2WVBA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
130
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTAIAMDEHNSLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 36
structure length 130
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvbA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvbA02
1U9PA 3GXQA 2K5JA 4D8JA 2K29A 1B28A 2BJ3A 2JXGA 3VEAA 2WVDA 3OD2A 2K9IA 2Y3YA 1NLAA 2JXHA 1EA4A 1B01A 2WVFA 2H1OE 3BKTA 2BJ1A 4HV0A 1X93A 2BJ9A 2WVEA 2BJ7A 2WVCA 3BKFA 2CA9A 2CPGA 2HZAA 3VW4A 2BNWA 1ARQA 1P94A 3FT7A 2BA3A 3H87C 2K1OA 3QOQA 1BDVA 2AY0A 3LGHA 4ME7E 1Q5YA 2BNZA 2HZVA 1MNTA 2GPEA 2NZCA 2CADA 1IRQA 1BAZA 2PC6A 2K6LA 2BSQE 2WVBA 3PHTA 1ARRA 3FMTA 1MYKA 1PARA 2RBFA 1QTGA 3QSIA 2CAJA 2KELA 1BDTA 1Q5VA 3VEBA 2BJ8A 2CAXA 4FXEA 2JXIA 1MYLA 2F1FA 2FGCA 3BKUA
chains in the Genus database with same CATH superfamily
5B09A 2WOMB 2XBPA 5F41A 2WK4A 5HQLA 4Y28C 3GIRA 1LOUA 2DGVA 1FNXH 2E29A 1A0OB 2GHWA 2RJZA 4OYPA 4K4WA 1CSJA 2KJVA 1DLOB 1KLMA 2KVQE 2Z2LA 1PCAA 2VOOA 3L7UA 2VJUA 4CM2A 3LPEA 5LSLA 1KQGB 2ZDOA 3AA9A 2E5IA 2NPIA 3VAGA 1M1HA 3H87C 2HFOA 4OI3A 2NR0A 3MD3A 3V6HA 2W8KA 4R25A 4UOFA 2QLFB 4OI1A 5FLXY 2G13A 2C3PA 4X2BA 3ONQA 2XMVA 4KFBB 3B8HA 4RW4A 2DNMA 2PI4A 1R3NA 2LU2A 3LF0A 4JI2F 3LP1B 2AJ2A 3MPUB 1VK3A 3ZZ0A 1DTTA 1Y7PA 1KOHA 1R89A 3PJ9A 4NYOA 4ZLLA 1YSJA 2UUAF 4IOBA 1CPZA 3SSSA 2LA4A 1FCAA 1X4FA 4I2QB 5CYJA 2OFHX 2DH9A 2BV3A 3I6PA 3SV3A 2YNFB 2JL9A 5KG5A 4NLGA 1PJ7A 3JQJA 2JHEA 1LKZA 3RB0A 2RDIA 4W98A 2BANA 5DDRC 4WCEQ 1XC9A 2AV5A 1TL5A 5FJ4A 1NHKL 2M52A 1IBMJ 2M9KA 3EZUA 1X9WA 1RK8A 1DLOA 1KLMB 4EI2A 2K06A 3AOBA 3MD1A 1ZPWX 2VBWA 1WOPA 4ELUA 4FYXB 4DQRA 4C8ZA 2CPEA 4R8UA 3CWJA 4PWWA 1RTIA 1IN0A 2ZE2B 2ZH2A 4L73A 4WJBA 1FD2A 4PPDA 4LF9F 2VG6B 4DSEA 1R31A 3EICA 5J2QA 1PAUB 1O51A 4D8JA 1TU0B 5K5MA 4LF6F 2MZRA 1IKXA 3MCOA 2DH7A 4ECTA 1Z2ZA 1RTZA 5G4DA 1YJ9S 4DL4A 5LXYA 3A8KA 3LTOA 1RU1A 4NZ6A 2Z56B 2QRRA 2DHHA 1FXLA 2K8GA 4MYTA 2KZMA 1N5YA 2AGQA 1MWYA 1Y3JA 3G2XA 1IXKA 3N6LA 1SC1B 4ZPDA 2NREA 3M2UB 4MFBA 3OVSA 3PX6A 3HXMA 1U6BA 3EXYA 2D3O1 2UXCF 2BR0A 3JSBA 3TAMB 1RTHA 2YNIA 3AB2B 2NYHA 3OFHA 4H4KC 1XR5A 5D0EA 4P10A 5E3RA 2B7BB 2GGPA 1SVDA 3ET6A 4I0WA 3MMBB 1PBAA 2GFFA 2HMIA 1C1CA 1Q16B 5ETVA 2XMKA 3CCWA 2EKYA 2F9DA 1MG7A 2HQCA 2V2KA 4USIA 3DHXA 1NK8A 1LWCB 1RT1A 1CLFA 2ACYA 5EDWA 2MGZB 1GTHA 4LFAF 2RKIB 4IR9A 1WHXA 1WD6A 3BM7A 3LP0B 1RTDB 1TP7A 1FKPA 5KFJA 2LU1A 3C66A 3I9ZA 2XGPA 2XEXA 3GFXA 2ZD1B 4CLKA 1LEOA 3GFHA 1F60B 2MZ1A 3R27A 2B4OA 5LM7E 2AEJA 4A8QA 3DRPA 1Y0HA 5CCLA 3G8QA 2AYBA 4DR1F 2DNKA 2GMHA 5CD4A 1O6XA 1L3SA 2OJ3A 4WF9Q 1HQEB 3D1QA 1NSKL 1KFDA 5KG2A 1WKLA 4JBCA 4A47A 5DJBA 1B4SA 1KOOA 3W2VA 2J8SA 1H73A 5HQ8A 2HHUA 1UFWA 2HBRB 2PIIA 4MAKA 5IV4A 1CULA 1NH8A 4IO9Q 5D15A 3CT9A 2L08A 4YQWA 3CJ3A 3F44A 3KNAA 1S1TB 5T14A 3OJSA 4DLGA 4OI0A 1RAOA 5FDLA 2M8DB 1V9OA 3VTIA 3SSQA 2N4DA 3NGSA 4ZOSA 1ZM4A 1XJWB 3HP6A 4I6YA 2GJIA 3CJKA 2ZITA 4HI1A 1KD1T 5CD4H 4X4NA 5K8OA 3W7BA 1GK8A 1GXLA 3GG0A 1WHYA 2HK2A 4OLPA 1RAFB 1FTCA 2EWHA 2DB1A 1FESA 2D41A 3HMJG 2B9YA 5JVHQ 4IFYB 1RAGB 1TTHB 1WOOA 2VPWB 3D6TB 2J6UA 4B9NA 2UXBJ 9ATCB 1Q5VA 2EKNA 4RWWA 3GCWP 3TQEA 2NPFA 2PA8D 1PBUA 1VISA 1ZH5A 1N54B 3NAIA 2KVIA 5E3CA 1IBKF 4JI7F 3A8IA 1NB7A 2UUCF 3KUHA 1D9DA 1X4CA 1NJZA 2KXNB 1WC1A 2GO9A 1CJTB 5ITHA 3D0GE 1FDDA 4JI1J 4KHPJ 3LO3A 1NJYA 4TKTA 3FRZA 4J9RA 3HO1A 2WVCA 2E44A 2HQGA 2GQQA 3BN7A 5D0RA 3UVJB 1JLCA 5HVGA 2HPUA 2CQ4A 2GMJA 3KJNB 4OHXA 4WFXA 5HATA 2ZFHA 3ZZYA 4DZ6A 5HSPA 3NOCA 3RRGA 4QR0A 1KDNA 4NMLA 3OFFA 4ECYA 1K1QA 3FCVA 2Q6CA 1CC7A 4P6QA 2D1CA 2B8PA 4HVZA 2HHHJ 3AXMA 5HLFB 2OFGX 4LF1A 5CHCB 4OYZA 3NEKA 1Q78A 1HNXJ 3PRDA 4KGVB 1RA7A 2YKPA 2HG4A 5IZHA 4DL3A 2MQQA 1IR1A 1OSDA 1ZA1B 1YRUA 3C16A 5KAKA 3GIMA 2JXGA 2YBVA 1MROB 5F9NA 2VA3A 1DQ9A 1F5AA 4K59A 4QIEA 1WDDA 2QT7A 3UVJA 2H1OE 1VDHA 4C48A 3T5HA 3PX4A 4K4VA 2E5LF 5KFZA 4WIQA 4N56A 3D66A 3FVYA 4Y00A 3PY8A 4DS5A 4EZ9A 3FT7A 2C2DA 2UU9J 2C42A 4TY9A 4M8LA 2BMBA 3WC2A 4M94A 4K5SA 3BR9A 4S0MA 3TVKA 2DGUA 4KGKA 3SZ2A 5CYMB 1D9AA 1RTDA 2UV8G 1D09B 3WQPA 2FLOA 3G5OA 3CTRA 1BAZA 1WI8A 3ISZA 4KGMA 4F3QA 3KMSA 4OZNA 1YZ7A 2E1CA 2UUBF 1Q86T 2HVIA 3QIPB 4K4ZA 1N33F 1Y9OA 2VV5A 4WFAQ 2DCUB 2ZUGA 3JSYA 3OL7A 4DR5F 4XDCA 2KKHA 1KRPA 4CCHA 4ERDA 3OTOF 2CQ1A 4NCGA 4WP9A 1FVQA 2J5AA 3DDNA 3M1VB 3M7VA 3MCNA 2F4VJ 1F6TA 3C14B 5THWA 1UW9A 2B5JB 3AQOA 2W1BA 3DLEB 3TAQA 1S1WB 2ZM6J 4LMZA 2NZ4A 5D8HB 2J8AA 2HQDA 1DARA 2DIUA 4O4RA 2HHSA 4CYUA 4JV0A 3T1YJ 2PMHA 2V4JA 5FDLB 2Y0SD 2BABA 1TKZA 5HJYA 1SKRA 4IRKA 1TL7B 1TELA 2E1RA 2ROEA 4C2MA 1SKSA 1YJWS 5BYRA 2HW3A 4O44B 2QN6B 3S8SA 1S1UA 4ZITA 1CJUB 3B82A 2DHAA 1IM4A 2RF2B 5J2QB 3UN5A 1TK8A 3M05A 3DN9A 1RWMB 2OD6A 3AQPA 2YQ1A 4RNHA 1V3RA 5BYQA 5HMYA 1ZAVA 1F2GA 2BKPA 3M6XA 3IS9B 2ALYB 2HNZA 1FRLA 3H2VE 2JX2A 2FJDB 3PACA 3ZZOA 5GAEU 2CPXA 2WRMA 1U9PA 2XO6A 2QA4G 2GC8A 3HD1A 2KM8B 4A8MP 4I7FB 4M5NA 5KG4A 1U6ZA 5IFMA 2OPPA 3H2UB 1HBMB 1YJ7A 3MR6A 1U0HB 4ZVTB 5I42A 4ALZA 5KFRA 4ZK7M 3UCZP 1XN9A 2BQ3A 1TV6A 3M32A 3VGTA 3HHNB 2W25A 3W5ZA 4DV5F 5HMWA 1NB2A 1LWCA 1RT1B 4J9VA 3OUYA 7FDRA 3H90A 2FHJD 1YBAA 2ZH7A 4ILLA 3CC4S 2YTCA 1NRKA 1ZOTA 4J7CA 1FHTA 3FUYA 5L1JA 1ZZFA 3IRXB 2Z2ZA 2CAJA 3EDRB 3QPIA 2L9DA 1LFPA 4ECXA 3C6UA 4DPTA 2Q3PA 1NSQA 2R8GA 1TVRA 1FNOA 2FGCA 2NLWA 4DL2A 1FJGF 3HVTB 3UN2A 4UT4A 5HN0A 2KZZA 1J5EJ 3THTA 3I56S 1EARA 1EETA 1MU2A 4URGA 4X65J 2VQEF 3BO3A 2FLPA 1B0PA 3NGDA 1TMMA 4LRAA 1U1NA 3D68A 5B08A 1XR7A 3T9ZA 2UUWA 1FEHA 2YXLA 4AE5A 1IKXB 4OYMA 4Y0FA 1NZ8A 4FN5A 1YX2A 4F0KA 1DRZA 1FFGB 4KJIA 2FVPA 1IKVA 4JI1F 3JQKA 1KVJA 1PIEA 1QY7A 2AEFA 3C19A 1MSWD 3KLEB 3PHTA 4ECRA 4QWBA 1HBNB 4K5RA 2F65A 1QVGR 2GVDB 2VB6A 3BR8A 5MAOA 2GX8A 1S1XB 1GTEA 3QLHA 3I55S 2CJKA 4CLWA 4FF3A 2UUTA 5JMNA 2M5YA 1IWGA 1A7GE 4DPWA 4GVLA 3OPKA 5C25A 2D9OA 4NLVA 2BANB 2UZAA 5RUBA 1UA0A 4K0KF 2BJ1A 1LWEA 1REVA 2HURA 1JLGB 4FKXA 4CLPA 2D3UA 2YNFA 4Z7YA 1HNWJ 3QZ7A 3FEXB 1VHIA 2G0IA 2OELA 3NY0A 3J7YU 3O1LA 2XS7A 5HK4A 2XGQA 5IC4B 3OSPA 1VYAA 1CJKA 3H7HB 3CJ0A 2NZCA 5ETSA 3SEOA 3GV5B 4NLWA 3Q8QB 1XNRJ 1KSPA 4PCQA 2KHCA 3M8SA 3C2PA 2ZBRA 2R8KA 3BH7B 1LWFA 4ECQA 4I2PB 1U7LA 4LRCA 4L72B 5AXMA 2W9AA 4M1KA 4NYZA 1VQOS 3F0NA 3EYZA 2ZOGA 3A1YG 1Q8BA 2XNRA 4DV4J 3CCSS 3K8VA 2RIJA 1TV6B 2FY8A 2GA7A 1PG5B 2HAFA 4OJ1A 4TLRA 2RU3A 1U0HA 1Y5IB 2NYIA 4Z37A 1WEZA 2GQ2A 4LFBF 5DO2A 1UL3A 1QDUB 1S0VA 1ARQA 2W2PP 2KU7A 3LA0A 3BGRA 3QLHB 4HYKA 2H54B 4QBUA 4BBYA 4RKUC 3WBZA 2BRLA 4N47A 3W5YA 2HNZB 2V63A 4K4XA 2COLA 1JKHA 1EJ7L 3I0RA 3L7PA 3FMTA 4LBPA 4RWXA 3T6JA 3DKDA 2IAJB 4HTIA 1F5BA 3KG1A 2KRRA 5LT5A 1W26A 5DQGA 2DNPA 2YPYA 4U67Q 3GU0A 3W9HA 4ANCA 4YY3J 1YJNS 1FK9B 1RHKB 1RBAA 1S10A 1ZA2B 5CAAA 4DCOB 1BQMA 2OPQA 3NGRA 1M5KC 2K1RA 3NCQA 2B4UA 2E7WA 3OR1B 3TWZA 4ATNA 5KFWA 2BKOA 1TFYA 2CPZA 3OVAA 5A0YA 2ADLA 2Q2KA 3NWGA 3N5BA 1XNQJ 3CULA 1NZAA 4IG0A 4AQYJ 3NNHA 3DMJA 2M70A 3MMJA 3RW7A 4GO5X 1FI4A 1VQYA 2IJNA 3CB4A 4ES1A 4NCGB 1Q5YA 1R27B 3M30A 1PAEX 2CADA 4JB8B 4ED1A 3KLIA 1S6PA 1OPZA 2X1BA 3C6TA 3DOLB 3MMAA 4OZJA 5K14A 4ELTA 3M8PA 4LBHA 4F50A 3HHLC 1FRJA 4OI2A 3PEJA 4ZPCA 3CC7S 1M1GA 2P9GA 4AFFA 2DGOA 3M6WA 3U7JA 1PKUA 1RAAB 3MPYA 3HHDA 4QCLA 1K9MT 2OPSA 4PYDA 2EVZA 2R4FA 2M3DA 1NK5A 2DNLA 3GCXP 1WKKA 1LXNA 4B9MA 2F3JA 4RNFA 1FERA 3BZQA 4NEZA 2O5DA 5AE3A 5F8GA 4FPIA 1I3OB 2VBXA 1SPBP 3AD8C 3OXGA 1NPPA 3ZTSA 3GQCA 2BKNA 2V5HG 4NI2A 3UR0A 3PW0A 3PW4A 2Z0GA 2ZNYA 5HBMA 4PQAA 4DX6A 3DRSB 2J0WA 1N52B 4HR2A 2E1AA 2DNNA 5IC6B 1S6UA 4AUKA 3GR1A 8ATCB 4R5PA 3G96A 1KS2A 2BRKA 1Q95G 2OTLS 1RT2B 3HKZD 1HIYA 2A1BA 3R5AA 3T5KA 4CYUB 5IT9U 3BS9A 2F63A 3AJ2A 4K4TA 4TVAB 2YKNA 3UPFA 1S1WA 5J1NA 2CZ4A 2M2BA 1JLCB 1URRA 2N4CA 1D8ZA 2XULA 4WU3A 5D0GA 6FD1A 1U1PA 3PO5A 3J7A1 1JLFB 3M1VA 4E8UA 4DWIA 4EWTA 4UY85 3G9CA 1KTQA 3IN5A 2YNGA 4J9OA 2W2OP 4AD6A 3ZZTA 4IO1A 2C3OA 3RBDA 2DO0A 3HT3A 2JLEA 2DTJA 4RU2A 3MTKA 3KK3A 1T94A 2WONB 5KFGA 3NOGA 1RWKB 4DFKA 5B0EA 4B3TF 4ANDA 4C8LA 5DG9A 2X1AA 1EETB 1ICEB 2B9WA 2GVZA 3TO8A 1SQGA 3MEEA 5KFUA 1FVSA 1B01A 4C9DA 2XSJB 4E0DA 3KLFA 4ID5A 4HT7A 3WC0A 3H2LA 3K2YA 2Q43A 3M2RB 5LJ3Y 5KFSA 3ZNUA 1VQ9S 4UOGA 4C11A 2VFTA 4JV2A 4Q44A 2P9EA 2JEJA 1I94F 4Y65A 3OT9A 2QSWA 5M2UA 2WVEA 2RUGA 3QMQA 3Q83A 1JLAB 2U1AA 1UWBA 2LVWA 2A3JA 4G1QB 4J91A 3MAHA 1IQTA 2GIRA 2VDHA 5C5JA 1VQNS 1AXQA 2H4WB 5GAEI 1BLUA 4KPCA 2GS8A 1FJCA 3EGNA 3KTQA 4DR6J 3I0SB 1DQ8A 1F1BB 1WHWA 2FJBB 4MIWA 4P2MA 4V1Ak 4ZVRB 5J1EB 1JLBB 3H98A 1YRTA 5ETPA 3MM6A 3BDEA 3O6QA 5IV3A 3CJSA 2XHWA 4WE1A 5A6WA 1FF2A 3W60A 5IS2A 2W9BB 4V19X 3HHEA 4LF5F 4B3OB 1UVIA 3PYDA 1T3NA 3ISNC 4Q0BB 2FJEB 1KVIA 3QIDA 2MSTA 3H20A 3PCOB 1TKTB 1N5QA 2VIHA 1V3ZA 4O3RA 1ZM9A 2VPZB 3HFKA 2ATCB 4OYBA 2H4YB 5KT3A 2EW9A 3BPDA 3JSRA 3MR7A 2OGUA 2GMLA 1S57A 3L95X 3ZTQA 3DOMA 3TNVA 2A2CA 5KFLA 4ER8A 5ETTA 3PVXA 2V4JB 5CCMA 4HL9A 3CPWR 4G1IA 1U49A 2C2OB 2CDRB 3D0IE 4NXMJ 2MQNA 3M2VB 1XR6A 2AF6A 2RAQA 4IFYA 4MKAA 3JTNA 5C2GA 2AJQA 2BYCA 3L09A 5B0GA 1OO0B 3EUNA 2CQCA 4Z2XA 5DGAA 3QO9A 1BC6A 1QUPA 3BQ2A 3NAHA 3K17A 1KQSR 2HS4A 2OMOA 3DCAA 1FEEA 2YX1A 3D9BA 4PXDA 1HLWA 4LUBA 4HACA 4PZVA 2B6AA 4WYLA 1A9NB 2V2QA 1OQ6A 4Y2KA 2CKWA 3QNWB 3VZHA 4B3MF 1GMWA 2MQOA 5F8JA 5E7OB 5L46A 5M2RA 4JUZA 2ZH6A 3NXZA 3RBXA 3MF5A 1WC6A 3OFEA 4ZJOA 3A8EA 4CT9A 1RP5A 4OYAA 3DOMB 5FIIA 3SIPB 4IFVB 3BGUA 4P75A 1J27A 5KG6A 3TW0A 3LQVA 2YWWA 2CYYA 2GQCA 1R7IA 3I5BA 1T3OA 2A2DA 3MWBA 1TKTA 1RADB 4UQGA 3FBEA 3H25A 1GFWB 1B0VA 3ELHA 1HFEL 4ES3A 2R7VA 4QIFA 1M90T 2UP1A 3Q8VA 4M5IA 3ILLA 4K8RA 3PHEA 2IMOA 3H40A 1N0UA 1AUDA 3A13A 3RR7A 2R7WA 4I6AA 1AZSA 5LXRA 4N5SA 4QW9A 2Q1LA 3C15B 4K4YA 2FHJA 3KK1A 1RKIA 2WVDA 1U1LA 1FRMA 5ETKA 3BV8A 4GKJF 3CEDA 1EQMA 1EP4A 2J7KA 5HBMB 1XNQF 3HX9A 5A8KB 3CJRA 1S4EA 4U9RA 1UTAA 5DZ7A 3PV8A 3RR8A 1UWBB 4MK7A 3WDOA 1YJUA 1D8YA 1VQKS 4C6AA 2OSQA 1U24A 4I2QA 4ZS6A 2MKKA 1XTZA 2DGQA 2E1PA 1Q82T 2CUYA 2HGMA 3O2IA 2V2ZA 4DFMA 2DGTA 2QA2A 1EX8A 2V8VA 4OYOA 4KSEB 2J9EA 4OHVA 3QRQA 1HW9A 3P3DA 1TAQA 2DEIA 1UFKA 2VHGA 1TFWA 3EVOA 3MOZA 4KFBA 6FDRA 4DL6A 3BO2A 4KRWA 4U7UD 4AXIA 1R8BA 3PEHA 3NL0A 1U2FA 2BE2A 1RT6A 2JOQA 3GXQA 2PMWA 1REVB 3QATA 1KVKA 1FJEB 3NMRA 4J37A 4L3NA 3ZZRA 1FT8A 3T5LA 2LKZA 2CIMA 3QBCA 1SQFA 4J9KA 1FRXA 2GVDA 3A8JA 4LR8A 2OEJA 2WTFA 1JLEB 3I5AA 3MM8B 4J9SA 2RDDA 1NK6A 2YKNB 3FNNA 3P45B 1SIWB 3KLEA 5A0YB 