2WVBA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
130
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTAIAMDEHNSLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 36
structure length 130
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvbA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvbA02
4D8JA 2CAXA 2K6LA 2WVFA 1MNTA 2FGCA 1ARRA 2HZVA 2K9IA 1Q5VA 2K1OA 4FXEA 2BA3A 2BJ8A 1IRQA 1PARA 2AY0A 1X93A 1B01A 3QSIA 2BNWA 4HV0A 2BJ3A 2JXIA 3VEAA 2WVDA 2BJ1A 2JXGA 1QTGA 3LGHA 1ARQA 3VEBA 3H87C 2WVCA 4ME7E 1BDVA 3BKTA 2BJ9A 3FT7A 3BKUA 1NLAA 2WVEA 2BSQE 2GPEA 1Q5YA 2HZAA 3PHTA 2BJ7A 3GXQA 2BNZA 1MYLA 2RBFA 1MYKA 3QOQA 3FMTA 2Y3YA 2H1OE 2WVBA 2PC6A 3BKFA 2CAJA 2KELA 1U9PA 1P94A 1B28A 1BDTA 1EA4A 2K29A 1BAZA 2K5JA 2CADA 2NZCA 2CA9A 2CPGA 3VW4A 2JXHA 3OD2A 2F1FA
chains in the Genus database with same CATH superfamily
2XMMA 1MWZA 9RUBA 1UKUA 4K2XA 5JXSA 1NK4A 4IRKA 2AGOA 2NCKL 4FVCA 1K1QA 2F4VF 4ZCIA 3M8QA 4URSA 3UR0A 2BKNA 3QZ8A 2AY0A 1WWHA 2HVIA 1UJ6A 4KBIA 2V5HG 2ILZA 3I56S 4BS2A 2RIJA 5DDRC 1YRTA 2FZKB 3BDPA 1RAAB 1EJ7L 3R8YA 2BANB 2WVCA 1JKHB 1ZAXA 3PEJA 2IVYA 4LSLB 1Y5NB 4H4KA 2BACA 2EG1A 5FIIA 1S6QA 5KOWA 3OR2A 2HK2A 3C46A 1RQ0A 2QC3A 4GC7A 1HHTP 2EXUA 3ZFVA 4BC9A 5K14A 1NPRA 2B8QA 3LOUA 3NAIA 1HR0J 2ZM6F 4EBCA 3CJ0A 1GH8A 3Q22A 1VYAA 4LF9J 1JQGA 1T0TV 4JOUA 4NCBA 4DPWA 2JEGA 3AA9A 3EUNA 4OYZA 3HKWA 1K47A 3TX0A 1JJ2R 1ACMB 2YTCA 3AOCA 1P8GA 3R9LA 5A76A 3H4BA 1WF1A 5J2MA 4RNNA 1VLYA 3RR8A 1GX5A 1DZ5A 4J37A 1EP4A 1L5UA 2VBWA 1NKCA 5DRKA 4CLYA 4CM2A 3CTRA 3SIPB 5JMNA 1AB8A 4B9SA 2GQCA 3J7A1 2R8GA 2JXGA 2NQPA 3UVJA 4B3SF 2Y9HA 5CYQB 4LFCJ 5DDPC 2X1AA 4ZIWA 