV A;  3MCN A;  2A6M A;  3GU0 A;  3O8W A;  2DR7 A;  2CXE A;  1GAO A;  5A2Q U;  1M5V C;  4MYU A;  2JFD A;  3F56 A;  4R0J A;  1U0H A;  3IC1 A;  1BDV A;  2VB6 A;  4LSN B;  2AF6 A;  4OZJ A;  3AD7 C;  1IKW A;  1JNZ B;  2CDR B;  1U0H B;  4YS2 A;  3N6M A;  1UVL A;  1I94 J;  2XMK A;  3SBM A;  2ASL A;  1FD8 A;  1S6Q A;  1DLO A;  2FDN A;  3H20 A;  4ZVU B;  4C11 B;  3T5J A;  2WTF A;  1VQM S;  2V34 A;  1NK4 A;  3SFU A;  2JDJ A;  4Y6I A;  1QUV A;  2KYZ A;  2J76 E;  4NAS A;  4FYY B;  2J6U A;  1VK8 A;  2Y1L B;  2DGV A;  2FD2 A;  4XPE A;  5D3G A;  5F0W A;  2PT0 A;  5KFS A;  4LF2 A;  3ILJ A;  3CUN A;  1WF1 A;  5KT6 A;  2B7C B;  4DV4 F;  4ED7 A;  2KM8 C;  1R6V A;  4GC7 A;  1DQA A;  5D3G B;  1K47 A;  3EXC X;  1WF0 A;  9ATC B;  2DRA A;  4RBU A;  5CD4 H;  5D6G A;  3PFO A;  1FTC A;  2CQH A;  4YUD A;  2DY1 A;  5U47 A;  1U1P A;  1Y5I B;  4ETX A;  1C0T A;  2BNZ A;  1SH3 A;  1FXL A;  1MW7 A;  4B3M F;  3CC2 S;  3AJ1 A;  4NCG A;  6FD1 A;  2FJW A;  2LKZ A;  2V50 A;  2ZDP A;  2BQR A;  3VGS A;  2ZC4 A;  3Q24 A;  2VJV A;  3FBB A; 
#chains in the Genus database with same CATH homology
 3VEB A;  2GPE A;  1Q5V A;  3QOQ A;  2K5J A;  2JXI A;  2FGC A;  2K6L A;  2BJ7 A;  2F1F A;  1BAZ A;  1MYK A;  2HZA A;  3LGH A;  1MNT A;  2BNW A;  3GXQ A;  2CPG A;  1ARR A;  1QTG A;  3BKU A;  3H87 C;  2HZV A;  2CAD A;  2CAJ A;  1EA4 A;  3PHT A;  2BA3 A;  4FXE A;  3QSI A;  2KEL A;  2Y3Y A;  1ARQ A;  1B28 A;  2WVF A;  1BDT A;  3FMT A;  1PAR A;  2BJ1 A;  2BSQ E;  3BKF A;  1NLA A;  3BKT A;  2K9I A;  4D8J A;  2WVB A;  4ME7 E;  3VEA A;  2AY0 A;  2CAX A;  3VW4 A;  1X93 A;  2CA9 A;  1P94 A;  1U9P A;  2JXH A;  1MYL A;  1BDV A;  2BJ9 A;  2BNZ A;  2NZC A;  4HV0 A;  2WVE A;  2BJ3 A;  2H1O E;  2RBF A;  2BJ8 A;  3OD2 A;  1Q5Y A;  2K29 A;  2WVD A;  2PC6 A;  2WVC A;  2JXG A;  1B01 A;  3FT7 A;  2K1O A;  1IRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...