1LV5A 1H38A 3C3LA 4F02A 1H7WA 3CJTA 4ETXA 1HNIA 1OYEA 2FC8A 4X65F 4M5HA 2E1MC 3VEBA 2WBRA 3AT1B 2RQMA 4ED8A 2W24A 1Q7YT 4LF4J 2QTWA 4QR2A 4O23A 2RHSB 3U1LA 1SL2A 4A8WA 3FK4A 2SXLA 3DM2A 3JSMA 1HNVB 2LQBA 4LBIA 3MECB 4DXLA 1D0EA 4NMXA 2FLNA 3V81B 3VGUA 2C2NA 4DX7A 4CLYA 2QO3A 2VH7A 1UVNA 3MOJB 4LR7A 3QYYA 1MU2B 2ZH5A 2EI5A 2NCKL 3KFWX 3T3FA 3CMQA 4NLSA 2LEPA 4PXEA 3R5DA 4K0KJ 5LMNJ 2R8IA 1SJ1A 3US5A 4LIWA 2YWGA 3TOQA 3RBZA 3X3UA 3H42A 4DX5A 3PX0A 2UU9F 2J9CA 1X8DA 2HZVA 2BACA 1N8RT 2OMLA 1JXEA 5ETMA 5KFMA 3G6XA 2J7WA 2NXJA 3LANA 2FD2A 1U2RA 3LP0A 1QAXA 4IDKA 4QR1A 5J1PA 3PM9A 3FC9A 2BOPA 1P6TA 5A76A 4J9QA 4DLEA 1URNA 2AEMA 4WIIA 3SV4A 2MZQA 2RNEA 2A10A 4YN3B 4B08A 1RCXB 3JQMA 1UVKA 3CO9A 5IWAF 4PAAA 2KRBA 1VBKA 3CCVS 2QL9B 4WYWA 2XWXA 4P52A 3LUYA 4TN2A 5KFYA 2BJ3A 2MY8A 2OPPB 3M8QB 2QLBB 2V67A 1ZPVA 3CE8A 4LSZB 4A46A 3HI9A 3TAPA 2IBKA 2JEIA 3Q8YA 3VCDA 2I1RA 2NXEA 2ZWOA 3P5TL 2KFYA 1E6YA 1U6FA 3S01A 3H4DA 2QEXS 2IM3A 4Y2MA 3HT0A 4Y6IA 4KYZA 1MWZA 3T1AA 5F8IA 3AJDA 4IG0B 2DY1A 4B3RF 2P9CA 2IMWP 1FX2A 1FRHA 1NJIT 2DBBA 3CF5Q 2FQQB 3JSMB 1U48A 3AY0A 4O0NA 2XS2A 4Y3CA 4PG4A 3GYXB 2F8MA 4X4TA 2AJ1A 4DUTA 4XO0A 1ROFA 3CCRS 2V68A 5B0DA 5C24A 2YKMA 1NU4A 3FBFA 4DI6A 3ZC4A 5KT4A 3QJPA 2R2SA 4IG3B 2CQ3A 1FDBA 2AQ4A 3TJ9A 4B9VA 2CWXA 2GIQA 4QJVA 2DGSA 4WXOA 2AZ3A 1JLEA 1M5SA 3CIZA 3QGHA 2IDLA 4FP9A 4QIVA 5B0AA 4OZ3A 4B9UA 3E01B 2AGPA 4F04B 1HR0F 2OEKA 2QLWA 2LXUA 1JNZB 2OHDA 2R7OA 4LQ3A 3WX8A 5KG7A 3TEGA 3J81Y 3J7Z5 2FJWA 1V6HA 3GV7B 1CQMA 4ED2A 1VIOA 4YS2A 4DFPA 1S76D 2F4FA 2ZOMA 5K20B 2FZGB 2H5EA 5DDOC 1Q8IA 5JJBA 1JNRB 1RT3B 4FS2A 2DNHA 3FBCA 3K8WA 3W65A 4WFNQ 2LECA 2D3OR 1HMVB 1RWOB 4PKDB 4X62J 1RE1B 4YR0A 3H4BA 1U1QA 2XYPB 2F7VA 1RWWB 3KG4A 5FD1A 3UE2A 4C3LA 3LWLA 3V4IB 3SI8A 3OR2A 4YR2A 1SC6A 2VBZA 4PG8A 3A12A 3BQ1A 2B9XA 5J2PB 4DF4A 3DRYA 2Z2YB 4FYYB 3CDAA 4OHYA 3BSCA 1S1VA 1PYOB 1X93A 2HRYA 4DL0C 2FVQA 3Q86A 2HZAA 1E6VB 1TUGB 2VD3A 5KG0A 1KFSA 4DV3J 1U1RA 3MECA 1LWEB 4JI5F 1JWWA 3EDQB 1I94J 2R7XA 1KEKA 1JMTA 5H9FJ 2G2OA 4EO8A 1VQ6S 3CD6S 4DV6F 1WEXA 2CPHA 1OPIA 3BH6B 4PABA 5HVFA 2YH0A 3GYNA 5F3ZA 3PKMA 2RHQB 3HPOA 2Y1IA 3U02A 1VQ5S 4MKBA 1T11A 2EG2A 3A3PB 4GC7A 3MPVA 2IHR1 1NDLA 4BHQA 1F2HA 3HVRA 1VHFA 3IBWA 2W7PA 2UUCJ 1KQKA 1NJWA 2Q79A 1HBNA 2P8IA 4WFZA 3LJPA 3G82B 2IC3A 1JLQA 1SV5A 3ITHB 4ZCKA 3R9LA 3GPAA 4ANEA 4CTAA 2IYIA 3KLHA 1UAWA 2PDAA 3GJSB 4N7TA 4DQPA 4ES2A 2N7CA 1WG4A 3K57A 3LP2B 4OJGA 3K59A 4MKYA 3QAEA 3Q8PB 1FX4A 1NUEA 3K5NA 2Z57B 1U0SA 4YDXA 2C2KB 5E33A 1SH3A 4O4GB 1ACMB 1H6KX 3D1OA 1QTNB 3BGFA 2OUGA 4ZJQA 2L3MA 1TKXA 2QYGA 3BGOP 3VAKA 2DNZA 2EBEA 3HHKA 1MMLA 1VQSA 5KFTA 5KFFA 3DLEA 4XIUA 2B5JA 1YTYA 3C14A 2DPJA 1CS4B 4PEOA 4PXBA 3W8PA 1S99A 1LFWA 4BCAA 1N5SA 2QL7B 1H98A 2POKA 1NM2A 4HH1A 2W9CA 1KNZA 3M6VA 4EO6A 2HGNA 3PYEA 3DLGA 1X9SA 2OKQA 1NK0A 1WI6A 3GJQB 2B4PA 3E2EA 4R0JA 5H9EJ 1APSA 1SC4B 2B0GA 1WSRA 1EKRA 1FDAA 1SB6A 2WZ1A 3K5MA 4DV0J 2DCLA 5KFOA 3CJQA 5I42B 4QZVB 2FYXA 3EZOA 3C15A 3IR6B 4GVBA 3QT5A 3L9ZA 5F8LA 4ZKAA 1U47A 4I7FA 4P2SA 1TR0A 1RAEB 2XS5A 3IRWP 4RW7A 2VDIA 3ILOA 1XWLA 1MROA 2FJXA 2U2FA 2XMAA 3DRXA 1X4AA 1RHUB 4DHVA 1LW2A 4P7TA 3R97A 3CJ8A 1S6QB 1SI9A 2RT3A 3VVUA 5DDPC 2HNYA 2D9PA 4LRVA 1ULRA 3EMTA 5CQGA 1T9XA 3FZBA 4ZVFA 2LEAA 5HP1B 1VI7A 1X4GA 1QE1B 4OZ0A 1YJVA 1BQXA 2CJ9A 4IFVA 5KFBA 3IR7B 4HDHA 1YDLA 3OV7A 1P27B 2DXFA 1Z1ZA 4M63A 4OI6A 4JI3F 1W2BR 3QRPA 2UXCJ 2HVEA 1K0TA 3J81U 2XCPA 1LW0A 2ZH9A 1RGVA 2JFDA 1S7HA 1XIQA 3IC1A 4B17A 3MMBA 4A8SA 3DLGB 1X9MA 5CZXA 3AHPA 3N6NA 4C11B 5IOLA 1IRQA 1RQ0A 3AOAA 4DR7F 4LF4F 2BSQE 2MQ8A 2MSSA 4ID5B 3M8YA 4DPXA 1N5YB 2VPXB 3GIKA 1P9YA 3UW1A 2BUNA 3A3NB 4D3GA 4JI5J 4I67A 1OMSA 4IH7A 3NO7A 2HNDA 2FVRA 5HROB 1H3DA 2H5JB 4U8VA 5D4LA 2M7SA 5LOQA 1MW7A 3V6DA 2ZOFA 4EBDA 3N9UC 2FY1A 1S72S 2E9TA 2MZSA 3NG8A 4QPXA 2MMYA 3J80Y 2EXUA 2MHNA 4L76A 4IOAQ 2FUG9 4DV6J 1HD0A 3BEGB 2R7QA 3AD9C 3ZTPA 5KT2A 1VC5A 4C8YA 4A8KA 5L9NA 1SUQB 2R42A 3CD7A 2JWNA 3QOQA 1V5IB 2KT2A 5FLXU 1DY3A 2B9EA 2ADBA 5I3UA 4YB5A 3F56A 1WACA 4NWBA 2D69A 4OMFG 1JJHA 3J7YI 3IBCB 3PRBA 2VG5B 1GEHA 4RBVA 4B3MJ 3PW5A 1PSDA 4CLTA 1VRUB 2C3YA 3UDEA 2HHTA 2XYGB 2HBQB 4N77A 1HWUA 1HBOA 1UJ4A 5KFNA 1FJ7A 4FXEA 5AJ3J 5BYSA 4YOEA 4ZVUB 1RWVB 2DR9A 2UUAJ 4U96A 5I3QA 3BO4A 4ICLB 3KLGB 2X1GA 4DR7J 2AX0A 1BY9A 1VGYA 2YX7A 3CJ2A 6AT1B 4X4RA 1DURA 5LMNF 3VAJA 3PO4A 1N33J 1FKOA 2HSEB 1KKHA 5L9XA 4EUVA 2VG5A 1PC5A 4DN9A 3LGNA 2I2YA 2CA9A 2CPGA 2EFOA 5BXIA 3O5TB 4ZVEA 4XPEA 4NLTA 5I3UB 1FA0A 2DYAA 2HK3A 4Q2LA 4CLZA 2DNOA 5J2MB 2V69A 1U26A 1TAUA 4WXWA 3LP1A 2Y1LB 2H3AA 2G1HA 2DIVA 2XSJA 2ZC4A 1CJTA 2Q6BA 3OR2B 1SKWA 3V4IA 1M1KT 1VLYA 4RW4B 4GC6A 2DGWA 5DGBA 2GVZB 2VASA 3BSNA 1FXDA 1X5PA 1HYSB 2E5HA 3SSRA 1NK7A 3M8WA 3NMAA 5L1KA 2BQUA 1JX4A 2XM3A 1YRXA 1R8AA 3CC2S 1WG1A 3NS6A 3RYLA 4QYZJ 2BJDA 1C1CB 1MNEA 3D67A 1T03A 1T9VA 1S77D 2K3IA 2CRLA 3CCTA 2XLJA 3Q89A 4USUA 4R0EA 4RNNA 1RBLA 3PYFA 5CZVA 1O5JA 1F0XA 4PG7A 4RU9A 1UFLA 2FJAB 4B9TA 3D3BJ 3J80U 3MGJA 1SC3B 4NLPA 4YFUA 3RAMA 1EB0A 3M9MB 3QGPA 2XMWA 3ZZZA 2VQFJ 1QSSA 2O01C 3TA1A 3DLJA 4TQRA 1NCLA 3I87A 2GJFA 3BYRA 3HSDA 5E3PA 2K1RB 4DSFA 1WELA 3X1LB 2KYXA 4R5PB 1HA1A 3C46A 5IM0B 1QE1A 3A4TA 1XBWA 1CULB 4H4OA 1EHWA 2VFSA 2HIYA 2E66A 3T9NA 4DG1A 3W2WA 2W7OA 2E9RX 1M0SA 1IM6A 1S1VB 2WHOA 3PDNA 4Y2IA 3R7NB 3SDEA 4YMEA 3R7SB 4R8UB 4EK2A 5J2PA 4KTQA 4X4OA 1PGZA 2VL1A 4MJWA 2HFUA 5L39A 3GV8B 1D3WA 3MM7B 4IQMA 3GR0A 4MK8A 4DV5J 3GLJA 4NLXA 4LFCJ 4GKJJ 1L3TA 3KJFB 3PRVA 1NKCA 1DJ0A 1WHVA 5AXNA 4B3OA 1B7YB 4Y2CA 4LF2A 2YH1A 2RVJA 1HHSA 2AYMA 2Z58B 3UD4P 3W8GA 2X7IA 1UVJA 2DT9A 3GFYA 2OD4A 4DR4F 1RXOB 3UO0A 4CLSA 4ZCIA 3KDNA 3TP2A 1FKAF 2HMIB 2MQLA 4QWEA 2ACMA 4O3NA 1QUVA 2HLUA 3GE9A 3HM9A 4FPRA 1K1SA 2J6SA 1HW8A 1DTTB 1RUSA 1S12A 4ZCLA 4YEAA 3TAMA 1QSLA 2XB2D 1TL1A 4EYHB 2IM2A 2C2EA 1I5OB 5L38A 2WSCC 5F9LA 4RZRA 4A8FA 2XMMA 2XO7A 3V6JA 4AXJA 2X1FA 5DG7A 3W2WB 4CP5A 4NOHA 1K47A 1XMBA 3PIOQ 1C0UA 1OS5A 1R0CB 3V4MA 1SJ3P 1VQLS 3CCMS 3OR1A 4PG5A 3UQSA 2MKJA 1HNVA 3D54A 1F9EB 4USHA 4G3IA 1RT5B 2UVRA 1K0VA 4J5OA 3IP0A 4OX8A 4ZVGA 5I4MA 5C42A 1ARRA 1M5VC 4KR0B 4OIXA 1R0BG 1ZZNA 2ILZA 3UNGC 3S6EA 1EAYC 3FFIA 5KFVA 2W8LA 3FGVA 2PN6A 1SJFA 4RUCA 1M5OC 5B0FA 1SV5B 1JLQB 2BX6A 2HWIA 2WOMA 1OQ3A 3PFEA 4KH0B 2FB0A 4UUWA 4P71A 4C7QA 2DITA 2KT3A 4KT0C 1VLOA 3BYPA 1W7WA 2PT0A 4OX7A 1HWIA 4DBQA 4CO5A 1RB0A 3MTJA 4F36A 4LVNP 4U6PA 3RRHA 3KK2B 2ZJRQ 2DPIA 4PRFA 1VR6A 2KDOA 3NGUA 2XMUA 4OYIA 3TVZA 2HRTA 2N3OA 2M88A 5KFPA 4IH6A 5A6PA 2ZVIA 2YKAA 4DV7F 2K1OA 1B0TA 2B56A 2V8HA 3AD7C 4Q45A 4OZ2A 3MFIA 1C0UB 4U7UK 2ASJA 3CD0A 4IDKB 1M5PC 3SXLA 4ED6A 2UVWA 2IA0A 1RLDA 1X5SA 3D28A 3QSIA 4MIAA 3CCJS 3KUEA 2OP5A 4ETZA 4ED7A 1UVLA 1UETA 1SIZA 3KJQB 5AJ3F 1IKYB 1Y5LB 2RU9A 4UTGA 4RLEA 1NDKA 1OJ4A 3EVWA 1XQIA 3BKUA 3UDCA 5J2MA 1YBTA 2YWHA 1RISA 1YWXA 4L75A 2WBMA 4YY3F 4FF2A 1GT8A 2PSZA 2O1PA 1ZAXA 3MEKA 2K9IA 1EA4A 1WF2A 2R8HA 1WG5A 3GZ7A 2GHPA 3PJWA 3R2CJ 4J9UE 3KXDA 4HLBA 3TR5A 2GAHC 3OXFA 2BQRA 3TZZA 1N34F 2MTLA 3ILIA 3HHLD 3IGNA 5AXKA 5C25B 3I4PA 3QSYB 1VCTA 4EEYA 3I5CA 1MN7A 1HBOB 5IWAJ 2ZJPQ 3OTOJ 2IFXA 3MUMP 3UI3A 2W7AA 2KL8A 3O3LA 2CJXB 4DU7A 3TA2A 3VV2B 4UZBA 1VC6A 2CJAA 3AXKA 4USKA 3TJ8A 2IY5B 3SDEB 1UEVA 1XERA 1XK8A 5CH7B 2HHQA 4IG3A 4H4MB 4NPOA 5B7WA 4HDGA 2QZ8A 2HBYB 3B78A 2PD1A 1QTMA 1VQ4S 5EWGA 3PW7A 1V5VA 1QAJA 1VS3A 3DOKB 1TQLA 3HZEA 3HSJA 4ZN1A 4DJBA 4WP8A 4LSLA 1IWAA 1HI0P 3NNCA 3FEZA 3CVKA 4P73A 3VZIA 5EN1A 2BW2A 1VMBA 1H2UX 2M8HA 4OI4A 2G4BA 1CEZA 2R7SA 4ZIVA 4HACB 2AU0A 4CO1A 4XTTA 4WZQA 4ZLNA 4DUZF 1U4BA 2IM1A 1E6YB 4OLOA 2P2CB 2KG0A 4LF6J 3ULHA 3EJMA 5HO4A 4KHPF 5I3PA 4ZLPA 3MMCB 2D3ZA 2UVUA 4P74A 4UF4A 2DD8S 3HDSA 4KBIA 2EBGA 3DLKB 1QAYA 2PE8A 3BN4A 4OQJA 8RUCA 1OG7A 3HHLA 2NQPA 2V34A 3FDSA 4PUOB 1N32J 5A8KA 2N3LA 1S9GB 2V8PA 3IG1B 4CT8A 3TX0A 2K7KA 3IM9A 3GB0A 4NLDA 5DM7Q 1LK5A 4BC7A 1I1GA 4KE5A 2IIHA 1GH8A 1C2PA 4X4UA 1NPRA 2K7JA 3BSAA 3SBMA 1N36J 1Q7LB 3MM7A 2WAQD 2BA3A 4KV8A 4JYAJ 4Q7AA 1VQMS 4F4AA 4XK8C 5EHHA 1R8HA 2GCFA 4RW8A 3ICLA 4JV5J 3MR2A 5G0RA 2GPEA 1BHNA 2B51A 2QGFB 3MEGB 4DG1B 3S1TA 3UN3A 1HPZA 3C8YA 1MYKA 4XAKA 3TUJC 4DPUA 5HI7A 4EU0A 1Z2LA 2AHOB 3V81A 1VQ8S 3TJAA 3ZNJ1 2XI2A 3I0SA 3KDOA 2KTQA 2JC0A 4FYWB 3AJ1A 4LREA 2CQ0A 4C8MA 4F2SA 2H9ZA 1RTJA 1N6QA 1BQNB 1HI1A 3DGPB 3MUTP 3IAS9 3BBCA 2O3DA 2WSEC 4EBEA 5ETRA 3BKTA 3MPDA 3VQSA 1Q8LA 1OWXA 2HIQA 3L7OA 4URSA 4A8YA 2ASDA 3SMZA 1B7FA 4NZ0A 3T41A 1C4CA 1X4HA 2VKRA 1FO1A 4LR9A 2CWKA 2FHMA 2OO4A 1PC4A 1H7XA 2JRSA 3DGVA 3VAHA 4FF1A 4AAIA 1UZHA 1LWXA 1J5OB 3M2RA 4BS2A 4I68A 3W63A 5L1IA 3K5LA 4M5JA 3GJTB 4ZVSB 4LJMA 1MNTA 4B9SA 1WNEA 1QAIA 2PEHA 3SQGA 3BGLA 5A8RB 3IO1A 1RA6A 1YGYA 2VC0A 3CMAS 4FDFA 4JP8A 4FYVB 2QA1A 4M5DA 1RT6B 3UNYA 2MJNA 4J9PA 2VA2A 4RUBA 4LF8F 4X84A 4YP3A 5EX3A 3L4BC 1XMOJ 1AROP 3TANA 3JYTA 1F9FA 1UCNA 1U02A 3DLHA 5A2QY 4CDIA 3MAAA 3A3OB 4NA1A 3K5OA 2KB2A 2QYCA 3KLHB 2MKSA 2BE7D 1X5OA 3BKFA 3ITHA 2W4PA 2IC3B 4M5MA 1YJRA 3O44A 4LF8J 2QJ3A 4Q0BA 1J2VA 3MXHP 1IUJA 3C16B 2W01A 3EM1A 1DZ5A 4WE1B 3B4MA 3TYTA 5IQ6A 2W9BA 3LGHA 1RCOB 2RRBA 1ZTWA 1TUVA 3UR3C 5ETOA 3E3XA 5J1EA 3QRRA 1S1TA 2WVBA 1FWPA 1F9HA 2CZVC 1R8PA 1SH0A 4CWBA 2YQ3A 3WX4A 4WK3A 1H2TZ 4GRSA 1X4EA 4EMDA 5HLFA 3EZ5A 1TL4A 3MCSA 5T41A 4X62F 1OSCA 2D7SA 4X4QA 3PFOA 5HANA 1NKBA 2DR5A 2XC9A 2EG1A 2F9JA 2PI5A 2HHXA 1G1XA 1T95A 5D6GA 5F8MA 1X4BA 1NSAA 2K5JA 2QA4S 4J9MA 3VEAA 3OVBA 4KO0A 1NPKA 2QMUB 2PGCA 3ZTOA 3IFEA 4K4SA 3DRPB 3KHLA 4KV8B 4L74A 3EPIA 3UCUP 1S7IA 4F26A 3IAM9 2C1EB 2XNQA 5DETA 2IVMA 3MAAB 1NK9A 4GVBB 3RRKA 5HL7Q 3MEEB 4O3SA 1HMVA 1WTFA 2AD9A 1T0TV 3R6LB 4J90A 2R3VA 2KG1A 1CC8A 3V6DB 1TK0A 5T7LA 1X0FA 1NH7A 4X64F 3MI7X 5F8NA 3WIVA 3HKWA 3DOLA 1IKWB 1CVJA 4CNYA 2GGPB 3ET6B 3CCQS 5D3GB 1G7CB 2JBVA 1AT1B 4C0HA 2LXIA 4M95A 4CH7A 3H0PA 1GMWD 2ROPA 2YNIB 2Z2MA 4OZ5A 2N7YA 4ZP9A 4WTOB 4TU8A 4WTYA 1N5VA 4FXVA 1J5OA 1PILA 2EFVA 2C28A 5U47A 2VODA 2HEKA 1REGX 1KWMA 3I82A 3DNCA 2RS8A 3M9OB 1UMJA 3L3CA 2BJ7A 2RQKA 2UXDF 1LW0B 1B70B 1YITS 3U27A 4ED4A 2ZZNA 4NLUA 5KT7A 8AT1B 2NUHA 3EX7B 3NNEA 4DV2J 4ZHRA 3RB3A 4GKKJ 3DDIA 4M5LA 3IR7A 2CQ2A 2HFVA 3MCMA 3W66A 5HMXA 1R6VA 1JQGA 3G87A 2PMZD 3TVYA 4ZN3A 4DSKA 3CD5A 5HP1A 4XDDA 3G8TA 1WJ9A 3SCJE 4ZMMA 1EKSA 1MN9A 3OTCA 3HFZB 4LFBJ 2Z4PA 2EPIA 1LW2B 4DDFA 4NXNF 4NCAA 1NEEA 4EFAC 2V4RA 