3PZPA 1WOOA 2COLA 3SDEB 1J5OA 2HLUA 4DQSA 3G6XA 1RT7A 1JXLA 4HHHA 2G2OA 4NI2B 1UFKA 4KAIA 1FESA 3MM5B 1HPZA 3V6KA 4R8UA 2FYXA 1FF2A 2YY3A 2WSFC 1NAQA 3MFHA 2H51B 3NLCA 4IOAQ 1FO1A 4Z7YA 3QO9A 4ZVSB 4USJC 4ECVA 4JV5F 4I2QB 4CLSA 4LF5J 3UO0A 5C2CA 4Y34A 5A6PA 4NYPA 4RUAA 2KJWA 1QDUB 3HO1A 2N82B 5A8RB 1X5TA 2XWYA 1C0TA 3FJ2A 4DV2J 2FJWA 1HBMB 2EVZA 3CCRS 3I87A 2GQ2A 2H3AA 2CNKB 2ZDPA 4IOBA 2B5JB 4CDIA 2FGOA 3MMCB 2K1RA 5A0YB 2UVUA 1C2PA 1F9EB 2IBKA 5CZVA 1N48A 5HP1B 3W5ZA 4TLRA 1YJVA 2KTQA 3SFUA 1SBRA 2V68A 1VQYA 2M4MA 1X4GA 4USWA 3EXCX 2C2MB 4AE5A 4LQ3A 1X0FA 1Q8IA 3EICA 3SMZA 3KLGB 4DSKA 1T05A 4DHVA 5CQGA 5RUBA 2HMIA 5KFGA 5B7WA 1NZAA 4B9NA 2NZCA 2C2NA 4PXEA 2FPHX 2HNYA 1QSLA 2E7VA 2DHGA 3KFWX 5AXLA 2ZBPA 4L3NA 1Q79A 2QFIA 3O44A 1VIOA 2KO1A 4J9LA 4K4TA 2I0XA 2I5JA 1JLCB 4YS2A 1ZA2B 3GJTB 3H42A 2WSEC 3W2WA 3QRQA 2Z2LA 3SI8A 2FY1A 2HAFA 1QTGA 4I6YA 4TXSA 2L9NA 2W7PA 1FDAA 4S0MA 4ZP7A 1BWEA 1BWVA 3DLKA 4Y2KA 4CRJA 2DHHA 5IOLA 3VAMA 2O01C 3BGOP 3C66A 2AD9A 4EFAC 4B3MJ 2GC8A 1S6QB 3OR2B 4A48A 3NNHA 1FHTA 2AJ1A 2W01A 4NXMF 5K14B 2DPJA 3SBMA 2EFQA 2ROGA 3KK1A 2V0NA 1V3ZA 2CRLA 4NMXA 3PM9A 3Q8YA 1OHNA 3BSOA 1QVFR 1EHWA 3PR5B 2V8DA 3GLJA 3DYAA 2E7WA 1N32F 1SJQA 4E98A 3VQTA 5J2MB 4PQUA 1JK9B 3P8BB 1PGZA 1IKXB 3D2WA 5LMUJ 2YH0A 1SC4B 3BQ1A 2CJYB 2Q79A 4KRWA 2HWHA 2XZWA 4L72B 4DUZF 1EP4B 4HR2A 3UE2A 2AEFA 2YX4A 2OP5A 3J7YI 2E5JA 2V63A 1RTDA 1CQMA 4U8VA 2AEMA 3UVJB 3VV2B 2XCPA 1TL1A 3M8RA 3BQ2A 1J5OB 2DNPA 3CE8A 1RT7B 4L3KA 1TL7A 4WFXA 3M1VA 3MHYA 3UI3A 2VG5A 2HEKA 4O3RA 1NHVA 1AROP 3FCWA 2D9OA 3M9OB 2CQIA 5IFMA 4XDCA 2B4VA 2E9TA 3PYFA 1YJTA 4WKYA 2YWFA 4ETXA 3BV8A 1SIZA 1N0VC 3QO9B 