4LSNB 5IQQA 2J0SD 3J7AN 1IBKJ 4JI7J 1MYLA 3QJJA 1N48A 2K2PA 2ZBPA 4CLLA 3UD3P 2DGXA 3R1HA 4C4WA 3Q8SB 4JV1A 5GAGI 5DG8A 2R2UA 2HRUA 3CJ4A 3H59A 2DH8A 2UXBF 2JZ5A 3VQTA 4LFCF 1JXVA 3IGVA 3Q8UA 4OX9F 2RUSA 5JUMA 1GAOA 4ZP6A 2W2QP 3KUGA 5H9EK 3JS9A 3MM9B 1AB8A 3Q2SC 1X60A 1NXIA 3CDBA 4PUOA 1BGXT 4G1QA 3PXGa 1UKUA 4E2FB 1O8BA 1T9WA 2L48A 3B4DA 2ZKTA 1Q16A 2BA9A 1QVFR 1UPMB 2FGOA 2LMIA 3KLIB 5K14B 4CTAB 4W92B 4KPYA 3ADAC 1AYEA 2HYIB 3S7RA 3R1LA 5E2QA 2MQPA 2G9OA 5AE1A 4GKKF 3F41A 2KKEA 2L9WA 2YNHB 1SXLA 3MM5B 2O67A 1CJKB 2GO8A 3NBPB 3R5BA 3KLFB 3R2DJ 2V2VA 3HFVA 3E51A 4N41A 2A18A 5A2QU 1RDRA 5CABA 2CVIA 3RBEA 1Q4RA 5CYQB 1NDPA 1AW0A 1YBUA 2V50A 2ZEJA 3M8ZA 3Q0AA 1D9FA 2HKEA 1YLXA 1NKEA 1Q53A 4O4GA 2CFXA 1FJGJ 1UZDA 1TZ0A 4RL1A 4UW2A 3GIJA 3LP2A 5AE2A 1KR4A 3G6YA 1G6BA 3JTPA 3NCPA 3K89A 1VRQC 1JLFA 3D1HA 3QJLA 1OIAA 2FHOB 2H48B 3MAQA 2AJ4A 4ZA1A 1HD1A 2MKYA 2KOEA 1XMQJ 3MURP 3FRYA 2BXJA 4NXMF 3ZO7A 2Y1JA 2HHWA 3GONA 2Z30B 3AA8A 3M8RA 2V4QA 3D0HE 4OJ3A 1IBLJ 4KIAA 2YKMB 2Z8QA 4L3KA 3V5RA 4ECSA 2XYHB 3D4JA 4IUFA 3OL6A 4LRBA 2ZKUA 5KFEA 1RT7A 1WWHA 2QG9B 3D5MA 4X66F 3N28A 2RS2A 1RT5A 3ETMA 4I1TA 4LIRA 4X4PA 3OHBA 1MMDA 3HJVA 3AODA 4ZP8A 2BE2B 2CNLB 5F0WA 1OYDA 1E6VA 5CYQA 2HBZB 1QD1A 2DO4A 2VU5A 2YWEA 4I2PA 2CZ9A 5SUHA 3H5YA 5L1LA 3EE3A 2AZ1A 1P8GA 2WB4A 4C3MA 3C6UB 2DEJA 2FHKA 4ZIWA 1S9FA 4DR6F 2OPSB 4CRJA 2A2BA 1HQ2A 3M8QA 3VWSA 4KHMA 2BOAA 5KFDA 2CG8A 3VALA 2EFQA 3IXQA 4P2XA 1X0PA 2EC0A 3LWMA 1BUXA 1TMJA 2AKWB 1P1LA 3DXSX 4ZPBA 3TX8A 3KHRA 3T1YF 2A6OA 1S9EA 4FNHA 5L8RC 1EQ0A 1YHQS 1YI2S 2B3TB 1T02A 2HS0A 4MJKA 2DK2A 5KOWA 4CI0B 1VFJA 3VAFA 4BWJA 2CJQA 1KC8T 4JYAF 4IR1A 4DV1F 4DPOA 3VW4A 1RHRB 3CDEA 4DU8A 2CPIA 1RWNB 2FPHX 3GJRB 4WFBQ 3KK2A 1Q1KA 2XY7A 2I6WA 3AAWB 2MKIA 4USWA 3HULA 4C0BA 4DCPB 4DV4F 4AL7A 2FDNA 3GILA 5E5NA 2QSFA 3FQLA 4C0OC 1WC5A 1VJQA 1NHUA 4RR5A 3IMQJ 1VJWA 2HVDA 3OQ2A 2JEFA 1WORA 1L5UA 2JNJA 4ZLJA 4X4SA 3N5FA 2CAXA 2DISA 4DR3F 1Y11A 4D3HA 4F25A 4HT5A 1RYRA 4AQYF 2AWZA 1P1TA 2LDYA 4U7CA 1VRTB 5ETNA 1RZMA 4ZHRB 1BXNA 1S0NA 3SCIE 3NGKA 4KKOA 1GX5A 1R0AB 4DSLA 4MTPA 1PJ6A 3NNAA 1UJ6A 4AL5A 3ENQA 4ILMA 3RU0A 2EEYA 4OZ1A 3TUZC 1S6OA 4CQ1A 3NS7B 2BNWA 2VC1A 3AOCA 2JSXA 4I64A 4ZVHA 2IVFB 3D6MB 4YR3A 1DQAA 1TL1B 5GAHI 2ASLA 5DLFA 4NLQA 1WEYA 3QWPA 5KFIA 3TA0A 3R5CA 3EXCX 1FXRA 4QYRA 2CNOB 4CO0A 2QMXA 5E3AA 5CXTA 3P49B 1PO6A 2PO4A 1H0HB 3FSYA 5F0UA 2AT1B 4RNOA 3QT6A 5HMZA 4MYUA 1ZETA 1G3OA 3B6BA 1RHQB 3MM9A 4KH1B 3M32B 1ITPA 3CCLS 2AIRB 2DXEA 2HHPA 2RB7A 2ZNZA 3W61A 3KMQA 3LPYA 2IYGA 1S4FA 2XSFA 4JI8F 5F8HA 4NXNJ 1UEKA 4H54A 2R2RA 4LVOP 1X7VA 1KHVA 2CQHA 3OSNA 1NHVA 4IQXA 3BBBA 3K58A 2V94A 2FZCB 5D77A 2APOA 5AXLA 4CO4A 2DXDA 1N5TA 4QPTA 3CDWA 2MPUA 2YY3A 3VR1A 1FKOB 4O3OA 3DLLQ 2HQFA 1JLBA 2GNKA 2JJ4D 2RF2A 5EGYA 4H4OB 3DM2B 1FFSB 1H2VZ 1QJHA 2QFIA 2F5GA 1YIJS 4V19J 4OL8A 5DQHA 2KFZA 3FBBA 3DHWC 2IPOB 3HF5A 2QIFA 4I6WA 2WW8A 1AZSB 3K5PA 5K8MA 3Q8RB 2AGOA 2W4CA 3POTB 2AYGA 2AYEA 3G8SA 2MLXA 2K29A 4I4BA 4ZPVR 4ZPAA 2HHVA 4WPAA 2NXCA 2HWHA 1RACB 4N8OA 1Y4ZB 2JEGA 2VG7B 3U1MA 3J7ZT 5KT5A 2FTRA 3FKBA 4MIBA 1Z4UA 4TQSA 2I5JB 2ZWPA 4NLOA 3LAMA 2CVEA 4LRDA 1OY8A 2CJBA 1BWEA 2IRYA 2CQDA 2KXHA 3OL9A 2ERRA 3TEHB 4DV7J 1UEUA 4PYAA 1U1MA 2K6LA 2B43A 1S48A 1RSCA 3B54A 3GSDA 2P5VA 1XMQF 1VC0A 3LH2S 1FE0A 4C98A 1S97A 1B64A 3CCES 2LQ5A 3IA0A 4JI3J 2B6AB 3G71S 3HVTA 4OV6A 1WTBA 2H5IB 2RSQA 2I5JA 1TVRB 3MHYA 3P4UB 2CPFA 5AT1B 3SQOP 2C3UA 2BW7A 2G2ZA 4YHHJ 4ECWA 1S79A 1CJVA 1F3VA 2HS3A 3QO9B 4DV3F 3T1HF 3IRXA 3BF4A 3IM8A 2XY6A 1N88A 1NLAA 3PNIA 1UW4A 2I9SA 3VF0B 4F8RA 4ZVPB 2DNRA 1C1BB 3POTA 1IQZA 4NEYA 3ISND 3TZWA 4GO7X 4IYQA 4YUDA 4TY8B 3NWRA 4FYDA 1EP4B 2OSRA 3KYLA 2RMLA 4YHHF 1HI8A 2B8QA 3BBFA 3GP9A 4FKYA 1CG2A 2GZOA 4DV1J 3T1HJ 3KK1B 5GAGU 1XNRF 2JH3A 2F4VF 1SJQA 4LQ9A 4QWAA 4FBTA 4JI2J 5KT6A 4K2JA 1WKJA 1WDTA 4C3KA 1XMOF 2KI2A 3VGVA 1KONA 4F3OA 4ECVA 1PJ5A 3I32A 1X5TA 2C3MA 2AJ0A 2QC3A 4OHZA 3TI0A 3OL8A 4C8OA 2E9ZA 5DS7A 4KC5A 4PQUA 1OHNA 2W4DA 4UOCA 5CA5A 3OXLA 1GMUA 4WK1A 4IRCA 2XG8A 1VOMA 3Q23A 3KG0A 3QQCD 2WB1D 4WKYA 1U45A 3CIMA 5J2NA 2VBYA 4J9NA 1RWPB 4O44A 4ECUA 5LL6d 1WC4A 3PR5B 5B0CA 1WUUA 2BVZA 3CCUS 4F4ZA 2Q66A 2H51B 9RUBA 3MZIA 4ED0A 3UFCX 1JXLA 2MLYA 3IWLA 2LFVA 3OBIA 3C6TB 3W64A 3ZZPA 5KFCA 2R9LA 7FD1A 1HNXF 4GMKA 4A8OA 4ED5A 2VFVA 4HTJA 2W9CB 3HCXA 5C2CA 4B02A 1GMVA 1RWUA 4UQTA 5LJ5Y 4F4YA 2PFDA 4JI4J 1TL3B 4LF5J 1SCJB 2IRXA 2K3KA 4BDPA 4EGLA 4O3QA 1ZAWA 3CJ5A 1FD8A 1S5ZA 2XMTA 3H5XA 3Q24A 2FZKB 3D7SB 1MLAA 3QIPA 5E41A 1LQ9A 2HHHF 1T8EA 2RQCA 3QFHA 2LEBA 1UVMA 4KKOB 2X51A 4PWUA 5T7LB 2DNQA 4QQBA 3KK3B 2RH3A 3FZ2A 4LSLB 2DNYA 4USTA 1BQNA 1VQ7S 1KN6A 3UWTA 4JI4F 5J2NB 3NCRA 4RBUA 4DSJA 3FEYB 3RW6A 4K4UA 1SJRA 4FF4A 2IAJA 4J9LA 1LXJA 4DR4J 4FXDA 4B3TJ 1JKHB 3EGVA 2QV6A 2ROGA 4DCJB 1JIHA 3GG1A 1K73T 1NBEB 2OEMA 2OLWA 4RW8B 3RB4A 2W2NP 2BBEA 1LK7A 2ZDPA 4DN0A 4DR2F 2MB0B 2MKCA 3EPGA 2LQ8A 1RAHB 2R2TA 2F1FA 2DHGA 1ZM2A 3FMWA 5DDQC 2VJVA 1RT2A 1VQPS 1YKWA 3QGGA 4O0IA 3MPWA 3FMBA 1L3KA 2LLZA 1FKPB 3RB6A 2MZJA 2WW4A 5ETQA 1ELOA 1TUWA 1S9GA 3IG1A 3CXCR 1XEZA 2MGZA 4DFJA 3D6HB 2JDJA 2H3EB 3ILJA 5D4OA 2CNNB 3DLKA 1RAJA 1C1BA 5DLGA 2HFZA 3P5BP 3FSIA 1R6YA 2DNGA 4WWSA 3ZFVA 3EGWB 3BQ0A 3N01A 4BLGA 5EX0A 1WC0A 1BWVA 1V3SA 3G6VA 1NJXA 4HEA9 3OTBA 4CM0A 4DR3J 3SFGA 1CS4A 2OTJS 5H9FK 2XWYA 2IBOA 4OHWA 3M2UA 4MFBB 4KGZB 2QLXA 3KKFA 1H72C 4NYPA 4QWCA 4HHJA 4IRDA 3DU6A 4NE9C 5K8PA 5KFXA 3CUNA 1FWLA 1YK9A 3I31A 2FC9A 3M8PB 1RU2A 2D74B 2G0CA 4G1PA 4RPFA 4DR1J 1N0VC 2G1DA 3GYGA 1A6LA 1B3TA 2IM0A 3PG9A 2RILA 1YZ6A 1DAXA 2BE9B 1YVFA 2DY9A 2LA6A 2QX0A 2VPYB 3DLBA 2Y9HA 1UWAA 3PYGA 4H4MA 4I56A 2OIHA 3KOAA 1LNQA 4DQSA 2GV1A 2ZH1A 2BDPA 1VBZA 3G82A 4LFAJ 1IR2A 2GJ2A 3HVWA 4ZPWR 2RRAA 2G2YA 3BDPA 1TK5A 4CLFA 1VIXA 4RX6A 1NK4A 2XI3A 1FDNA 1RI7A 5C24B 1IKVB 2CQIA 1KLNA 3GSIA 1BQMB 2OPQB 1FE4A 3TUPA 1RTJB 4G6VB 1N6QB 4DS4A 1SQEA 1U1KA 4MK9A 3HSZA 4AYBD 2EFGA 3THPA 1S0OA 4KB7A 1T05A 4DPYA 5GAHU 3R7BB 2UV8A 5BJRA 2RD5C 2VFRA 2JXHA 4LRFA 4NI2B 4DOZA 2V8DA 1HQEA 2JFKA 4KHRA 4NL5A 3K0JA 4JOUA 3TUIC 3E8OA 3OHAA 4DF8A 2N82B 3R5JB 3T19A 3PR4A 2I38A 1HQUB 2J7UA 3MM5A 3EGZA 3W3SA 4QU7A 1NDCA 1IKYA 2ZVSA 3MR5A 2CPYA 3NP5A 4CIOA 3D2WA 2KJWA 1S59A 2I0XA 1GX6A 4OYXA 4FNIA 4CH1A 3CDUA 3LW5C 2RBFA 3DFEA 1IBLF 4DEZA 2XQCA 4HHHA 2IDEA 2YX4A 5IT9Y 4B3RJ 1KQFB 4ELVA 3KHHA 2LQ9A 2G0JA 2GAGC 1R43A 1JJCB 1WC3A 5JXSA 2XHCA 1B99A 1HBMA 2XZWA 3HLUA 1LWFB 2H65B 2J6TA 2C2ZB 4USVA 5LSOA 3DYAA 1NAQA 4U8YA 1HBUA 2ASYA 2I8EA 3HSGA 1U2CA 3DC2A 2BJ9A 5KOXA 1IBMF 1RHMB 2IJRA 2NXUA 1SBRA 1W2IA 2QFJA 3HK2A 1F5CA 2QL5B 4Y34A 2HQ3A 1FTRA 3VGSA 4DV2F 4UUXA 1YJTA 2DRBA 4LSNA 3VAMA 5B0BA 3FFIB 2E5JA 3BPSP 1R0AA 1IR0A 5GMKa 3JAMU 4KQZA 1EIYB 3QWUA 4DUYF 2HAIA 3QZ8A 1R8CA 1JB0C 1T05B 1FNMA 1VRTA 2MDAA 3EWGA 3NRBA 2Y8YA 2ZC3A 3GMGA 1VBXA 3GTYX 4F4KA 4W4MA 4F4WA 1FK9A 1TL7A 4RW9B 1TKZB 2MYFA 3KWMA 5IT4A 1L3VA 5ETLA 2RDJA 2DR6A 3FCWA 1RAIB 3MEDB 1P9QC 1HHQA 3I0RB 4F2RA 4NRTA 3DDKA 1SIWA 2XCAA 1BMQB 3I96A 1RTIB 2ZE2A 4NCBA 2DRDA 2KT5A 3PZPA 1D1UA 3H5UA 2OI2A 3CO0P 3UD5A 4FBUA 3G86A 2L41A 3CMES 1FFWB 2YQ0A 3BGRB 5GVQA 4LF7J 2AX1A 2M0GB 3AH6A 3DYAB 3QFWA 4OX9J 5BR8F 2GW8A 5KFKA 3NKYA 5GADI 1IKWA 2DJWA 2XMJA 3W1YC 4RO0A 3ZTRA 3VHQA 2LCWA 2NS1B 2QMWA 4M5GA 4C8NA 2XTJP 4FVMA 4CZCA 2XY5A 4NLYA 1ZYQA 1BDTA 4QOTA 5KFAA 2XLKA 2YPZA 4NLRA 2MHEA 4MMOA 1Y00A 2P6TA 3KJVA 2OAUA 5E0OA 1SH2A 3GIIA 3LGMA 2ZZTA 4MKVA 2JLGA 1Q0NA 2VICA 4IOCQ 1HARA 1HQUA 5H1SV 3MUVP 2RQ4A 4N76A 1RT4B 1DHMA 4QIWD 1N34J 1UP1A 4I69A 3DRRB 4DX8H 2E7VA 2VQEJ 5HQMA 4HV0A 3G6ES 1RHJB 4CNZA 2PA3A 4NA2A 2FVSA 3OJUA 4F0HA 2ZH8A 2WCXA 3ENVA 1KP6A 2KN4A 4ITSA 4CO3A 2HVHA 4JI0J 4JI6J 2ZBQA 3JAMY 1PARA 4P2FA 2J9DA 1RKJA 1S1XA 1HNIB 3IWNC 4X64J 3Q22A 2CPJA 2H1YA 4XPCA 2DHXA 3LOUA 4DSIA 4KAIA 1M5HA 3IS9A 3MM8A 1PYSB 4LT6A 3QT8A 1ZS6A 3FQKA 1RJJA 4P72A 4WU2A 2HFSA 4ZPTR 3LALA 4ENOA 3KHGA 1SUQA 1RYSA 2B7CB 2AP6A 4UOHA 2ALZA 5KG1A 5JVGQ 2DKOB 3NGTA 1F3FA 3NS5A 2WVFA 3QGIA 4ID8A 4TLQA 2ZBIA 4P9SA 3JYTB 1S1UB 4LF7F 1IJFB 1HR0J 2KFNA 2ZHBA 3OLBA 1ZTTA 5HAOA 4BC9A 5A8WA 1BDVA 4M5DB 3RJMB 1DTQB 2OPRB 4EZ6A 4P7VA 1GQEA 2NXNA 4RUAA 2HNDB 2BNZA 2F8HA 3PJXA 4NX9A 5IXUA 2RE1A 5A8RA 1HWLA 2IRUA 3SQGB 1JJ2R 2IA6A 3IR5B 1NMEB 3VVTA 4AL6A 4N8NA 3V2UC 1TL3A 3SYZA 4B3SJ 2YNHA 2E7XA 3NBPA 3TZYA 1G2EA 1GXTA 2JVRA 3HJFA 1JK9B 4USJC 5E3QA 3CNQP 4JI0F 2RRNA 1HWJA 4JI6F 4DMZA 2F8EX 4U95A 5EWEA 1SL0A 1Y3KA 4F0MA 1T7PA 1KTVA 2HGLA 5K9FA 3RAXA 3ZZUA 5DZ6A 3W9IA 3CSKA 2PEBA 3D3CJ 3PIPQ 3OUYB 4YB6A 4PWDB 1JJ4A 2ABYA 2ZZMA 4EYIB 4YB7A 2ZM6F 1WSVA 4ICLA 3KLGA 2IVYA 2DR8A 1P94A 2MKHA 3M4XA 1X4DA 2VZ9A 2JC1A 3FSXA 4WFYA 3SFUA 3P96A 1U8SA 2ATLA 2KXFA 2NSCA 4ME7E 1N36F 1QM9A 1S6QA 1VRUA 3O8WA 1ZM3A 4ILRA 2KHDA 4UZCA 3UDLA 1U1OA 2UUBJ 3BB5A 4DR5J 3IWXA 5G0RB 1K44A 3QT7A 2R7TA 1QTGA 4KO0B 3OTDA 2KH9A 3FCHA 1QSYA 4ZDNA 1AA1B 2ZD1A 2VFUA 2YWKA 3VAIA 1KBRA 1CJUA 2CPDA 3K7RA 1C0TA 5KFHA 5BR8J 3KNGA 2X3DA 4AT1B 1U25A 2BM0A 2EK1A 2MLZA 3SCLE 2RKIA 3IBFB 5KFQA 3FJ2A 2JLFA 4G65A 2R7RA 3TQ1A 4CO2A 3J81j 4TY8A 2Y8WA 4DUZJ 1H74A 3R8YA 3HHLB 3N79A 4MT1A 4A8XA 5HROA 5C7PA 1OY6A 2EFPA 4OZLA 3ENAA 3KLVA 4ZVOB 2ZH3A 1DFDA 1PYTA 2LYVA 5KTQA 4K7QA 3PTWA 4ED3A 1UA1A 1OY9A 3MMCA 1DBDA 1CJVB 3HVAA 1ZBTA 2BM1A 3NLCA 4IH5A 2EFNA 4HKQA 4JV5F 4F3MA 2BJEA 5ADZA 5HVHA 3ENWA 5M2PA 4DQIA 3UDVA 3G4SS 5D3GA 2BZ2A 4KGXB 4FS1A 2HQIA 4USMA 3BREA 5KG3A 1T03B 2M4MA 3M2VA 4PXCA 4ZP7A 4Q5VA 5D78A 1HNZJ 2IJFA 2MEWA 2C2MB 2WONA 2MXYA 2KM8C 2E5GA 5A8WB 2LDIA 3HD2A 4YB1P 1HYSA 2LXFA 2XLIA 3W62A 5CYMA 5LMUJ 4WZMA 4HH0A 1HHTP 1Y10A 3DXBA 1Q81T 1C0TB 4JI8J 1W25A 2MZTA 2O66A 3H5SA 4TYAA 4F4XA 2ADCA 2J0QD 3TZXA 4DV0F 4MH8A 3OW2R 4Q8FA 2VG6A 4RW6B 3LAKA 2C2RA 4B9LA 3R6GB 2VF3A 1N32F 2VG7A 2ZHOA 3I9V9 4Q8EA 4OYWA 4PQUB 3PKYA 1AFIA 5GMDA 1HNZF 1HL6A 2Y1RI 3CJKB 5LMUF 2AJFE 3DU5A 4TU7A 3DI6B 1VBYA 5DQIA 1K8AT 4O3PA 1RLCL 2Y0BB 3MM6B 1NNDA 2X3GA 3M6UA 4FXWA 3WIUA 2CQPA 2AN7A 2EC2A 3DGPA 1EZZB 2LQJA 2QE5A 3GWCA 3WZ0A 1J5EF 2R8JA 1QLNA 4CLUA 4CH0S 3CW2C 3DRSA 3RG6A 1VK8A 4UY8T 5DM6Q 3RAQA 1RABB 3W2VB 4HI2A 1JLAA 1HPZB 2QLJB 1BE4A 1HNWF 2HFNA 2V0NA 3DI6A 3W5XA 2CQBA 3DRRA 3THVA 3MFHA 4YDDB 2ZJQQ 4TYBA 3N4WA 3F73A 1Q8KA 4Q2MA 2GHVC 4DL7A 1O0PA 2YKQA 4RW6A 3KJVB 4NZ7A 1FRIA 1MWQA 1U8WA 4NRUA 5EUHA 4ECZA 3OFGA 4QU6A 2AW0A 