4ERDA 4F02A 4O3NA 3MPWA 4J9VA 4OYPA 3W66A 4B3OB 1XTZA 1X4FA 4NLGA 1HNIA 1FT8A 4YB6A 1RT2A 4C8NA 4NLPA 2ERRA 1VJQA 1TVRB 4M5KA 3AJDA 5LL6d 3D6MB 2G0CA 3L7OA 4HLBA 3F0NA 2F3JA 1C0TB 5HVHA 1Q8LA 1O0PA 4ZP8A 2CUYA 3HDSA 2MJUA 3GJQB 2Y1JA 4A8SA 5LXRA 3F73A 2FTRA 3C3LA 1DRZA 4F0KA 1QSYA 3HFZB 3EZOA 4NYZA 3HK2A 4A8MP 4AXJA 2K1RB 1TKTA 4DSLA 2BOAA 4GKJF 3BR8A 1WI8A 3LAMA 1U09A 2RF2B 1MN9A 2ALYB 3M8WA 3SCLE 5EX3A 2BR0A 1N8RT 1X5PA 2BE9B 3ETMA 4NLVA 1OWXA 2IC3A 1VC0A 1H2TZ 4EI2A 3EVOA 3H98A 1SUQA 1T05B 1SKWA 3ULHA 1VQLS 2CA9A 2HMIB 2VV5A 3OD2A 2CJAA 3HHLD 3PDNA 5HAOA 2B3TB 3JAMY 1M5PC 2FHKA 2A0FB 4WP3A 3MMAA 2RDDA 3CCQS 1S1WA 3AB4B 3UQSA 5IT9Y 4IUFA 4RW6A 3H8YA 2ZH1A 4DPYA 4ENOA 1EZZB 1JB0C 3MEEA 4IRDA 4X2BA 4C0HA 2I5JB 3CDUA 4LSNB 1FKAF 4JYAJ 4U7UK 3W2WB 3D68A 2DH7A 2RQCA 4QW8A 4PABA 4X4PA 1WJ9A 4MKYA 4PG8A 1SJ3P 1NB2A 4HACB 3BSAA 2VU5A 1RKIA 3DLKB 1GXTA 4B17A 3CDAA 4NLQA 3LPYA 3G8SA 3SYZA 2WONA 4OHWA 3QWUA 3KHGA 3C19A 3KNAA 1RHKB 1N34J 1TKXA 3LANA 4DU8A 1Q16B 2K5JA 2IFXA 4QQBA 3UCUP 3IR5B 1ZM3A 3VQSA 5LMNJ 3D6HB 5AE2A 1RT3B 1LWFB 3KK1B 2DH8A 3E01B 4USIA 3DRSA 4DLGA 2KB2A 3GPAA 1FWLA 1ARRA 1X60A 1BGXT 4C3KA 2EFPA 4ZLPA 2VH7A 4OX6A 1VQ7S 3QIPA 1N5QA 1HWJA 4CIOA 1Y4ZB 1NK5A 1YVFA 2DNHA 3R6GB 4QJVA 5E33A 2ZZTA 3IWLA 4YN3B 1J2VA 4PYAA 3D7SB 1ZAVA 2ATLA 1RHMB 2AU0A 5K8NA 3G87A 4DUTA 5CAAA 4DG1A 3QAEA 2FJAB 3MPYA 3GMGA 4H4KC 1N56A 4ZVTB 2QEXS 1RTDB 5KG1A 3KYLA 3SSRA 2Q43A 3TA2A 1FA0A 1TL1B 2B4PA 4RL1A 2JVOA 3I5CA 3O1LA 4KKOA 5HROA 4X65J 2KG1A 1S4EA 2BX6A 1TL7B 1YBUA 4IYQA 4ZIVA 1BDTA 2B43A 2GAHC 4WFYA 2VG5B 4PR6A 2XYGB 1W2IA 2OEJA 1RWKB 3HX9A 4X4VA 3K89A 4O4GA 1SJFA 4P7TA 4ZS6A 5F8HA 2DXEA 2HRTA 3D3CJ 4WFAQ 2CPXA 4RNMA 1WSVA 1JXEA 3PVXA 1MROB 1AZSB 2VFVA 2A1BA 2JFKA 1FDBA 1YKWA 3HZGA 3A8EA 2QLXA 2OTLS 1KS2A 2ZBCA 1D9DA 3ZZ0A 4KY3A 4IG0A 4U95A 2KJVA 1OO0B 2QL5B 3I5AA 4OI4A 3O2IA 1VQMS 3FRYA 3GZ7A 3BB5A 1NSAA 2AWZA 2HIYA 1OS5A 4GKKJ 3VHQA 4DQQA 1VQPS 2OSQA 3HI9A 3RBEA 1PBAA 4AUKA 1FX2A 3P5BP 4ZCKA 3HSZA 3KLFB 1VR6A 2VPYB 3BGRA 4MKBA 2AT1B 3CCVS 1NJYA 1FRLA 3DDNA 2ZH8A 4HEA9 2MPUA 3W9HA 3J7Z5 1NB7A 1U45A 1FWKA 2VC1A 3R5BA 3W1YC 1S1TA 2W2QP 3M8YA 4A8KA 1WKLA 1M5OC 5LSLA 2IC3B 3LP0B 4JI5J 3T1HJ 3NNCA 3M05A 3QRPA 1S0NA 4PWDA 2F8HA 3BSCA 3DC2A 3D54A 2WBMA 1U2CA 1TELA 3MMAB 5DM7Q 1Q5VA 3QBCA 2ZH9A 3D66A 2DRDA 2YNIA 3PEHA 4CLKA 2V9WA 4RW6B 1UEVA 2MZJA 3MEEB 5D3GA 3QGHA 4P2MA 2Y1LB 4X64J 2E1AA 4HI2A 1H72C 1GFWB 1N33J 3BKTA 3BPSP 4ZN1A 2Z58B 2KM8C 3FT7A 1SQFA 2AX1A 3ZTQA 3WQPA 5ETVA 1HBOA 3Q83A 1R8AA 5J2PA 1M1GA 1VBXA 2Z0GA 1Z2ZA 3R3TA 1VHFA 2CQ0A 2QIFA 1DQ8A 1NHUA 4WBFA 2QTWA 4LFCF 3M2RA 3TVZA 3OL6A 4QCLA 2XYHB 1O51A 2KELA 2UXBJ 5ETTA 1HYSB 3M2UA 1XNRJ 1KONA 1XNQJ 4O0NA 2GX8A 1V5IB 1FNXH 1PIEA 2E5IA 2GIFA 4ELVA 1HIYA 4URGA 1UL3A 1FFWB 3OTBA 4J9OA 3OTOJ 4BC7A 1KP6A 4OJ1A 4LF5F 3TW0A 2QMXA 3PFEA 3MPUB 3ONQA 4AXIA 3IXQA 3Q8RB 1IM4A 2ASYA 4P52A 2XLJA 2DY9A 4Q45A 3QT5A 1VRTA 4DV2F 1OQ3A 1RZMA 2QE5A 1ZTTA 2OGUA 3POTA 3OHAA 4JV1A 4MIAA 1UFWA 5KFEA 3GONA 2DHAA 2D41A 2YWWA 4B9MA 1C4AA 1H7XA 4FYWB 1Q78A 4NA2A 3NOGA 1U8SA 1PKUA 4C4WA 3ENQA 2RDIA 2IM0A 4JBCA 3BS9A 4F3MA 4AYBD 3KLVA 6AT1B 3ICLA 3D67A 2NYHA 1ELOA 3VAJA 2IIHA 2ZOMA 2J0QD 3BR9A 3RBDA 1APSA 4EYIB 2J0XA 3WBZA 2V4RA 2UUTA 2ZH5A 1S77D 2XO6A 5I4MA 3ZNUA 3HHEA 3PG9A 2JX2A 1EQMA 3SFGA 1PARA 2HS0A 5CH7B 4U6PA 2CQBA 4FXVA 