3ZXWA 3QAUA 3OLAA 3M9NB 1X31C 4DR2J 2B4VA 2FIUA 3R5GA 5D0HA 4A4JA 5EWFA 1TKXB 4PR6A 3T5JA 2MQMA 2J9DE 3ETOA 2W2MP 2JXIA 2ZHAA 2HZCA 2GIFA 2YVSA 2MY7A 3T6BA 2WSFC 4OX6A 4L6V3 1S6PB 3MMAB 4OJHA 1UJ5A 2XZTB 3OTEA 1NLKL 4DL5A 2KO1A 1B28A 1RBOB 2J76E 3JXOA 4OV1A 3UCGA 7AT1B 1T9YA 4Q43A 2FLLA 2Y3YA 2YNGB 1RTHB 3E01A 2ZBCA 2DHSA 4ZJLA 1HWKA 4DUYJ 3I4HX 3H8YA 3RGIA 1GNKA 2J0XA 3CCZA 5GADU 3GFZA 1I6JA 5HJXA 2C22A 2FJVA 2HVZA 4KY3A 4C97A 2VOPA 4HHUA 1CQNA 3WHIA 4Y2AA 2HLTA 2VONA 2YWFA 5C42B 3V6KA 3TARA 2ZH4A 3RUBL 4ZCMA 2PC6A 4NA3A 2CXEA 2FVCA 4H4KA 4TNOA 2V9WA 4A48A 4TU9A 1YG0A 3DOKA 1KHWA 3SCKE 1S0MA 1SL1A 1MMNA 2UVVA 2P6SA 1N4LA 2HNYB 1WF1A 1T9TA 3BJYA 1TKDA 3MEGA 4F67A 1CBKA 3P8BB 2BEFA 5GMEA 5LSRA 2PFFB 4Z7CA 3OD2A 2CG4A 4RW7B 2V6AA 1RT4A 1WOSA 4FVCA 4RUHA 3P6YC 4X4VA 1NSPA 3D6FB 2VUGA 4PPZA 2CNKB 1HBUB 5IT0A 2DR7A 1T9UA 5SZTA 4BWMA 4QWDA 4K50A 2YKOA 1AUSL 4RBTA 3JTOA 2V9KA 3N0VA 4X66J 1C4AA 4LF9J 2HWTA 1FRKA 1NO8A 1RT3A 4QW8A 4C8KA 3BSOA 5F3TA 2E5LJ 1AFJA 2NUUG 4PWDA 1S9EB 4WBFA 2ILYA 2L9NA 2V8GA 5MLCV 4QIGA 4DZDA 4K2XA 1N56A 4DQQA 2DRAA 1IJEB 1Y5NB 1HKAA 3AFGA 1WF0A 3M30B 3JB9k 3HZGA 4F7VA 1RWXB 3DMJB 4FZVA 2A6MA 4WP3A 5D4NA 1L3UA 4M5KA 2AMCB 1G4CA 2LP4A 2JVOA 1BD6A 5K8NA 1SJ4P 3Q2TC 1U09A 3EVMA 3R3TA 2A0FB 1FWKA 4W90B 3N6MA 3MEDA 3U1NA 2NSBA 1S49A 2OH2A 2CJYB 2KYZA 1DTQA 2OPRA 4OFZA 2VQFF 1JLGA 3MDFA 1Q79A 2UXDJ 1I51B 1YQHA 2MJUA 4RW9A 2VKZG 1SKUB 2AY0A 1UPPA 5DRKA 4B3SF 3TRGA 5IM0A 4QYZK 4WKRA 4RNMA 1IVZA 1RT7B 3CGIA 2CDQA 2XZDB 4E98A 3W9JA 4IKAA 5D4PA 2F40A 4ZVQB 3RZAA 1GXUA 2KELA 1IBCB 4NASA 4TXSA 2CQGA 3RTVA 3PW2A 2BJ8A 3AB4B 3MR3A 4PG6A 2R7UA 4URQU 4RJVA 4EBCA 2ZUAA 2EK6A 2DVIA
chains in the Genus database with same CATH topology
1U9PA 3GXQA 2K5JA 4D8JA 2K29A 1B28A 2BJ3A 2JXGA 3VEAA 2WVDA 3OD2A 2K9IA 2Y3YA 1NLAA 2JXHA 1EA4A 1B01A 2WVFA 2H1OE 3BKTA 2BJ1A 4HV0A 1X93A 2BJ9A 2WVEA 2BJ7A 2WVCA 3BKFA 2CA9A 2CPGA 2HZAA 3VW4A 2BNWA 1ARQA 1P94A 3FT7A 2BA3A 3H87C 2K1OA 3QOQA 1BDVA 2AY0A 3LGHA 4ME7E 1Q5YA 2BNZA 2HZVA 1MNTA 2GPEA 2NZCA 2CADA 1IRQA 1BAZA 2PC6A 2K6LA 2BSQE 2WVBA 3PHTA 1ARRA 3FMTA 1MYKA 1PARA 2RBFA 1QTGA 3QSIA 2CAJA 2KELA 1BDTA 1Q5VA 3VEBA 2BJ8A 2CAXA 4FXEA 2JXIA 1MYLA 2F1FA 2FGCA 3BKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9P A;  3GXQ A;  2K5J A;  4D8J A;  2K29 A;  1B28 A;  2BJ3 A;  2JXG A;  3VEA A;  2WVD A;  3OD2 A;  2K9I A;  2Y3Y A;  1NLA A;  2JXH A;  1EA4 A;  1B01 A;  2WVF A;  2H1O E;  3BKT A;  2BJ1 A;  4HV0 A;  1X93 A;  2BJ9 A;  2WVE A;  2BJ7 A;  2WVC A;  3BKF A;  2CA9 A;  2CPG A;  2HZA A;  3VW4 A;  2BNW A;  1ARQ A;  1P94 A;  3FT7 A;  2BA3 A;  3H87 C;  2K1O A;  3QOQ A;  1BDV A;  2AY0 A;  3LGH A;  4ME7 E;  1Q5Y A;  2BNZ A;  2HZV A;  1MNT A;  2GPE A;  2NZC A;  2CAD A;  1IRQ A;  1BAZ A;  2PC6 A;  2K6L A;  2BSQ E;  2WVB A;  3PHT A;  1ARR A;  3FMT A;  1MYK A;  1PAR A;  2RBF A;  1QTG A;  3QSI A;  2CAJ A;  2KEL A;  1BDT A;  1Q5V A;  3VEB A;  2BJ8 A;  2CAX A;  4FXE A;  2JXI A;  1MYL A;  2F1F A;  2FGC A;  3BKU A; 
#chains in the Genus database with same CATH topology
 5B09 A;  2WOM B;  2XBP A;  5F41 A;  2WK4 A;  5HQL A;  4Y28 C;  3GIR A;  1LOU A;  2DGV A;  1FNX H;  2E29 A;  1A0O B;  2GHW A;  2RJZ A;  4OYP A;  4K4W A;  1CSJ A;  2KJV A;  1DLO B;  1KLM A;  2KVQ E;  2Z2L A;  1PCA A;  2VOO A;  3L7U A;  2VJU A;  4CM2 A;  3LPE A;  5LSL A;  1KQG B;  2ZDO A;  3AA9 A;  2E5I A;  2NPI A;  3VAG A;  1M1H A;  3H87 C;  2HFO A;  4OI3 A;  2NR0 A;  3MD3 A;  3V6H A;  2W8K A;  4R25 A;  4UOF A;  2QLF B;  4OI1 A;  5FLX Y;  2G13 A;  2C3P A;  4X2B A;  3ONQ A;  2XMV A;  4KFB B;  3B8H A;  4RW4 A;  2DNM A;  2PI4 A;  1R3N A;  2LU2 A;  3LF0 A;  4JI2 F;  3LP1 B;  2AJ2 A;  3MPU B;  1VK3 A;  3ZZ0 A;  1DTT A;  1Y7P A;  1KOH A;  1R89 A;  3PJ9 A;  4NYO A;  4ZLL A;  1YSJ A;  2UUA F;  4IOB A;  1CPZ A;  3SSS A;  2LA4 A;  1FCA A;  1X4F A;  4I2Q B;  5CYJ A;  2OFH X;  2DH9 A;  2BV3 A;  3I6P A;  3SV3 A;  2YNF B;  2JL9 A;  5KG5 A;  4NLG A;  1PJ7 A;  3JQJ A;  2JHE A;  1LKZ A;  3RB0 A;  2RDI A;  4W98 A;  2BAN A;  5DDR C;  4WCE Q;  1XC9 A;  2AV5 A;  1TL5 A;  5FJ4 A;  1NHK L;  2M52 A;  1IBM J;  2M9K A;  3EZU A;  1X9W A;  1RK8 A;  1DLO A;  1KLM B;  4EI2 A;  2K06 A;  3AOB A;  3MD1 A;  1ZPW X;  2VBW A;  1WOP A;  4ELU A;  4FYX B;  4DQR A;  4C8Z A;  2CPE A;  4R8U A;  3CWJ A;  4PWW A;  1RTI A;  1IN0 A;  2ZE2 B;  2ZH2 A;  4L73 A;  4WJB A;  1FD2 A;  4PPD A;  4LF9 F;  2VG6 B;  4DSE A;  1R31 A;  3EIC A;  5J2Q A;  1PAU B;  1O51 A;  4D8J A;  1TU0 B;  5K5M A;  4LF6 F;  2MZR A;  1IKX A;  3MCO A;  2DH7 A;  4ECT A;  1Z2Z A;  1RTZ A;  5G4D A;  1YJ9 S;  4DL4 A;  5LXY A;  3A8K A;  3LTO A;  1RU1 A;  4NZ6 A;  2Z56 B;  2QRR A;  2DHH A;  1FXL A;  2K8G A;  4MYT A;  2KZM A;  1N5Y A;  2AGQ A;  1MWY A;  1Y3J A;  3G2X A;  1IXK A;  3N6L A;  1SC1 B;  4ZPD A;  2NRE A;  3M2U B;  4MFB A;  3OVS A;  3PX6 A;  3HXM A;  1U6B A;  3EXY A;  2D3O 1;  2UXC F;  2BR0 A;  3JSB A;  3TAM B;  1RTH A;  2YNI A;  3AB2 B;  2NYH A;  3OFH A;  4H4K C;  1XR5 A;  5D0E A;  4P10 A;  5E3R A;  2B7B B;  2GGP A;  1SVD A;  3ET6 A;  4I0W A;  3MMB B;  1PBA A;  2GFF A;  2HMI A;  1C1C A;  1Q16 B;  5ETV A;  2XMK A;  3CCW A;  2EKY A;  2F9D A;  1MG7 A;  2HQC A;  2V2K A;  4USI A;  3DHX A;  1NK8 A;  1LWC B;  1RT1 A;  1CLF A;  2ACY A;  5EDW A;  2MGZ B;  1GTH A;  4LFA F;  2RKI B;  4IR9 A;  1WHX A;  1WD6 A;  3BM7 A;  3LP0 B;  1RTD B;  1TP7 A;  1FKP A;  5KFJ A;  2LU1 A;  3C66 A;  3I9Z A;  2XGP A;  2XEX A;  3GFX A;  2ZD1 B;  4CLK A;  1LEO A;  3GFH A;  1F60 B;  2MZ1 A;  3R27 A;  2B4O A;  5LM7 E;  2AEJ A;  4A8Q A;  3DRP A;  1Y0H A;  5CCL A;  3G8Q A;  2AYB A;  4DR1 F;  2DNK A;  2GMH A;  5CD4 A;  1O6X A;  1L3S A;  2OJ3 A;  4WF9 Q;  1HQE B;  3D1Q A;  1NSK L;  1KFD A;  5KG2 A;  1WKL A;  4JBC A;  4A47 A;  5DJB A;  1B4S A;  1KOO A;  3W2V A;  2J8S A;  1H73 A;  5HQ8 A;  2HHU A;  1UFW A;  2HBR B;  2PII A;  4MAK A;  5IV4 A;  1CUL A;  1NH8 A;  4IO9 Q;  5D15 A;  3CT9 A;  2L08 A;  4YQW A;  3CJ3 A;  3F44 A;  3KNA A;  1S1T B;  5T14 A;  3OJS A;  4DLG A;  4OI0 A;  1RAO A;  5FDL A;  2M8D B;  1V9O A;  3VTI A;  3SSQ A;  2N4D A;  3NGS A;  4ZOS A;  1ZM4 A;  1XJW B;  3HP6 A;  4I6Y A;  2GJI A;  3CJK A;  2ZIT A;  4HI1 A;  1KD1 T;  5CD4 H;  4X4N A;  5K8O A;  3W7B A;  1GK8 A;  1GXL A;  3GG0 A;  1WHY A;  2HK2 A;  4OLP A;  1RAF B;  1FTC A;  2EWH A;  2DB1 A;  1FES A;  2D41 A;  3HMJ G;  2B9Y A;  5JVH Q;  4IFY B;  1RAG B;  1TTH B;  1WOO A;  2VPW B;  3D6T B;  2J6U A;  4B9N A;  2UXB J;  9ATC B;  1Q5V A;  2EKN A;  4RWW A;  3GCW P;  3TQE A;  2NPF A;  2PA8 D;  1PBU A;  1VIS A;  1ZH5 A;  1N54 B;  3NAI A;  2KVI A;  5E3C A;  1IBK F;  4JI7 F;  3A8I A;  1NB7 A;  2UUC F;  3KUH A;  1D9D A;  1X4C A;  1NJZ A;  2KXN B;  1WC1 A;  2GO9 A;  1CJT B;  5ITH A;  3D0G E;  1FDD A;  4JI1 J;  4KHP J;  3LO3 A;  1NJY A;  4TKT A;  3FRZ A;  4J9R A;  3HO1 A;  2WVC A;  2E44 A;  2HQG A;  2GQQ A;  3BN7 A;  5D0R A;  3UVJ B;  1JLC A;  5HVG A;  2HPU A;  2CQ4 A;  2GMJ A;  3KJN B;  4OHX A;  4WFX A;  5HAT A;  2ZFH A;  3ZZY A;  4DZ6 A;  5HSP A;  3NOC A;  3RRG A;  4QR0 A;  1KDN A;  4NML A;  3OFF A;  4ECY A;  1K1Q A;  3FCV A;  2Q6C A;  1CC7 A;  4P6Q A;  2D1C A;  2B8P A;  4HVZ A;  2HHH J;  3AXM A;  5HLF B;  2OFG X;  4LF1 A;  5CHC B;  4OYZ A;  3NEK A;  1Q78 A;  1HNX J;  3PRD A;  4KGV B;  1RA7 A;  2YKP A;  2HG4 A;  5IZH A;  4DL3 A;  2MQQ A;  1IR1 A;  1OSD A;  1ZA1 B;  1YRU A;  3C16 A;  5KAK A;  3GIM A;  2JXG A;  2YBV A;  1MRO B;  5F9N A;  2VA3 A;  1DQ9 A;  1F5A A;  4K59 A;  4QIE A;  1WDD A;  2QT7 A;  3UVJ A;  2H1O E;  1VDH A;  4C48 A;  3T5H A;  3PX4 A;  4K4V A;  2E5L F;  5KFZ A;  4WIQ A;  4N56 A;  3D66 A;  3FVY A;  4Y00 A;  3PY8 A;  4DS5 A;  4EZ9 A;  3FT7 A;  2C2D A;  2UU9 J;  2C42 A;  4TY9 A;  4M8L A;  2BMB A;  3WC2 A;  4M94 A;  4K5S A;  3BR9 A;  4S0M A;  3TVK A;  2DGU A;  4KGK A;  3SZ2 A;  5CYM B;  1D9A A;  1RTD A;  2UV8 G;  1D09 B;  3WQP A;  2FLO A;  3G5O A;  3CTR A;  1BAZ A;  1WI8 A;  3ISZ A;  4KGM A;  4F3Q A;  3KMS A;  4OZN A;  1YZ7 A;  2E1C A;  2UUB F;  1Q86 T;  2HVI A;  3QIP B;  4K4Z A;  1N33 F;  1Y9O A;  2VV5 A;  4WFA Q;  2DCU B;  2ZUG A;  3JSY A;  3OL7 A;  4DR5 F;  4XDC A;  2KKH A;  1KRP A;  4CCH A;  4ERD A;  3OTO F;  2CQ1 A;  4NCG A;  4WP9 A;  1FVQ A;  2J5A A;  3DDN A;  3M1V B;  3M7V A;  3MCN A;  2F4V J;  1F6T A;  3C14 B;  5THW A;  1UW9 A;  2B5J B;  3AQO A;  2W1B A;  3DLE B;  3TAQ A;  1S1W B;  2ZM6 J;  4LMZ A;  2NZ4 A;  5D8H B;  2J8A A;  2HQD A;  1DAR A;  2DIU A;  4O4R A;  2HHS A;  4CYU A;  4JV0 A;  3T1Y J;  2PMH A;  2V4J A;  5FDL B;  2Y0S D;  2BAB A;  1TKZ A;  5HJY A;  1SKR A;  4IRK A;  1TL7 B;  1TEL A;  2E1R A;  2ROE A;  4C2M A;  1SKS A;  1YJW S;  5BYR A;  2HW3 A;  4O44 B;  2QN6 B;  3S8S A;  1S1U A;  4ZIT A;  1CJU B;  3B82 A;  2DHA A;  1IM4 A;  2RF2 B;  5J2Q B;  3UN5 A;  1TK8 A;  3M05 A;  3DN9 A;  1RWM B;  2OD6 A;  3AQP A;  2YQ1 A;  4RNH A;  1V3R A;  5BYQ A;  5HMY A;  1ZAV A;  1F2G A;  2BKP A;  3M6X A;  3IS9 B;  2ALY B;  2HNZ A;  1FRL A;  3H2V E;  2JX2 A;  2FJD B;  3PAC A;  3ZZO A;  5GAE U;  2CPX A;  2WRM A;  1U9P A;  2XO6 A;  2QA4 G;  2GC8 A;  3HD1 A;  2KM8 B;  4A8M P;  4I7F B;  4M5N A;  5KG4 A;  1U6Z A;  5IFM A;  2OPP A;  3H2U B;  1HBM B;  1YJ7 A;  3MR6 A;  1U0H B;  4ZVT B;  5I42 A;  4ALZ A;  5KFR A;  4ZK7 M;  3UCZ P;  1XN9 A;  2BQ3 A;  1TV6 A;  3M32 A;  3VGT A;  3HHN B;  2W25 A;  3W5Z A;  4DV5 F;  5HMW A;  1NB2 A;  1LWC A;  1RT1 B;  4J9V A;  3OUY A;  7FDR A;  3H90 A;  2FHJ D;  1YBA A;  2ZH7 A;  4ILL A;  3CC4 S;  2YTC A;  1NRK A;  1ZOT A;  4J7C A;  1FHT A;  3FUY A;  5L1J A;  1ZZF A;  3IRX B;  2Z2Z A;  2CAJ A;  3EDR B;  3QPI A;  2L9D A;  1LFP A;  4ECX A;  3C6U A;  4DPT A;  2Q3P A;  1NSQ A;  2R8G A;  1TVR A;  1FNO A;  2FGC A;  2NLW A;  4DL2 A;  1FJG F;  3HVT B;  3UN2 A;  4UT4 A;  5HN0 A;  2KZZ A;  1J5E J;  3THT A;  3I56 S;  1EAR A;  1EET A;  1MU2 A;  4URG A;  4X65 J;  2VQE F;  3BO3 A;  2FLP A;  1B0P A;  3NGD A;  1TMM A;  4LRA A;  1U1N A;  3D68 A;  5B08 A;  1XR7 A;  3T9Z A;  2UUW A;  1FEH A;  2YXL A;  4AE5 A;  1IKX B;  4OYM A;  4Y0F A;  1NZ8 A;  4FN5 A;  1YX2 A;  4F0K A;  1DRZ A;  1FFG B;  4KJI A;  2FVP A;  1IKV A;  4JI1 F;  3JQK A;  1KVJ A;  1PIE A;  1QY7 A;  2AEF A;  3C19 A;  1MSW D;  3KLE B;  3PHT A;  4ECR A;  4QWB A;  1HBN B;  4K5R A;  2F65 A;  1QVG R;  2GVD B;  2VB6 