3MAQA 1YG0A 1KTQA 4DV5J 3IG1A 3AD9C 4K5RA 1J5EJ 4HVZA 2W9BB 4X66F 1OPZA 2KOEA 2XYPB 4I1TA 4ZLJA 2DTJA 3BN7A 4OZJA 2CQCA 1U48A 1WHYA 1E6YB 3CT9A 3KLEA 1R6YA 2MXYA 4YB1P 3ET6B 2DR6A 2IVFB 1WC1A 3BGUA 5KFZA 2B7CB 2DEIA 2VG7A 1PJ6A 2PO4A 1G7CB 4C8ZA 4I7FA 3BGRB 2IVMA 4DR4J 4CLWA 5KG2A 4FXDA 4QWCA 2RQKA 3B4DA 2FB0A 3HHNB 4B3MF 2FVQA 5GAEU 4OL8A 1NMEB 3TJ9A 1U6ZA 1S1TB 2PFFB 1LXNA 5ADZA 4CTAA 1RUSA 4LF7J 4WU3A 1V9OA 1IXKA 2BW7A 5L1LA 2ZITA 5K9FA 4N56A 2IAJA 3G8TA 2FIUA 2ZE2A 1RT1B 2Y1IA 5IC6B 2BJ3A 2R7WA 2XTJP 2R7UA 6FDRA 1IKVA 1KR4A 1P1TA 4KGMA 4OJHA 2YNIB 3PHEA 2AGQA 3GP9A 1PBUA 2ZD1A 4ZJLA 4IR9A 2R7RA 3MI7X 5D3GB 1RSCA 2PEBA 4C3LA 3G6ES 1NK0A 4ETZA 2GHWA 4IQMA 1NCLA 3N01A 2RRAA 1T8EA 2NUUG 3CCLS 1IKYB 2L48A 2E7XA 1LWCA 1YITS 1HBOB 5J2PB 5IT4A 2RHQB 4PCQA 3PO4A 4RW8B 1S97A 3PJ9A 1JNZB 3R6LB 3FEXB 1YJRA 1HNVB 4HL9A 2LDIA 2D7SA 3DHXA 4FKYA 1BXNA 1TL5A 3RAXA 3G71S 4USUA 1CJTA 4CO5A 1S1UA 1NHKL 5CYMA 2EFOA 1WDTA 2QA4S 1MMNA 4RW9B 4NA1A 3MMJA 1XMBA 2HFOA 1XIQA 1ZYQA 4ZITA 5HVFA 3IM9A 1FE0A 2C3OA 3RZAA 4C8MA 5DQIA 2HW3A 1F3FA 1WC3A 1UP1A 4DX5A 1S76D 3KJFB 2OIHA 3AOBA 1UVJA 2VBXA 4FYXB 4TN2A 1OSDA 4AL5A 5D77A 3VZHA 4C0OC 1K1SA 2EFNA 5L1JA 2M0GB 5FD1A 2HVHA 2WAQD 4RNOA 4QWAA 2V69A 1VRTB 2WVEA 5HJYA 2E9ZA 3U7JA 2YKOA 4OLPA 2F5GA 5HLFA 4QYZK 1FDNA 4QWDA 1G4CA 3HPOA 2Y0BB 1AXQA 2YKMA 4NA3A 2XSFA 1JLBB 4WKRA 4F36A 1NEEA 2FDNA 3C15A 4N8OA 3OBIA 3J81U 4E0DA 2HK3A 2BJEA 2F1FA 3MOZA 4M5IA 3NOCA 1W2BR 2R7SA 3DXSX 2HGLA 2NYIA 3OR1B 2DB1A 1SC6A 5IWAJ 1KTVA 2LXFA 4FXEA 5KFMA 3M4XA 3L4BC 3K5MA 3QMQA 2R8HA 1PAUB 3UD4P 2HG4A 5D0RA 4WTYA 3IG1B 3J81j 3Q24A 2XB2D 5KFIA 3MWBA 1U25A 1N54B 2ILYA 1DY3A 