A;  3BR8 A;  5MAO A;  2GX8 A;  1S1X B;  1GTE A;  3QLH A;  3I55 S;  2CJK A;  4CLW A;  4FF3 A;  2UUT A;  5JMN A;  2M5Y A;  1IWG A;  1A7G E;  4DPW A;  4GVL A;  3OPK A;  5C25 A;  2D9O A;  4NLV A;  2BAN B;  2UZA A;  5RUB A;  1UA0 A;  4K0K F;  2BJ1 A;  1LWE A;  1REV A;  2HUR A;  1JLG B;  4FKX A;  4CLP A;  2D3U A;  2YNF A;  4Z7Y A;  1HNW J;  3QZ7 A;  3FEX B;  1VHI A;  2G0I A;  2OEL A;  3NY0 A;  3J7Y U;  3O1L A;  2XS7 A;  5HK4 A;  2XGQ A;  5IC4 B;  3OSP A;  1VYA A;  1CJK A;  3H7H B;  3CJ0 A;  2NZC A;  5ETS A;  3SEO A;  3GV5 B;  4NLW A;  3Q8Q B;  1XNR J;  1KSP A;  4PCQ A;  2KHC A;  3M8S A;  3C2P A;  2ZBR A;  2R8K A;  3BH7 B;  1LWF A;  4ECQ A;  4I2P B;  1U7L A;  4LRC A;  4L72 B;  5AXM A;  2W9A A;  4M1K A;  4NYZ A;  1VQO S;  3F0N A;  3EYZ A;  2ZOG A;  3A1Y G;  1Q8B A;  2XNR A;  4DV4 J;  3CCS S;  3K8V A;  2RIJ A;  1TV6 B;  2FY8 A;  2GA7 A;  1PG5 B;  2HAF A;  4OJ1 A;  4TLR A;  2RU3 A;  1U0H A;  1Y5I B;  2NYI A;  4Z37 A;  1WEZ A;  2GQ2 A;  4LFB F;  5DO2 A;  1UL3 A;  1QDU B;  1S0V A;  1ARQ A;  2W2P P;  2KU7 A;  3LA0 A;  3BGR A;  3QLH B;  4HYK A;  2H54 B;  4QBU A;  4BBY A;  4RKU C;  3WBZ A;  2BRL A;  4N47 A;  3W5Y A;  2HNZ B;  2V63 A;  4K4X A;  2COL A;  1JKH A;  1EJ7 L;  3I0R A;  3L7P A;  3FMT A;  4LBP A;  4RWX A;  3T6J A;  3DKD A;  2IAJ B;  4HTI A;  1F5B A;  3KG1 A;  2KRR A;  5LT5 A;  1W26 A;  5DQG A;  2DNP A;  2YPY A;  4U67 Q;  3GU0 A;  3W9H A;  4ANC A;  4YY3 J;  1YJN S;  1FK9 B;  1RHK B;  1RBA A;  1S10 A;  1ZA2 B;  5CAA A;  4DCO B;  1BQM A;  2OPQ A;  3NGR A;  1M5K C;  2K1R A;  3NCQ A;  2B4U A;  2E7W A;  3OR1 B;  3TWZ A;  4ATN A;  5KFW A;  2BKO A;  1TFY A;  2CPZ A;  3OVA A;  5A0Y A;  2ADL A;  2Q2K A;  3NWG A;  3N5B A;  1XNQ J;  3CUL A;  1NZA A;  4IG0 A;  4AQY J;  3NNH A;  3DMJ A;  2M70 A;  3MMJ A;  3RW7 A;  4GO5 X;  1FI4 A;  1VQY A;  2IJN A;  3CB4 A;  4ES1 A;  4NCG B;  1Q5Y A;  1R27 B;  3M30 A;  1PAE X;  2CAD A;  4JB8 B;  4ED1 A;  3KLI A;  1S6P A;  1OPZ A;  2X1B A;  3C6T A;  3DOL B;  3MMA A;  4OZJ A;  5K14 A;  4ELT A;  3M8P A;  4LBH A;  4F50 A;  3HHL C;  1FRJ A;  4OI2 A;  3PEJ A;  4ZPC A;  3CC7 S;  1M1G A;  2P9G A;  4AFF A;  2DGO A;  3M6W A;  3U7J A;  1PKU A;  1RAA B;  3MPY A;  3HHD A;  4QCL A;  1K9M T;  2OPS A;  4PYD A;  2EVZ A;  2R4F A;  2M3D A;  1NK5 A;  2DNL A;  3GCX P;  1WKK A;  1LXN A;  4B9M A;  2F3J A;  4RNF A;  1FER A;  3BZQ A;  4NEZ A;  2O5D A;  5AE3 A;  5F8G A;  4FPI A;  1I3O B;  2VBX A;  1SPB P;  3AD8 C;  3OXG A;  1NPP A;  3ZTS A;  3GQC A;  2BKN A;  2V5H G;  4NI2 A;  3UR0 A;  3PW0 A;  3PW4 A;  2Z0G A;  2ZNY A;  5HBM A;  4PQA A;  4DX6 A;  3DRS B;  2J0W A;  1N52 B;  4HR2 A;  2E1A A;  2DNN A;  5IC6 B;  1S6U A;  4AUK A;  3GR1 A;  8ATC B;  4R5P A;  3G96 A;  1KS2 A;  2BRK A;  1Q95 G;  2OTL S;  1RT2 B;  3HKZ D;  1HIY A;  2A1B A;  3R5A A;  3T5K A;  4CYU B;  5IT9 U;  3BS9 A;  2F63 A;  3AJ2 A;  4K4T A;  4TVA B;  2YKN A;  3UPF A;  1S1W A;  5J1N A;  2CZ4 A;  2M2B A;  1JLC B;  1URR A;  2N4C A;  1D8Z A;  2XUL A;  4WU3 A;  5D0G A;  6FD1 A;  1U1P A;  3PO5 A;  3J7A 1;  1JLF B;  3M1V A;  4E8U A;  4DWI A;  4EWT A;  4UY8 5;  3G9C A;  1KTQ A;  3IN5 A;  2YNG A;  4J9O A;  2W2O P;  4AD6 A;  3ZZT A;  4IO1 A;  2C3O A;  3RBD A;  2DO0 A;  3HT3 A;  2JLE A;  2DTJ A;  4RU2 A;  3MTK A;  3KK3 A;  1T94 A;  2WON B;  5KFG A;  3NOG A;  1RWK B;  4DFK A;  5B0E A;  4B3T F;  4AND A;  4C8L A;  5DG9 A;  2X1A A;  1EET B;  1ICE B;  2B9W A;  2GVZ A;  3TO8 A;  1SQG A;  3MEE A;  5KFU A;  1FVS A;  1B01 A;  4C9D A;  2XSJ B;  4E0D A;  3KLF A;  4ID5 A;  4HT7 A;  3WC0 A;  3H2L A;  3K2Y A;  2Q43 A;  3M2R B;  5LJ3 Y;  5KFS A;  3ZNU A;  1VQ9 S;  4UOG A;  4C11 A;  2VFT A;  4JV2 A;  4Q44 A;  2P9E A;  2JEJ A;  1I94 F;  4Y65 A;  3OT9 A;  2QSW A;  5M2U A;  2WVE A;  2RUG A;  3QMQ A;  3Q83 A;  1JLA B;  2U1A A;  1UWB A;  2LVW A;  2A3J A;  4G1Q B;  4J91 A;  3MAH A;  1IQT A;  2GIR A;  2VDH A;  5C5J A;  1VQN S;  1AXQ A;  2H4W B;  5GAE I;  1BLU A;  4KPC A;  2GS8 A;  1FJC A;  3EGN A;  3KTQ A;  4DR6 J;  3I0S B;  1DQ8 A;  1F1B B;  1WHW A;  2FJB B;  4MIW A;  4P2M A;  4V1A k;  4ZVR B;  5J1E B;  1JLB B;  3H98 A;  1YRT A;  5ETP A;  3MM6 A;  3BDE A;  3O6Q A;  5IV3 A;  3CJS A;  2XHW A;  4WE1 A;  5A6W A;  1FF2 A;  3W60 A;  5IS2 A;  2W9B B;  4V19 X;  3HHE A;  4LF5 F;  4B3O B;  1UVI A;  3PYD A;  1T3N A;  3ISN C;  4Q0B B;  2FJE B;  1KVI A;  3QID A;  2MST A;  3H20 A;  3PCO B;  1TKT B;  1N5Q A;  2VIH A;  1V3Z A;  4O3R A;  1ZM9 A;  2VPZ B;  3HFK A;  2ATC B;  4OYB A;  2H4Y B;  5KT3 A;  2EW9 A;  3BPD A;  3JSR A;  3MR7 A;  2OGU A;  2GML A;  1S57 A;  3L95 X;  3ZTQ A;  3DOM A;  3TNV A;  2A2C A;  5KFL A;  4ER8 A;  5ETT A;  3PVX A;  2V4J B;  5CCM A;  4HL9 A;  3CPW R;  4G1I A;  1U49 A;  2C2O B;  2CDR B;  3D0I E;  4NXM J;  2MQN A;  3M2V B;  1XR6 A;  2AF6 A;  2RAQ A;  4IFY A;  4MKA A;  3JTN A;  5C2G A;  2AJQ A;  2BYC A;  3L09 A;  5B0G A;  1OO0 B;  3EUN A;  2CQC A;  4Z2X A;  5DGA A;  3QO9 A;  1BC6 A;  1QUP A;  3BQ2 A;  3NAH A;  3K17 A;  1KQS R;  2HS4 A;  2OMO A;  3DCA A;  1FEE A;  2YX1 A;  3D9B A;  4PXD A;  1HLW A;  4LUB A;  4HAC A;  4PZV A;  2B6A A;  4WYL A;  1A9N B;  2V2Q A;  1OQ6 A;  4Y2K A;  2CKW A;  3QNW B;  3VZH A;  4B3M F;  1GMW A;  2MQO A;  5F8J A;  5E7O B;  5L46 A;  5M2R A;  4JUZ A;  2ZH6 A;  3NXZ A;  3RBX A;  3MF5 A;  1WC6 A;  3OFE A;  4ZJO A;  3A8E A;  4CT9 A;  1RP5 A;  4OYA A;  3DOM B;  5FII A;  3SIP B;  4IFV B;  3BGU A;  4P75 A;  1J27 A;  5KG6 A;  3TW0 A;  3LQV A;  2YWW A;  2CYY A;  2GQC A;  1R7I A;  3I5B A;  1T3O A;  2A2D A;  3MWB A;  1TKT A;  1RAD B;  4UQG A;  3FBE A;  3H25 A;  1GFW B;  1B0V A;  3ELH A;  1HFE L;  4ES3 A;  2R7V A;  4QIF A;  1M90 T;  2UP1 A;  3Q8V A;  4M5I A;  3ILL A;  4K8R A;  3PHE A;  2IMO A;  3H40 A;  1N0U A;  1AUD A;  3A13 A;  3RR7 A;  2R7W A;  4I6A A;  1AZS A;  5LXR A;  4N5S A;  4QW9 A;  2Q1L A;  3C15 B;  4K4Y A;  2FHJ A;  3KK1 A;  1RKI A;  2WVD A;  1U1L A;  1FRM A;  5ETK A;  3BV8 A;  4GKJ F;  3CED A;  1EQM A;  1EP4 A;  2J7K A;  5HBM B;  1XNQ F;  3HX9 A;  5A8K B;  3CJR A;  1S4E A;  4U9R A;  1UTA A;  5DZ7 A;  3PV8 A;  3RR8 A;  1UWB B;  4MK7 A;  3WDO A;  1YJU A;  1D8Y A;  1VQK S;  4C6A A;  2OSQ A;  1U24 A;  4I2Q A;  4ZS6 A;  2MKK A;  1XTZ A;  2DGQ A;  2E1P A;  1Q82 T;  2CUY A;  2HGM A;  3O2I A;  2V2Z A;  4DFM A;  2DGT A;  2QA2 A;  1EX8 A;  2V8V A;  4OYO A;  4KSE B;  2J9E A;  4OHV A;  3QRQ A;  1HW9 A;  3P3D A;  1TAQ A;  2DEI A;  1UFK A;  2VHG A;  1TFW A;  3EVO A;  3MOZ A;  4KFB A;  6FDR A;  4DL6 A;  3BO2 A;  4KRW A;  4U7U D;  4AXI A;  1R8B A;  3PEH A;  3NL0 A;  1U2F A;  2BE2 A;  1RT6 A;  2JOQ A;  3GXQ A;  2PMW A;  1REV B;  3QAT A;  1KVK A;  1FJE B;  3NMR A;  4J37 A;  4L3N A;  3ZZR A;  1FT8 A;  3T5L A;  2LKZ A;  2CIM A;  3QBC A;  1SQF A;  4J9K A;  1FRX A;  2GVD A;  3A8J A;  4LR8 A;  2OEJ A;  2WTF A;  1JLE B;  3I5A A;  3MM8 B;  4J9S A;  2RDD A;  1NK6 A;  2YKN B;  3FNN A;  3P45 B;  1SIW B;  3KLE A;  5A0Y B;  1LV5 A;  1H38 A;  3C3L A;  4F02 A;  1H7W A;  3CJT A;  4ETX A;  1HNI A;  1OYE A;  2FC8 A;  4X65 F;  4M5H A;  2E1M C;  3VEB A;  2WBR A;  3AT1 B;  2RQM A;  4ED8 A;  2W24 A;  1Q7Y T;  4LF4 J;  2QTW A;  4QR2 A;  4O23 A;  2RHS B;  3U1L A;  1SL2 A;  4A8W A;  3FK4 A;  2SXL A;  3DM2 A;  3JSM A;  1HNV B;  2LQB A;  4LBI A;  3MEC B;  4DXL A;  1D0E A;  4NMX A;  2FLN A;  3V81 B;  3VGU A;  2C2N A;  4DX7 A;  4CLY A;  2QO3 A;  2VH7 A;  1UVN A;  3MOJ B;  4LR7 A;  3QYY A;  1MU2 B;  2ZH5 A;  2EI5 A;  2NCK L;  3KFW X;  3T3F A;  3CMQ A;  4NLS A;  2LEP A;  4PXE A;  3R5D A;  4K0K J;  5LMN J;  2R8I A;  1SJ1 A;  3US5 A;  4LIW A;  2YWG A;  3TOQ A;  3RBZ A;  3X3U A;  3H42 A;  4DX5 A;  3PX0 A;  2UU9 F;  2J9C A;  1X8D A;  2HZV A;  2BAC A;  1N8R T;  2OML A;  1JXE A;  5ETM A;  5KFM A;  3G6X A;  2J7W A;  2NXJ A;  3LAN A;  2FD2 A;  1U2R A;  3LP0 A;  1QAX A;  4IDK A;  4QR1 A;  5J1P A;  3PM9 A;  3FC9 A;  2BOP A;  1P6T A;  5A76 A;  4J9Q A;  4DLE A;  1URN A;  2AEM A;  4WII A;  3SV4 A;  2MZQ A;  2RNE A;  2A10 A;  4YN3 B;  4B08 A;  1RCX B;  3JQM A;  1UVK A;  3CO9 A;  5IWA F;  4PAA A;  2KRB A;  1VBK A;  3CCV S;  2QL9 B;  4WYW A;  2XWX A;  4P52 A;  3LUY A;  4TN2 A;  5KFY A;  2BJ3 A;  2MY8 A;  2OPP B;  3M8Q B;  2QLB B;  2V67 A;  1ZPV A;  3CE8 A;  4LSZ B;  4A46 A;  3HI9 A;  3TAP A;  2IBK A;  2JEI A;  3Q8Y A;  3VCD A;  2I1R A;  2NXE A;  2ZWO A;  3P5T L;  2KFY A;  1E6Y A;  1U6F A;  3S01 A;  3H4D A;  2QEX S;  2IM3 A;  4Y2M A;  3HT0 A;  4Y6I A;  4KYZ A;  1MWZ A;  3T1A A;  5F8I A;  3AJD A;  4IG0 B;  2DY1 A;  4B3R F;  2P9C A;  2IMW P;  1FX2 A;  1FRH A;  1NJI T;  2DBB A;  3CF5 Q;  2FQQ B;  3JSM B;  1U48 A;  3AY0 A;  4O0N A;  2XS2 A;  4Y3C A;  4PG4 A;  3GYX B;  2F8M A;  4X4T A;  2AJ1 A;  4DUT A;  4XO0 A;  1ROF A;  3CCR S;  2V68 A;  5B0D A;  5C24 A;  2YKM A;  1NU4 A;  3FBF A;  4DI6 A;  3ZC4 A;  5KT4 A;  3QJP A;  2R2S A;  4IG3 B;  2CQ3 A;  1FDB A;  2AQ4 A;  3TJ9 A;  4B9V A;  2CWX A;  2GIQ A;  4QJV A;  2DGS A;  4WXO A;  2AZ3 A;  1JLE A;  1M5S A;  3CIZ A;  3QGH A;  2IDL A;  4FP9 A;  4QIV A;  5B0A A;  4OZ3 A;  4B9U A;  3E01 B;  2AGP A;  4F04 B;  1HR0 F;  2OEK A;  2QLW A;  2LXU A;  1JNZ B;  2OHD A;  2R7O A;  4LQ3 A;  3WX8 A;  5KG7 A;  3TEG A;  3J81 Y;  3J7Z 5;  2FJW A;  1V6H A;  3GV7 B;  1CQM A;  4ED2 A;  1VIO A;  4YS2 A;  4DFP A;  1S76 D;  2F4F A;  2ZOM A;  5K20 B;  2FZG B;  2H5E A;  5DDO C;  1Q8I A;  5JJB A;  1JNR B;  1RT3 B;  4FS2 A;  2DNH A;  3FBC A;  3K8W A;  3W65 A;  4WFN Q;  2LEC A;  2D3O R;  1HMV B;  1RWO B;  4PKD B;  4X62 J;  1RE1 B;  4YR0 A;  3H4B A;  1U1Q A;  2XYP B;  2F7V A;  1RWW B;  3KG4 A;  5FD1 A;  3UE2 A;  4C3L A;  3LWL A;  3V4I B;  3SI8 A;  3OR2 A;  4YR2 A;  1SC6 A;  2VBZ A;  4PG8 A;  3A12 A;  3BQ1 A;  2B9X A;  5J2P B;  4DF4 A;  3DRY A;  2Z2Y B;  4FYY B;  3CDA A;  4OHY A;  3BSC A;  1S1V A;  1PYO B;  1X93 A;  2HRY A;  4DL0 C;  2FVQ A;  3Q86 A;  2HZA A;  1E6V B;  1TUG B;  2VD3 A;  5KG0 A;  1KFS A;  4DV3 J;  1U1R A;  3MEC A;  1LWE B;  4JI5 F;  1JWW A;  3EDQ B;  1I94 J;  2R7X A;  1KEK A;  1JMT A;  5H9F J;  2G2O A;  4EO8 A;  1VQ6 S;  3CD6 S;  4DV6 F;  1WEX A;  2CPH A;  1OPI A;  3BH6 B;  4PAB A;  5HVF A;  2YH0 A;  3GYN A;  5F3Z A;  3PKM A;  2RHQ B;  3HPO A;  2Y1I A;  3U02 A;  1VQ5 S;  4MKB A;  1T11 A;  2EG2 A;  3A3P B;  4GC7 A;  3MPV A;  2IHR 1;  1NDL A;  4BHQ A;  1F2H A;  3HVR A;  1VHF A;  3IBW A;  2W7P A;  2UUC J;  1KQK A;  1NJW A;  2Q79 A;  1HBN A;  2P8I A;  4WFZ A;  3LJP A;  3G82 B;  2IC3 A;  1JLQ A;  1SV5 A;  3ITH B;  4ZCK A;  3R9L A;  3GPA A;  4ANE A;  4CTA A;  2IYI A;  3KLH A;  1UAW A;  2PDA A;  3GJS B;  4N7T A;  4DQP A;  4ES2 A;  2N7C A;  1WG4 A;  3K57 A;  3LP2 B;  4OJG A;  3K59 A;  4MKY A;  3QAE A;  3Q8P B;  1FX4 A;  1NUE A;  3K5N A;  2Z57 B;  1U0S A;  4YDX A;  2C2K B;  5E33 A;  1SH3 A;  4O4G B;  1ACM B;  1H6K X;  3D1O A;  1QTN B;  3BGF A;  2OUG A;  4ZJQ A;  2L3M A;  1TKX A;  2QYG A;  3BGO P;  3VAK A;  2DNZ A;  2EBE A;  3HHK A;  1MML A;  1VQS A;  5KFT A;  5KFF A;  3DLE A;  4XIU A;  2B5J A;  1YTY A;  3C14 A;  2DPJ A;  1CS4 B;  4PEO A;  4PXB A;  3W8P A;  1S99 A;  1LFW A;  4BCA A;  1N5S A;  2QL7 B;  1H98 A;  2POK A;  1NM2 A;  4HH1 A;  2W9C A;  1KNZ A;  3M6V A;  4EO6 A;  2HGN A;  3PYE A;  3DLG A;  1X9S A;  2OKQ A;  1NK0 A;  1WI6 A;  3GJQ B;  2B4P A;  3E2E A;  4R0J A;  5H9E J;  1APS A;  1SC4 B;  2B0G A;  1WSR A;  1EKR A;  1FDA A;  1SB6 A;  2WZ1 A;  3K5M A;  4DV0 J;  2DCL A;  5KFO A;  3CJQ A;  5I42 B;  4QZV B;  2FYX A;  3EZO A;  3C15 A;  3IR6 B;  4GVB A;  3QT5 A;  3L9Z A;  5F8L A;  4ZKA A;  1U47 A;  4I7F A;  4P2S A;  1TR0 A;  1RAE B;  2XS5 A;  3IRW P;  4RW7 A;  2VDI A;  3ILO A;  1XWL A;  1MRO A;  2FJX A;  2U2F A;  2XMA A;  3DRX A;  1X4A A;  1RHU B;  4DHV A;  1LW2 A;  4P7T A;  3R97 A;  3CJ8 A;  1S6Q B;  1SI9 A;  2RT3 A;  3VVU A;  5DDP C;  2HNY A;  2D9P A;  4LRV A;  1ULR A;  3EMT A;  5CQG A;  1T9X A;  3FZB A;  4ZVF A;  2LEA A;  5HP1 B;  1VI7 A;  1X4G A;  1QE1 B;  4OZ0 A;  1YJV A;  1BQX A;  2CJ9 A;  4IFV A;  5KFB A;  3IR7 B;  4HDH A;  1YDL A;  3OV7 A;  1P27 B;  2DXF A;  1Z1Z A;  4M63 A;  4OI6 A;  4JI3 F;  1W2B R;  3QRP A;  2UXC J;  2HVE A;  1K0T A;  3J81 U;  2XCP A;  1LW0 A;  2ZH9 A;  1RGV A;  2JFD A;  1S7H A;  1XIQ A;  3IC1 A;  4B17 A;  3MMB A;  4A8S A;  3DLG B;  1X9M A;  5CZX A;  3AHP A;  3N6N A;  4C11 B;  5IOL A;  1IRQ A;  1RQ0 A;  3AOA A;  4DR7 F;  4LF4 F;  2BSQ E;  2MQ8 A;  2MSS A;  4ID5 B;  3M8Y A;  4DPX A;  1N5Y B;  2VPX B;  3GIK A;  1P9Y A;  3UW1 A;  2BUN A;  3A3N B;  4D3G A;  4JI5 J;  4I67 A;  1OMS A;  4IH7 A;  3NO7 A;  2HND A;  2FVR A;  5HRO B;  1H3D A;  2H5J B;  4U8V A;  5D4L A;  2M7S A;  5LOQ A;  1MW7 A;  3V6D A;  2ZOF A;  4EBD A;  3N9U C;  2FY1 A;  1S72 S;  2E9T A;  2MZS A;  3NG8 A;  4QPX A;  2MMY A;  3J80 Y;  2EXU A;  2MHN A;  4L76 A;  4IOA Q;  2FUG 9;  4DV6 J;  1HD0 A;  3BEG B;  2R7Q A;  3AD9 C;  3ZTP A;  5KT2 A;  1VC5 A;  4C8Y A;  4A8K A;  5L9N A;  1SUQ B;  2R42 A;  3CD7 A;  2JWN A;  3QOQ A;  1V5I B;  2KT2 A;  5FLX U;  1DY3 A;  2B9E A;  2ADB A;  5I3U A;  4YB5 A;  3F56 A;  1WAC A;  4NWB A;  2D69 A;  4OMF G;  1JJH A;  3J7Y I;  3IBC B;  3PRB A;  2VG5 B;  1GEH A;  4RBV A;  4B3M J;  3PW5 A;  1PSD A;  4CLT A;  1VRU B;  2C3Y A;  3UDE A;  2HHT A;  2XYG B;  2HBQ B;  4N77 A;  1HWU A;  1HBO A;  1UJ4 A;  5KFN A;  1FJ7 A;  4FXE A;  5AJ3 J;  5BYS A;  4YOE A;  4ZVU B;  1RWV B;  2DR9 A;  2UUA J;  4U96 A;  5I3Q A;  3BO4 A;  4ICL B;  3KLG B;  2X1G A;  4DR7 J;  2AX0 A;  1BY9 A;  1VGY A;  2YX7 A;  3CJ2 A;  6AT1 B;  4X4R A;  1DUR A;  5LMN F;  3VAJ A;  3PO4 A;  1N33 J;  1FKO A;  2HSE B;  1KKH A;  5L9X A;  4EUV A;  2VG5 A;  1PC5 A;  4DN9 A;  3LGN A;  2I2Y A;  2CA9 A;  2CPG A;  2EFO A;  5BXI A;  3O5T B;  4ZVE A;  4XPE A;  4NLT A;  5I3U B;  1FA0 A;  2DYA A;  2HK3 A;  4Q2L A;  4CLZ A;  2DNO A;  5J2M B;  2V69 A;  1U26 A;  1TAU A;  4WXW A;  3LP1 A;  2Y1L B;  2H3A A;  2G1H A;  2DIV A;  2XSJ A;  2ZC4 A;  1CJT A;  2Q6B A;  3OR2 B;  1SKW A;  3V4I A;  1M1K T;  1VLY A;  4RW4 B;  4GC6 A;  2DGW A;  5DGB A;  2GVZ B;  2VAS A;  3BSN A;  1FXD A;  1X5P A;  1HYS B;  2E5H A;  3SSR A;  1NK7 A;  3M8W A;  3NMA A;  5L1K A;  2BQU A;  1JX4 A;  2XM3 A;  1YRX A;  1R8A A;  3CC2 S;  1WG1 A;  3NS6 A;  3RYL A;  4QYZ J;  2BJD A;  1C1C B;  1MNE A;  3D67 A;  1T03 A;  1T9V A;  1S77 D;  2K3I A;  2CRL A;  3CCT A;  2XLJ A;  3Q89 A;  4USU A;  4R0E A;  4RNN A;  1RBL A;  3PYF A;  5CZV A;  1O5J A;  1F0X A;  4PG7 A;  4RU9 A;  1UFL A;  2FJA B;  4B9T A;  3D3B J;  3J80 U;  3MGJ A;  1SC3 B;  4NLP A;  4YFU A;  3RAM A;  1EB0 A;  3M9M B;  3QGP A;  2XMW A;  3ZZZ A;  2VQF J;  1QSS A;  2O01 C;  3TA1 A;  3DLJ A;  4TQR A;  1NCL A;  3I87 A;  2GJF A;  3BYR A;  3HSD A;  5E3P A;  2K1R B;  4DSF A;  1WEL A;  3X1L B;  2KYX A;  4R5P B;  1HA1 A;  3C46 A;  5IM0 B;  1QE1 A;  3A4T A;  1XBW A;  1CUL B;  4H4O A;  1EHW A;  2VFS A;  2HIY A;  2E66 A;  3T9N A;  4DG1 A;  3W2W A;  2W7O A;  2E9R X;  1M0S A;  1IM6 A;  1S1V B;  2WHO A;  3PDN A;  4Y2I A;  3R7N B;  3SDE A;  4YME A;  3R7S B;  4R8U B;  4EK2 A;  5J2P A;  4KTQ A;  4X4O A;  1PGZ A;  2VL1 A;  4MJW A;  2HFU A;  5L39 A;  3GV8 B;  1D3W A;  3MM7 B;  4IQM A;  3GR0 A;  4MK8 A;  4DV5 J;  3GLJ A;  4NLX A;  4LFC J;  4GKJ J;  1L3T A;  3KJF B;  3PRV A;  1NKC A;  1DJ0 A;  1WHV A;  5AXN A;  4B3O A;  1B7Y B;  4Y2C A;  4LF2 A;  2YH1 A;  2RVJ A;  1HHS A;  2AYM A;  2Z58 B;  3UD4 P;  3W8G A;  2X7I A;  1UVJ A;  2DT9 A;  3GFY A;  2OD4 A;  4DR4 F;  1RXO B;  3UO0 A;  4CLS A;  4ZCI A;  3KDN A;  3TP2 A;  1FKA F;  2HMI B;  2MQL A;  4QWE A;  2ACM A;  4O3N A;  1QUV A;  2HLU A;  3GE9 A;  3HM9 A;  4FPR A;  1K1S A;  2J6S A;  1HW8 A;  1DTT B;  1RUS A;  1S12 A;  4ZCL A;  4YEA A;  3TAM A;  1QSL A;  2XB2 D;  1TL1 A;  4EYH B;  2IM2 A;  2C2E A;  1I5O B;  5L38 A;  2WSC C;  5F9L A;  4RZR A;  4A8F A;  2XMM A;  2XO7 A;  3V6J A;  4AXJ A;  2X1F A;  5DG7 A;  3W2W B;  4CP5 A;  4NOH A;  1K47 A;  1XMB A;  3PIO Q;  1C0U A;  1OS5 A;  1R0C B;  3V4M A;  1SJ3 P;  1VQL S;  3CCM S;  3OR1 A;  4PG5 A;  3UQS A;  2MKJ A;  1HNV A;  3D54 A;  1F9E B;  4USH A;  4G3I A;  1RT5 B;  2UVR A;  1K0V A;  4J5O A;  3IP0 A;  4OX8 A;  4ZVG A;  5I4M A;  5C42 A;  1ARR A;  1M5V C;  4KR0 B;  4OIX A;  1R0B G;  1ZZN A;  2ILZ A;  3UNG C;  3S6E A;  1EAY C;  3FFI A;  5KFV A;  2W8L A;  3FGV A;  2PN6 A;  1SJF A;  4RUC A;  1M5O C;  5B0F A;  1SV5 B;  1JLQ B;  2BX6 A;  2HWI A;  2WOM A;  1OQ3 A;  3PFE A;  4KH0 B;  2FB0 A;  4UUW A;  4P71 A;  4C7Q A;  2DIT A;  2KT3 A;  4KT0 C;  1VLO A;  3BYP A;  1W7W A;  2PT0 A;  4OX7 A;  1HWI A;  4DBQ A;  4CO5 A;  1RB0 A;  3MTJ A;  4F36 A;  4LVN P;  4U6P A;  3RRH A;  3KK2 B;  2ZJR Q;  2DPI A;  4PRF A;  1VR6 A;  2KDO A;  3NGU A;  2XMU A;  4OYI A;  3TVZ A;  2HRT A;  2N3O A;  2M88 A;  5KFP A;  4IH6 A;  5A6P A;  2ZVI A;  2YKA A;  4DV7 F;  2K1O A;  1B0T A;  2B56 A;  2V8H A;  3AD7 C;  4Q45 A;  4OZ2 A;  3MFI A;  1C0U B;  4U7U K;  2ASJ A;  3CD0 A;  4IDK B;  1M5P C;  3SXL A;  4ED6 A;  2UVW A;  2IA0 A;  1RLD A;  1X5S A;  3D28 A;  3QSI A;  4MIA A;  3CCJ S;  3KUE A;  2OP5 A;  4ETZ A;  4ED7 A;  1UVL A;  1UET A;  1SIZ A;  3KJQ B;  5AJ3 F;  1IKY B;  1Y5L B;  2RU9 A;  4UTG A;  4RLE A;  1NDK A;  1OJ4 A;  3EVW A;  1XQI A;  3BKU A;  3UDC A;  5J2M A;  1YBT A;  2YWH A;  1RIS A;  1YWX A;  4L75 A;  2WBM A;  4YY3 F;  4FF2 A;  1GT8 A;  2PSZ A;  2O1P A;  1ZAX A;  3MEK A;  2K9I A;  1EA4 A;  1WF2 A;  2R8H A;  1WG5 A;  3GZ7 A;  2GHP A;  3PJW A;  3R2C J;  4J9U E;  3KXD A;  4HLB A;  3TR5 A;  2GAH C;  3OXF A;  2BQR A;  3TZZ A;  1N34 F;  2MTL A;  3ILI A;  3HHL D;  3IGN A;  5AXK A;  5C25 B;  3I4P A;  3QSY B;  1VCT A;  4EEY A;  3I5C A;  1MN7 A;  1HBO B;  5IWA J;  2ZJP Q;  3OTO J;  2IFX A;  3MUM P;  3UI3 A;  2W7A A;  2KL8 A;  3O3L A;  2CJX B;  4DU7 A;  3TA2 A;  3VV2 B;  4UZB A;  1VC6 A;  2CJA A;  3AXK A;  4USK A;  3TJ8 A;  2IY5 B;  3SDE B;  1UEV A;  1XER A;  1XK8 A;  5CH7 B;  2HHQ A;  4IG3 A;  4H4M B;  4NPO A;  5B7W A;  4HDG A;  2QZ8 A;  2HBY B;  3B78 A;  2PD1 A;  1QTM A;  1VQ4 S;  5EWG A;  3PW7 A;  1V5V A;  1QAJ A;  1VS3 A;  3DOK B;  1TQL A;  3HZE A;  3HSJ A;  4ZN1 A;  4DJB A;  4WP8 A;  4LSL A;  1IWA A;  1HI0 P;  3NNC A;  3FEZ A;  3CVK A;  4P73 A;  3VZI A;  5EN1 A;  2BW2 A;  1VMB A;  1H2U X;  2M8H A;  4OI4 A;  2G4B A;  1CEZ A;  2R7S A;  4ZIV A;  4HAC B;  2AU0 A;  4CO1 A;  4XTT A;  4WZQ A;  4ZLN A;  4DUZ F;  1U4B A;  2IM1 A;  1E6Y B;  4OLO A;  2P2C B;  2KG0 A;  4LF6 J;  3ULH A;  3EJM A;  5HO4 A;  4KHP F;  5I3P A;  4ZLP A;  3MMC B;  2D3Z A;  2UVU A;  4P74 A;  4UF4 A;  2DD8 S;  3HDS A;  4KBI A;  2EBG A;  3DLK B;  1QAY A;  2PE8 A;  3BN4 A;  4OQJ A;  8RUC A;  1OG7 A;  3HHL A;  2NQP A;  2V34 A;  3FDS A;  4PUO B;  1N32 J;  5A8K A;  2N3L A;  1S9G B;  2V8P A;  3IG1 B;  4CT8 A;  3TX0 A;  2K7K A;  3IM9 A;  3GB0 A;  4NLD A;  5DM7 Q;  1LK5 A;  4BC7 A;  1I1G A;  4KE5 A;  2IIH A;  1GH8 A;  1C2P A;  4X4U A;  1NPR A;  2K7J A;  3BSA A;  3SBM A;  1N36 J;  1Q7L B;  3MM7 A;  2WAQ D;  2BA3 A;  4KV8 A;  4JYA J;  4Q7A A;  1VQM S;  4F4A A;  4XK8 C;  5EHH A;  1R8H A;  2GCF A;  4RW8 A;  3ICL A;  4JV5 J;  3MR2 A;  5G0R A;  2GPE A;  1BHN A;  2B51 A;  2QGF B;  3MEG B;  4DG1 B;  3S1T A;  3UN3 A;  1HPZ A;  3C8Y A;  1MYK A;  4XAK A;  3TUJ C;  4DPU A;  5HI7 A;  4EU0 A;  1Z2L A;  2AHO B;  3V81 A;  1VQ8 S;  3TJA A;  3ZNJ 1;  2XI2 A;  3I0S A;  3KDO A;  2KTQ A;  2JC0 A;  4FYW B;  3AJ1 A;  4LRE A;  2CQ0 A;  4C8M A;  4F2S A;  2H9Z A;  1RTJ A;  1N6Q A;  1BQN B;  1HI1 A;  3DGP B;  3MUT P;  3IAS 9;  3BBC A;  2O3D A;  2WSE C;  4EBE A;  5ETR A;  3BKT A;  3MPD A;  3VQS A;  1Q8L A;  1OWX A;  2HIQ A;  3L7O A;  4URS A;  4A8Y A;  2ASD A;  3SMZ A;  1B7F A;  4NZ0 A;  3T41 A;  1C4C A;  1X4H A;  2VKR A;  1FO1 A;  4LR9 A;  2CWK A;  2FHM A;  2OO4 A;  1PC4 A;  1H7X A;  2JRS A;  3DGV A;  3VAH A;  4FF1 A;  4AAI A;  1UZH A;  1LWX A;  1J5O B;  3M2R A;  4BS2 A;  4I68 A;  3W63 A;  5L1I A;  3K5L A;  4M5J A;  3GJT B;  4ZVS B;  4LJM A;  1MNT A;  4B9S A;  1WNE A;  1QAI A;  2PEH A;  3SQG A;  3BGL A;  5A8R B;  3IO1 A;  1RA6 A;  1YGY A;  2VC0 A;  3CMA S;  4FDF A;  4JP8 A;  4FYV B;  2QA1 A;  4M5D A;  1RT6 B;  3UNY A;  2MJN A;  4J9P A;  2VA2 A;  4RUB A;  4LF8 F;  4X84 A;  4YP3 A;  5EX3 A;  3L4B C;  1XMO J;  1ARO P;  3TAN A;  3JYT A;  1F9F A;  1UCN A;  1U02 A;  3DLH A;  5A2Q Y;  4CDI A;  3MAA A;  3A3O B;  4NA1 A;  3K5O A;  2KB2 A;  2QYC A;  3KLH B;  2MKS A;  2BE7 D;  1X5O A;  3BKF A;  3ITH A;  2W4P A;  2IC3 B;  4M5M A;  1YJR A;  3O44 A;  4LF8 J;  2QJ3 A;  4Q0B A;  1J2V A;  3MXH P;  1IUJ A;  3C16 B;  2W01 A;  3EM1 A;  1DZ5 A;  4WE1 B;  3B4M A;  3TYT A;  5IQ6 A;  2W9B A;  3LGH A;  1RCO B;  2RRB A;  1ZTW A;  1TUV A;  3UR3 C;  5ETO A;  3E3X A;  5J1E A;  3QRR A;  1S1T A;  2WVB A;  1FWP A;  1F9H A;  2CZV C;  1R8P A;  1SH0 A;  4CWB A;  2YQ3 A;  3WX4 A;  4WK3 A;  1H2T Z;  4GRS A;  1X4E A;  4EMD A;  5HLF A;  3EZ5 A;  1TL4 A;  3MCS A;  5T41 A;  4X62 F;  1OSC A;  2D7S A;  4X4Q A;  3PFO A;  5HAN A;  1NKB A;  2DR5 A;  2XC9 A;  2EG1 A;  2F9J A;  2PI5 A;  2HHX A;  1G1X A;  1T95 A;  5D6G A;  5F8M A;  1X4B A;  1NSA A;  2K5J A;  2QA4 S;  4J9M A;  3VEA A;  3OVB A;  4KO0 A;  1NPK A;  2QMU B;  2PGC A;  3ZTO A;  3IFE A;  4K4S A;  3DRP B;  3KHL A;  4KV8 B;  4L74 A;  3EPI A;  3UCU P;  1S7I A;  4F26 A;  3IAM 9;  2C1E B;  2XNQ A;  5DET A;  2IVM A;  3MAA B;  1NK9 A;  4GVB B;  3RRK A;  5HL7 Q;  3MEE B;  4O3S A;  1HMV A;  1WTF A;  2AD9 A;  1T0T V;  3R6L B;  4J90 A;  2R3V A;  2KG1 A;  1CC8 A;  3V6D B;  1TK0 A;  5T7L A;  1X0F A;  1NH7 A;  4X64 F;  3MI7 X;  5F8N A;  3WIV A;  3HKW A;  3DOL A;  1IKW B;  1CVJ A;  4CNY A;  2GGP B;  3ET6 B;  3CCQ S;  5D3G B;  1G7C B;  2JBV A;  1AT1 B;  4C0H A;  2LXI A;  4M95 A;  4CH7 A;  3H0P A;  1GMW D;  2ROP A;  2YNI B;  2Z2M A;  4OZ5 A;  2N7Y A;  4ZP9 A;  4WTO B;  4TU8 A;  4WTY A;  1N5V A;  4FXV A;  1J5O A;  1PIL A;  2EFV A;  2C28 A;  5U47 A;  2VOD A;  2HEK A;  1REG X;  1KWM A;  3I82 A;  3DNC A;  2RS8 A;  3M9O B;  1UMJ A;  3L3C A;  2BJ7 A;  2RQK A;  2UXD F;  1LW0 B;  1B70 B;  1YIT S;  3U27 A;  4ED4 A;  2ZZN A;  4NLU A;  5KT7 A;  8AT1 B;  2NUH A;  3EX7 B;  3NNE A;  4DV2 J;  4ZHR A;  3RB3 A;  4GKK J;  3DDI A;  4M5L A;  3IR7 A;  2CQ2 A;  2HFV A;  3MCM A;  3W66 A;  5HMX A;  1R6V A;  1JQG A;  3G87 A;  2PMZ D;  3TVY A;  4ZN3 A;  4DSK A;  3CD5 A;  5HP1 A;  4XDD A;  3G8T A;  1WJ9 A;  3SCJ E;  4ZMM A;  1EKS A;  1MN9 A;  3OTC A;  3HFZ B;  4LFB J;  2Z4P A;  2EPI A;  1LW2 B;  4DDF A;  4NXN F;  4NCA A;  1NEE A;  4EFA C;  2V4R A;  4LSN B;  5IQQ A;  2J0S D;  3J7A N;  1IBK J;  4JI7 J;  1MYL A;  3QJJ A;  1N48 A;  2K2P A;  2ZBP A;  4CLL A;  3UD3 P;  2DGX A;  3R1H A;  4C4W A;  3Q8S B;  4JV1 A;  5GAG I;  5DG8 A;  2R2U A;  2HRU A;  3CJ4 A;  3H59 A;  2DH8 A;  2UXB F;  2JZ5 A;  3VQT A;  4LFC F;  1JXV A;  3IGV A;  3Q8U A;  4OX9 F;  2RUS A;  5JUM A;  1GAO A;  4ZP6 A;  2W2Q P;  3KUG A;  5H9E K;  3JS9 A;  3MM9 B;  1AB8 A;  3Q2S C;  1X60 A;  1NXI A;  3CDB A;  4PUO A;  1BGX T;  4G1Q A;  3PXG a;  1UKU A;  4E2F B;  1O8B A;  1T9W A;  2L48 A;  3B4D A;  2ZKT A;  1Q16 A;  2BA9 A;  1QVF R;  1UPM B;  2FGO A;  2LMI A;  3KLI B;  5K14 B;  4CTA B;  4W92 B;  4KPY A;  3ADA C;  1AYE A;  2HYI B;  3S7R A;  3R1L A;  5E2Q A;  2MQP A;  2G9O A;  5AE1 A;  4GKK F;  3F41 A;  2KKE A;  2L9W A;  2YNH B;  1SXL A;  3MM5 B;  2O67 A;  1CJK B;  2GO8 A;  3NBP B;  3R5B A;  3KLF B;  3R2D J;  2V2V A;  3HFV A;  3E51 A;  4N41 A;  2A18 A;  5A2Q U;  1RDR A;  5CAB A;  2CVI A;  3RBE A;  1Q4R A;  5CYQ B;  1NDP A;  1AW0 A;  1YBU A;  2V50 A;  2ZEJ A;  3M8Z A;  3Q0A A;  1D9F A;  2HKE A;  1YLX A;  1NKE A;  1Q53 A;  4O4G A;  2CFX A;  1FJG J;  1UZD A;  1TZ0 A;  4RL1 A;  4UW2 A;  3GIJ A;  3LP2 A;  5AE2 A;  1KR4 A;  3G6Y A;  1G6B A;  3JTP A;  3NCP A;  3K89 A;  1VRQ C;  1JLF A;  3D1H A;  3QJL A;  1OIA A;  2FHO B;  2H48 B;  3MAQ A;  2AJ4 A;  4ZA1 A;  1HD1 A;  2MKY A;  2KOE A;  1XMQ J;  3MUR P;  3FRY A;  2BXJ A;  4NXM F;  3ZO7 A;  2Y1J A;  2HHW A;  3GON A;  2Z30 B;  3AA8 A;  3M8R A;  2V4Q A;  3D0H E;  4OJ3 A;  1IBL J;  4KIA A;  2YKM B;  2Z8Q A;  4L3K A;  3V5R A;  4ECS A;  2XYH B;  3D4J A;  4IUF A;  3OL6 A;  4LRB A;  2ZKU A;  5KFE A;  1RT7 A;  1WWH A;  2QG9 B;  3D5M A;  4X66 F;  3N28 A;  2RS2 A;  1RT5 A;  3ETM A;  4I1T A;  4LIR A;  4X4P A;  3OHB A;  1MMD A;  3HJV A;  3AOD A;  4ZP8 A;  2BE2 B;  2CNL B;  5F0W A;  1OYD A;  1E6V A;  5CYQ A;  2HBZ B;  1QD1 A;  2DO4 A;  2VU5 A;  2YWE A;  4I2P A;  2CZ9 A;  5SUH A;  3H5Y A;  5L1L A;  3EE3 A;  2AZ1 A;  1P8G A;  2WB4 A;  4C3M A;  3C6U B;  2DEJ A;  2FHK A;  4ZIW A;  1S9F A;  4DR6 F;  2OPS B;  4CRJ A;  2A2B A;  1HQ2 A;  3M8Q A;  3VWS A;  4KHM A;  2BOA A;  5KFD A;  2CG8 A;  3VAL A;  2EFQ A;  3IXQ A;  4P2X A;  1X0P A;  2EC0 A;  3LWM A;  1BUX A;  1TMJ A;  2AKW B;  1P1L A;  3DXS X;  4ZPB A;  3TX8 A;  3KHR A;  3T1Y F;  2A6O A;  1S9E A;  4FNH A;  5L8R C;  1EQ0 A;  1YHQ S;  1YI2 S;  2B3T B;  1T02 A;  2HS0 A;  4MJK A;  2DK2 A;  5KOW A;  4CI0 B;  1VFJ A;  3VAF A;  4BWJ A;  2CJQ A;  1KC8 T;  4JYA F;  4IR1 A;  4DV1 F;  4DPO A;  3VW4 A;  1RHR B;  3CDE A;  4DU8 A;  2CPI A;  1RWN B;  2FPH X;  3GJR B;  4WFB Q;  3KK2 A;  1Q1K A;  2XY7 A;  2I6W A;  3AAW B;  2MKI A;  4USW A;  3HUL A;  4C0B A;  4DCP B;  4DV4 F;  4AL7 A;  2FDN A;  3GIL A;  5E5N A;  2QSF A;  3FQL A;  4C0O C;  1WC5 A;  1VJQ A;  1NHU A;  4RR5 A;  3IMQ J;  1VJW A;  2HVD A;  3OQ2 A;  2JEF A;  1WOR A;  1L5U A;  2JNJ A;  4ZLJ A;  4X4S A;  3N5F A;  2CAX A;  2DIS A;  4DR3 F;  1Y11 A;  4D3H A;  4F25 A;  4HT5 A;  1RYR A;  4AQY F;  2AWZ A;  1P1T A;  2LDY A;  4U7C A;  1VRT B;  5ETN A;  1RZM A;  4ZHR B;  1BXN A;  1S0N A;  3SCI E;  3NGK A;  4KKO A;  1GX5 A;  1R0A B;  4DSL A;  4MTP A;  1PJ6 A;  3NNA A;  1UJ6 A;  4AL5 A;  3ENQ A;  4ILM A;  3RU0 A;  2EEY A;  4OZ1 A;  3TUZ C;  1S6O A;  4CQ1 A;  3NS7 B;  2BNW A;  2VC1 A;  3AOC A;  2JSX A;  4I64 A;  4ZVH A;  2IVF B;  3D6M B;  4YR3 A;  1DQA A;  1TL1 B;  5GAH I;  2ASL A;  5DLF A;  4NLQ A;  1WEY A;  3QWP A;  5KFI A;  3TA0 A;  3R5C A;  3EXC X;  1FXR A;  4QYR A;  2CNO B;  4CO0 A;  2QMX A;  5E3A A;  5CXT A;  3P49 B;  1PO6 A;  2PO4 A;  1H0H B;  3FSY A;  5F0U A;  2AT1 B;  4RNO A;  3QT6 A;  5HMZ A;  4MYU A;  1ZET A;  1G3O A;  3B6B A;  1RHQ B;  3MM9 A;  4KH1 B;  3M32 B;  1ITP A;  3CCL S;  2AIR B;  2DXE A;  2HHP A;  2RB7 A;  2ZNZ A;  3W61 A;  3KMQ A;  3LPY A;  2IYG A;  1S4F A;  2XSF A;  4JI8 F;  5F8H A;  4NXN J;  1UEK A;  4H54 A;  2R2R A;  4LVO P;  1X7V A;  1KHV A;  2CQH A;  3OSN A;  1NHV A;  4IQX A;  3BBB A;  3K58 A;  2V94 A;  2FZC B;  5D77 A;  2APO A;  5AXL A;  4CO4 A;  2DXD A;  1N5T A;  4QPT A;  3CDW A;  2MPU A;  2YY3 A;  3VR1 A;  1FKO B;  4O3O A;  3DLL Q;  2HQF A;  1JLB A;  2GNK A;  2JJ4 D;  2RF2 A;  5EGY A;  4H4O B;  3DM2 B;  1FFS B;  1H2V Z;  1QJH A;  2QFI A;  2F5G A;  1YIJ S;  4V19 J;  4OL8 A;  5DQH A;  2KFZ A;  3FBB A;  3DHW C;  2IPO B;  3HF5 A;  2QIF A;  4I6W A;  2WW8 A;  1AZS B;  3K5P A;  5K8M A;  3Q8R B;  2AGO A;  2W4C A;  3POT B;  2AYG A;  2AYE A;  3G8S A;  2MLX A;  2K29 A;  4I4B A;  4ZPV R;  4ZPA A;  2HHV A;  4WPA A;  2NXC A;  2HWH A;  1RAC B;  4N8O A;  1Y4Z B;  2JEG A;  2VG7 B;  3U1M A;  3J7Z T;  5KT5 A;  2FTR A;  3FKB A;  4MIB A;  1Z4U A;  4TQS A;  2I5J B;  2ZWP A;  4NLO A;  3LAM A;  2CVE A;  4LRD A;  1OY8 A;  2CJB A;  1BWE A;  2IRY A;  2CQD A;  2KXH A;  3OL9 A;  2ERR A;  3TEH B;  4DV7 J;  1UEU A;  4PYA A;  1U1M A;  2K6L A;  2B43 A;  1S48 A;  1RSC A;  3B54 A;  3GSD A;  2P5V A;  1XMQ F;  1VC0 A;  3LH2 S;  1FE0 A;  4C98 A;  1S97 A;  1B64 A;  3CCE S;  2LQ5 A;  3IA0 A;  4JI3 J;  2B6A B;  3G71 S;  3HVT A;  4OV6 A;  1WTB A;  2H5I B;  2RSQ A;  2I5J A;  1TVR B;  3MHY A;  3P4U B;  2CPF A;  5AT1 B;  3SQO P;  2C3U A;  2BW7 A;  2G2Z A;  4YHH J;  4ECW A;  1S79 A;  1CJV A;  1F3V A;  2HS3 A;  3QO9 B;  4DV3 F;  3T1H F;  3IRX A;  3BF4 A;  3IM8 A;  2XY6 A;  1N88 A;  1NLA A;  3PNI A;  1UW4 A;  2I9S A;  3VF0 B;  4F8R A;  4ZVP B;  2DNR A;  1C1B B;  3POT A;  1IQZ A;  4NEY A;  3ISN D;  3TZW A;  4GO7 X;  4IYQ A;  4YUD A;  4TY8 B;  3NWR A;  4FYD A;  1EP4 B;  2OSR A;  3KYL A;  2RML A;  4YHH F;  1HI8 A;  2B8Q A;  3BBF A;  3GP9 A;  4FKY A;  1CG2 A;  2GZO A;  4DV1 J;  3T1H J;  3KK1 B;  5GAG U;  1XNR F;  2JH3 A;  2F4V F;  1SJQ A;  4LQ9 A;  4QWA A;  4FBT A;  4JI2 J;  5KT6 A;  4K2J A;  1WKJ A;  1WDT A;  4C3K A;  1XMO F;  2KI2 A;  3VGV A;  1KON A;  4F3O A;  4ECV A;  1PJ5 A;  3I32 A;  1X5T A;  2C3M A;  2AJ0 A;  2QC3 A;  4OHZ A;  3TI0 A;  3OL8 A;  4C8O A;  2E9Z A;  5DS7 A;  4KC5 A;  4PQU A;  1OHN A;  2W4D A;  4UOC A;  5CA5 A;  3OXL A;  1GMU A;  4WK1 A;  4IRC A;  2XG8 A;  1VOM A;  3Q23 A;  3KG0 A;  3QQC D;  2WB1 D;  4WKY A;  1U45 A;  3CIM A;  5J2N A;  2VBY A;  4J9N A;  1RWP B;  4O44 A;  4ECU A;  5LL6 d;  1WC4 A;  3PR5 B;  5B0C A;  1WUU A;  2BVZ A;  3CCU S;  4F4Z A;  2Q66 A;  2H51 B;  9RUB A;  3MZI A;  4ED0 A;  3UFC X;  1JXL A;  2MLY A;  3IWL A;  2LFV A;  3OBI A;  3C6T B;  3W64 A;  3ZZP A;  5KFC A;  2R9L A;  7FD1 A;  1HNX F;  4GMK A;  4A8O A;  4ED5 A;  2VFV A;  4HTJ A;  2W9C B;  3HCX A;  5C2C A;  4B02 A;  1GMV A;  1RWU A;  4UQT A;  5LJ5 Y;  4F4Y A;  2PFD A;  4JI4 J;  1TL3 B;  4LF5 J;  1SCJ B;  2IRX A;  2K3K A;  4BDP A;  4EGL A;  4O3Q A;  1ZAW A;  3CJ5 A;  1FD8 A;  1S5Z A;  2XMT A;  3H5X A;  3Q24 A;  2FZK B;  3D7S B;  1MLA A;  3QIP A;  5E41 A;  1LQ9 A;  2HHH F;  1T8E A;  2RQC A;  3QFH A;  2LEB A;  1UVM A;  4KKO B;  2X51 A;  4PWU A;  5T7L B;  2DNQ A;  4QQB A;  3KK3 B;  2RH3 A;  3FZ2 A;  4LSL B;  2DNY A;  4UST A;  1BQN A;  1VQ7 S;  1KN6 A;  3UWT A;  4JI4 F;  5J2N B;  3NCR A;  4RBU A;  4DSJ A;  3FEY B;  3RW6 A;  4K4U A;  1SJR A;  4FF4 A;  2IAJ A;  4J9L A;  1LXJ A;  4DR4 J;  4FXD A;  4B3T J;  1JKH B;  3EGV A;  2QV6 A;  2ROG A;  4DCJ B;  1JIH A;  3GG1 A;  1K73 T;  1NBE B;  2OEM A;  2OLW A;  4RW8 B;  3RB4 A;  2W2N P;  2BBE A;  1LK7 A;  2ZDP A;  4DN0 A;  4DR2 F;  2MB0 B;  2MKC A;  3EPG A;  2LQ8 A;  1RAH B;  2R2T A;  2F1F A;  2DHG A;  1ZM2 A;  3FMW A;  5DDQ C;  2VJV A;  1RT2 A;  1VQP S;  1YKW A;  3QGG A;  4O0I A;  3MPW A;  3FMB A;  1L3K A;  2LLZ A;  1FKP B;  3RB6 A;  2MZJ A;  2WW4 A;  5ETQ A;  1ELO A;  1TUW A;  1S9G A;  3IG1 A;  3CXC R;  1XEZ A;  2MGZ A;  4DFJ A;  3D6H B;  2JDJ A;  2H3E B;  3ILJ A;  5D4O A;  2CNN B;  3DLK A;  1RAJ A;  1C1B A;  5DLG A;  2HFZ A;  3P5B P;  3FSI A;  1R6Y A;  2DNG A;  4WWS A;  3ZFV A;  3EGW B;  3BQ0 A;  3N01 A;  4BLG A;  5EX0 A;  1WC0 A;  1BWV A;  1V3S A;  3G6V A;  1NJX A;  4HEA 9;  3OTB A;  4CM0 A;  4DR3 J;  3SFG A;  1CS4 A;  2OTJ S;  5H9F K;  2XWY A;  2IBO A;  4OHW A;  3M2U A;  4MFB B;  4KGZ B;  2QLX A;  3KKF A;  1H72 C;  4NYP A;  4QWC A;  4HHJ A;  4IRD A;  3DU6 A;  4NE9 C;  5K8P A;  5KFX A;  3CUN A;  1FWL A;  1YK9 A;  3I31 A;  2FC9 A;  3M8P B;  1RU2 A;  2D74 B;  2G0C A;  4G1P A;  4RPF A;  4DR1 J;  1N0V C;  2G1D A;  3GYG A;  1A6L A;  1B3T A;  2IM0 A;  3PG9 A;  2RIL A;  1YZ6 A;  1DAX A;  2BE9 B;  1YVF A;  2DY9 A;  2LA6 A;  2QX0 A;  2VPY B;  3DLB A;  2Y9H A;  1UWA A;  3PYG A;  4H4M A;  4I56 A;  2OIH A;  3KOA A;  1LNQ A;  4DQS A;  2GV1 A;  2ZH1 A;  2BDP A;  1VBZ A;  3G82 A;  4LFA J;  1IR2 A;  2GJ2 A;  3HVW A;  4ZPW R;  2RRA A;  2G2Y A;  3BDP A;  1TK5 A;  4CLF A;  1VIX A;  4RX6 A;  1NK4 A;  2XI3 A;  1FDN A;  1RI7 A;  5C24 B;  1IKV B;  2CQI A;  1KLN A;  3GSI A;  1BQM B;  2OPQ B;  1FE4 A;  3TUP A;  1RTJ B;  4G6V B;  1N6Q B;  4DS4 A;  1SQE A;  1U1K A;  4MK9 A;  3HSZ A;  4AYB D;  2EFG A;  3THP A;  1S0O A;  4KB7 A;  1T05 A;  4DPY A;  5GAH U;  3R7B B;  2UV8 A;  5BJR A;  2RD5 C;  2VFR A;  2JXH A;  4LRF A;  4NI2 B;  4DOZ A;  2V8D A;  1HQE A;  2JFK A;  4KHR A;  4NL5 A;  3K0J A;  4JOU A;  3TUI C;  3E8O A;  3OHA A;  4DF8 A;  2N82 B;  3R5J B;  3T19 A;  3PR4 A;  2I38 A;  1HQU B;  2J7U A;  3MM5 A;  3EGZ A;  3W3S A;  4QU7 A;  1NDC A;  1IKY A;  2ZVS A;  3MR5 A;  2CPY A;  3NP5 A;  4CIO A;  3D2W A;  2KJW A;  1S59 A;  2I0X A;  1GX6 A;  4OYX A;  4FNI A;  4CH1 A;  3CDU A;  3LW5 C;  2RBF A;  3DFE A;  1IBL F;  4DEZ A;  2XQC A;  4HHH A;  2IDE A;  2YX4 A;  5IT9 Y;  4B3R J;  1KQF B;  4ELV A;  3KHH A;  2LQ9 A;  2G0J A;  2GAG C;  1R43 A;  1JJC B;  1WC3 A;  5JXS A;  2XHC A;  1B99 A;  1HBM A;  2XZW A;  3HLU A;  1LWF B;  2H65 B;  2J6T A;  2C2Z B;  4USV A;  5LSO A;  3DYA A;  1NAQ A;  4U8Y A;  1HBU A;  2ASY A;  2I8E A;  3HSG A;  1U2C A;  3DC2 A;  2BJ9 A;  5KOX A;  1IBM F;  1RHM B;  2IJR A;  2NXU A;  1SBR A;  1W2I A;  2QFJ A;  3HK2 A;  1F5C A;  2QL5 B;  4Y34 A;  2HQ3 A;  1FTR A;  3VGS A;  4DV2 F;  4UUX A;  1YJT A;  2DRB A;  4LSN A;  3VAM A;  5B0B A;  3FFI B;  2E5J A;  3BPS P;  1R0A A;  1IR0 A;  5GMK a;  3JAM U;  4KQZ A;  1EIY B;  3QWU A;  4DUY F;  2HAI A;  3QZ8 A;  1R8C A;  1JB0 C;  1T05 B;  1FNM A;  1VRT A;  2MDA A;  3EWG A;  3NRB A;  2Y8Y A;  2ZC3 A;  3GMG A;  1VBX A;  3GTY X;  4F4K A;  4W4M A;  4F4W A;  1FK9 A;  1TL7 A;  4RW9 B;  1TKZ B;  2MYF A;  3KWM A;  5IT4 A;  1L3V A;  5ETL A;  2RDJ A;  2DR6 A;  3FCW A;  1RAI B;  3MED B;  1P9Q C;  1HHQ A;  3I0R B;  4F2R A;  4NRT A;  3DDK A;  1SIW A;  2XCA A;  1BMQ B;  3I96 A;  1RTI B;  2ZE2 A;  4NCB A;  2DRD A;  2KT5 A;  3PZP A;  1D1U A;  3H5U A;  2OI2 A;  3CO0 P;  3UD5 A;  4FBU A;  3G86 A;  2L41 A;  3CME S;  1FFW B;  2YQ0 A;  3BGR B;  5GVQ A;  4LF7 J;  2AX1 A;  2M0G B;  3AH6 A;  3DYA B;  3QFW A;  4OX9 J;  5BR8 F;  2GW8 A;  5KFK A;  3NKY A;  5GAD I;  1IKW A;  2DJW A;  2XMJ A;  3W1Y C;  4RO0 A;  3ZTR A;  3VHQ A;  2LCW A;  2NS1 B;  2QMW A;  4M5G A;  4C8N A;  2XTJ P;  4FVM A;  4CZC A;  2XY5 A;  4NLY A;  1ZYQ A;  1BDT A;  4QOT A;  5KFA A;  2XLK A;  2YPZ A;  4NLR A;  2MHE A;  4MMO A;  1Y00 A;  2P6T A;  3KJV A;  2OAU A;  5E0O A;  1SH2 A;  3GII A;  3LGM A;  2ZZT A;  4MKV A;  2JLG A;  1Q0N A;  2VIC A;  4IOC Q;  1HAR A;  1HQU A;  5H1S V;  3MUV P;  2RQ4 A;  4N76 A;  1RT4 B;  1DHM A;  4QIW D;  1N34 J;  1UP1 A;  4I69 A;  3DRR B;  4DX8 H;  2E7V A;  2VQE J;  5HQM A;  4HV0 A;  3G6E S;  1RHJ B;  4CNZ A;  2PA3 A;  4NA2 A;  2FVS A;  3OJU A;  4F0H A;  2ZH8 A;  2WCX A;  3ENV A;  1KP6 A;  2KN4 A;  4ITS A;  4CO3 A;  2HVH A;  4JI0 J;  4JI6 J;  2ZBQ A;  3JAM Y;  1PAR A;  4P2F A;  2J9D A;  1RKJ A;  1S1X A;  1HNI B;  3IWN C;  4X64 J;  3Q22 A;  2CPJ A;  2H1Y A;  4XPC A;  2DHX A;  3LOU A;  4DSI A;  4KAI A;  1M5H A;  3IS9 A;  3MM8 A;  1PYS B;  4LT6 A;  3QT8 A;  1ZS6 A;  3FQK A;  1RJJ A;  4P72 A;  4WU2 A;  2HFS A;  4ZPT R;  3LAL A;  4ENO A;  3KHG A;  1SUQ A;  1RYS A;  2B7C B;  2AP6 A;  4UOH A;  2ALZ A;  5KG1 A;  5JVG Q;  2DKO B;  3NGT A;  1F3F A;  3NS5 A;  2WVF A;  3QGI A;  4ID8 A;  4TLQ A;  2ZBI A;  4P9S A;  3JYT B;  1S1U B;  4LF7 F;  1IJF B;  1HR0 J;  2KFN A;  2ZHB A;  3OLB A;  1ZTT A;  5HAO A;  4BC9 A;  5A8W A;  1BDV A;  4M5D B;  3RJM B;  1DTQ B;  2OPR B;  4EZ6 A;  4P7V A;  1GQE A;  2NXN A;  4RUA A;  2HND B;  2BNZ A;  2F8H A;  3PJX A;  4NX9 A;  5IXU A;  2RE1 A;  5A8R A;  1HWL A;  2IRU A;  3SQG B;  1JJ2 R;  2IA6 A;  3IR5 B;  1NME B;  3VVT A;  4AL6 A;  4N8N A;  3V2U C;  1TL3 A;  3SYZ A;  4B3S J;  2YNH A;  2E7X A;  3NBP A;  3TZY A;  1G2E A;  1GXT A;  2JVR A;  3HJF A;  1JK9 B;  4USJ C;  5E3Q A;  3CNQ P;  4JI0 F;  2RRN A;  1HWJ A;  4JI6 F;  4DMZ A;  2F8E X;  4U95 A;  5EWE A;  1SL0 A;  1Y3K A;  4F0M A;  1T7P A;  1KTV A;  2HGL A;  5K9F A;  3RAX A;  3ZZU A;  5DZ6 A;  3W9I A;  3CSK A;  2PEB A;  3D3C J;  3PIP Q;  3OUY B;  4YB6 A;  4PWD B;  1JJ4 A;  2ABY A;  2ZZM A;  4EYI B;  4YB7 A;  2ZM6 F;  1WSV A;  4ICL A;  3KLG A;  2IVY A;  2DR8 A;  1P94 A;  2MKH A;  3M4X A;  1X4D A;  2VZ9 A;  2JC1 A;  3FSX A;  4WFY A;  3SFU A;  3P96 A;  1U8S A;  2ATL A;  2KXF A;  2NSC A;  4ME7 E;  1N36 F;  1QM9 A;  1S6Q A;  1VRU A;  3O8W A;  1ZM3 A;  4ILR A;  2KHD A;  4UZC A;  3UDL A;  1U1O A;  2UUB J;  3BB5 A;  4DR5 J;  3IWX A;  5G0R B;  1K44 A;  3QT7 A;  2R7T A;  1QTG A;  4KO0 B;  3OTD A;  2KH9 A;  3FCH A;  1QSY A;  4ZDN A;  1AA1 B;  2ZD1 A;  2VFU A;  2YWK A;  3VAI A;  1KBR A;  1CJU A;  2CPD A;  3K7R A;  1C0T A;  5KFH A;  5BR8 J;  3KNG A;  2X3D A;  4AT1 B;  1U25 A;  2BM0 A;  2EK1 A;  2MLZ A;  3SCL E;  2RKI A;  3IBF B;  5KFQ A;  3FJ2 A;  2JLF A;  4G65 A;  2R7R A;  3TQ1 A;  4CO2 A;  3J81 j;  4TY8 A;  2Y8W A;  4DUZ J;  1H74 A;  3R8Y A;  3HHL B;  3N79 A;  4MT1 A;  4A8X A;  5HRO A;  5C7P A;  1OY6 A;  2EFP A;  4OZL A;  3ENA A;  3KLV A;  4ZVO B;  2ZH3 A;  1DFD A;  1PYT A;  2LYV A;  5KTQ A;  4K7Q A;  3PTW A;  4ED3 A;  1UA1 A;  1OY9 A;  3MMC A;  1DBD A;  1CJV B;  3HVA A;  1ZBT A;  2BM1 A;  3NLC A;  4IH5 A;  2EFN A;  4HKQ A;  4JV5 F;  4F3M A;  2BJE A;  5ADZ A;  5HVH A;  3ENW A;  5M2P A;  4DQI A;  3UDV A;  3G4S S;  5D3G A;  2BZ2 A;  4KGX B;  4FS1 A;  2HQI A;  4USM A;  3BRE A;  5KG3 A;  1T03 B;  2M4M A;  3M2V A;  4PXC A;  4ZP7 A;  4Q5V A;  5D78 A;  1HNZ J;  2IJF A;  2MEW A;  2C2M B;  2WON A;  2MXY A;  2KM8 C;  2E5G A;  5A8W B;  2LDI A;  3HD2 A;  4YB1 P;  1HYS A;  2LXF A;  2XLI A;  3W62 A;  5CYM A;  5LMU J;  4WZM A;  4HH0 A;  1HHT P;  1Y10 A;  3DXB A;  1Q81 T;  1C0T B;  4JI8 J;  1W25 A;  2MZT A;  2O66 A;  3H5S A;  4TYA A;  4F4X A;  2ADC A;  2J0Q D;  3TZX A;  4DV0 F;  4MH8 A;  3OW2 R;  4Q8F A;  2VG6 A;  4RW6 B;  3LAK A;  2C2R A;  4B9L A;  3R6G B;  2VF3 A;  1N32 F;  2VG7 A;  2ZHO A;  3I9V 9;  4Q8E A;  4OYW A;  4PQU B;  3PKY A;  1AFI A;  5GMD A;  1HNZ F;  1HL6 A;  2Y1R I;  3CJK B;  5LMU F;  2AJF E;  3DU5 A;  4TU7 A;  3DI6 B;  1VBY A;  5DQI A;  1K8A T;  4O3P A;  1RLC L;  2Y0B B;  3MM6 B;  1NND A;  2X3G A;  3M6U A;  4FXW A;  3WIU A;  2CQP A;  2AN7 A;  2EC2 A;  3DGP A;  1EZZ B;  2LQJ A;  2QE5 A;  3GWC A;  3WZ0 A;  1J5E F;  2R8J A;  1QLN A;  4CLU A;  4CH0 S;  3CW2 C;  3DRS A;  3RG6 A;  1VK8 A;  4UY8 T;  5DM6 Q;  3RAQ A;  1RAB B;  3W2V B;  4HI2 A;  1JLA A;  1HPZ B;  2QLJ B;  1BE4 A;  1HNW F;  2HFN A;  2V0N A;  3DI6 A;  3W5X A;  2CQB A;  3DRR A;  3THV A;  3MFH A;  4YDD B;  2ZJQ Q;  4TYB A;  3N4W A;  3F73 A;  1Q8K A;  4Q2M A;  2GHV C;  4DL7 A;  1O0P A;  2YKQ A;  4RW6 A;  3KJV B;  4NZ7 A;  1FRI A;  1MWQ A;  1U8W A;  4NRU A;  5EUH A;  4ECZ A;  3OFG A;  4QU6 A;  2AW0 A;  3ZXW A;  3QAU A;  3OLA A;  3M9N B;  1X31 C;  4DR2 J;  2B4V A;  2FIU A;  3R5G A;  5D0H A;  4A4J A;  5EWF A;  1TKX B;  4PR6 A;  3T5J A;  2MQM A;  2J9D E;  3ETO A;  2W2M P;  2JXI A;  2ZHA A;  2HZC A;  2GIF A;  2YVS A;  2MY7 A;  3T6B A;  2WSF C;  4OX6 A;  4L6V 3;  1S6P B;  3MMA B;  4OJH A;  1UJ5 A;  2XZT B;  3OTE A;  1NLK L;  4DL5 A;  2KO1 A;  1B28 A;  1RBO B;  2J76 E;  3JXO A;  4OV1 A;  3UCG A;  7AT1 B;  1T9Y A;  4Q43 A;  2FLL A;  2Y3Y A;  2YNG B;  1RTH B;  3E01 A;  2ZBC A;  2DHS A;  4ZJL A;  1HWK A;  4DUY J;  3I4H X;  3H8Y A;  3RGI A;  1GNK A;  2J0X A;  3CCZ A;  5GAD U;  3GFZ A;  1I6J A;  5HJX A;  2C22 A;  2FJV A;  2HVZ A;  4KY3 A;  4C97 A;  2VOP A;  4HHU A;  1CQN A;  3WHI A;  4Y2A A;  2HLT A;  2VON A;  2YWF A;  5C42 B;  3V6K A;  3TAR A;  2ZH4 A;  3RUB L;  4ZCM A;  2PC6 A;  4NA3 A;  2CXE A;  2FVC A;  4H4K A;  4TNO A;  2V9W A;  4A48 A;  4TU9 A;  1YG0 A;  3DOK A;  1KHW A;  3SCK E;  1S0M A;  1SL1 A;  1MMN A;  2UVV A;  2P6S A;  1N4L A;  2HNY B;  1WF1 A;  1T9T A;  3BJY A;  1TKD A;  3MEG A;  4F67 A;  1CBK A;  3P8B B;  2BEF A;  5GME A;  5LSR A;  2PFF B;  4Z7C A;  3OD2 A;  2CG4 A;  4RW7 B;  2V6A A;  1RT4 A;  1WOS A;  4FVC A;  4RUH A;  3P6Y C;  4X4V A;  1NSP A;  3D6F B;  2VUG A;  4PPZ A;  2CNK B;  1HBU B;  5IT0 A;  2DR7 A;  1T9U A;  5SZT A;  4BWM A;  4QWD A;  4K50 A;  2YKO A;  1AUS L;  4RBT A;  3JTO A;  2V9K A;  3N0V A;  4X66 J;  1C4A A;  4LF9 J;  2HWT A;  1FRK A;  1NO8 A;  1RT3 A;  4QW8 A;  4C8K A;  3BSO A;  5F3T A;  2E5L J;  1AFJ A;  2NUU G;  4PWD A;  1S9E B;  4WBF A;  2ILY A;  2L9N A;  2V8G A;  5MLC V;  4QIG A;  4DZD A;  4K2X A;  1N56 A;  4DQQ A;  2DRA A;  1IJE B;  1Y5N B;  1HKA A;  3AFG A;  1WF0 A;  3M30 B;  3JB9 k;  3HZG A;  4F7V A;  1RWX B;  3DMJ B;  4FZV A;  2A6M A;  4WP3 A;  5D4N A;  1L3U A;  4M5K A;  2AMC B;  1G4C A;  2LP4 A;  2JVO A;  1BD6 A;  5K8N A;  1SJ4 P;  3Q2T C;  1U09 A;  3EVM A;  3R3T A;  2A0F B;  1FWK A;  4W90 B;  3N6M A;  3MED A;  3U1N A;  2NSB A;  1S49 A;  2OH2 A;  2CJY B;  2KYZ A;  1DTQ A;  2OPR A;  4OFZ A;  2VQF F;  1JLG A;  3MDF A;  1Q79 A;  2UXD J;  1I51 B;  1YQH A;  2MJU A;  4RW9 A;  2VKZ G;  1SKU B;  2AY0 A;  1UPP A;  5DRK A;  4B3S F;  3TRG A;  5IM0 A;  4QYZ K;  4WKR A;  4RNM A;  1IVZ A;  1RT7 B;  3CGI A;  2CDQ A;  2XZD B;  4E98 A;  3W9J A;  4IKA A;  5D4P A;  2F40 A;  4ZVQ B;  3RZA A;  1GXU A;  2KEL A;  1IBC B;  4NAS A;  4TXS A;  2CQG A;  3RTV A;  3PW2 A;  2BJ8 A;  3AB4 B;  3MR3 A;  4PG6 A;  2R7U A;  4URQ U;  4RJV A;  4EBC A;  2ZUA A;  2EK6 A;  2DVI A; 
#chains in the Genus database with same CATH homology
 1U9P A;  3GXQ A;  2K5J A;  4D8J A;  2K29 A;  1B28 A;  2BJ3 A;  2JXG A;  3VEA A;  2WVD A;  3OD2 A;  2K9I A;  2Y3Y A;  1NLA A;  2JXH A;  1EA4 A;  1B01 A;  2WVF A;  2H1O E;  3BKT A;  2BJ1 A;  4HV0 A;  1X93 A;  2BJ9 A;  2WVE A;  2BJ7 A;  2WVC A;  3BKF A;  2CA9 A;  2CPG A;  2HZA A;  3VW4 A;  2BNW A;  1ARQ A;  1P94 A;  3FT7 A;  2BA3 A;  3H87 C;  2K1O A;  3QOQ A;  1BDV A;  2AY0 A;  3LGH A;  4ME7 E;  1Q5Y A;  2BNZ A;  2HZV A;  1MNT A;  2GPE A;  2NZC A;  2CAD A;  1IRQ A;  1BAZ A;  2PC6 A;  2K6L A;  2BSQ E;  2WVB A;  3PHT A;  1ARR A;  3FMT A;  1MYK A;  1PAR A;  2RBF A;  1QTG A;  3QSI A;  2CAJ A;  2KEL A;  1BDT A;  1Q5V A;  3VEB A;  2BJ8 A;  2CAX A;  4FXE A;  2JXI A;  1MYL A;  2F1F A;  2FGC A;  3BKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...