4EZ6A 2BQRA 2X3DA 4UZBA 3KLEB 4DX6A 3TZYA 2Q1LA 2CJBA 3KK3A 3K59A 3S01A 2E1MC 4I68A 4EO6A 1S4FA 2DO4A 1F3VA 2EK6A 1QE1A 2A2BA 3AXMA 3VF0B 2HBYB 2M5YA 1GMWA 4CWBA 3P4UB 1RAOA 2ZUAA 3VGSA 4RBTA 1GT8A 1WC4A 3W2VA 2YXLA 4QOTA 3OT9A 1KFDA 4CTAB 2CVIA 1C1CA 3IO1A 3TYTA 3MFIA 1U2RA 1NK9A 2P8IA 2IAJB 1OG7A 5F8NA 2JJ4D 4DL3A 1K73T 1SH2A 1A7GE 3GU0A 3M30B 4DX8H 2XI2A 1XERA 3TARA 4Q7AA 3CJKB 7AT1B 5HBMA 4CZCA 1S1XB 3TUJC 4XDDA 4AFFA 3RB0A 3H2LA 1F2HA 1GMUA 1XR5A 4B3TJ 1NXIA 2GQQA 4MYTA 3QWPA 1TR0A 3N79A 3D0HE 3KWMA 2VJUA 4R0EA 1HW8A 1RXOB 1FVQA 3T5HA 1KKHA 4C0BA 3A3OB 5EWGA 1RWMB 4FXWA 1LWCB 1HI1A 2DH9A 5E3PA 3IR6B 2OO4A 5D4LA 1R7IA 3KHHA 4DR2J 2AX0A 2FLPA 1T03A 2W25A 5ITHA 4X84A 1GXLA 3HZEA 1I94J 2HVDA 2PI4A 3FUYA 1TKZA 5D0HA 4N5SA 2P5VA 3CCUS 2ZVSA 3K5PA 2YKAA 1K0TA 4F0HA 2QA1A 1TFWA 1KN6A 3UNYA 1EETB 3HVRA 4JV0A 4ZLLA 1Q4RA 2KXHA 3EGNA 3E2EA 2AYGA 1KVKA 3QT8A 4P72A 1RWUA 2EBGA 1ARQA 5F0WA 5C42A 2ZEJA 2BXJA 4N77A 3W61A 4ZDNA 2BJDA 4DFPA 2V8HA 4AD6A 5M2UA 3D6FB 4G6VB 4QIFA 1HMVA 1UCNA 1VIXA 3GCXP 5I3QA 4N41A 2A10A 3MM9A 4F25A 3MR5A 3FNNA 2CDRB 3QIDA 1HD0A 4U7CA 2RKIB 5HO4A 4GKKF 2A2DA 3FFIA 5DZ7A 2CAJA 3J7YU 2CNOB 1WEXA 2OLWA 2CADA 2YKMB 3A13A 4MK7A 2HFZA 4ED3A 3CMAS 5D78A 1M1HA 2D3OR 1NKEA 4DCJB 4NMLA 3V4IA 4LRDA 1YSJA 2NR0A 3HFKA 3OFGA 2X7IA 5H9EJ 2KKEA 3THPA 2GGPA 2JXIA 4F4XA 1FKPA 1NSPA 3TVYA 3M6VA 5AXMA 1ITPA 4ZVQB 1T9VA 2M70A 3LUYA 1HNWJ 2BA9A 4NZ6A 5HN0A 3OL9A 1G3OA 2QMWA 3B6BA 2KVQE 3LW5C 5AXNA 2UUWA 2YWGA 3AB2B 4K4WA 4HDHA 4ZPAA 3L09A 4K4XA 2C2EA 4C2MA 2H54B 3BGLA 3QT6A 4ZCLA 2NZ4A 4DV7J 4CCHA 3ENAA 1MNEA 2HFSA 3QFHA 3KK3B 4UT4A 2L08A 2FY8A 2YX7A 4YR2A 1ZZFA 3LF0A 4F2SA 1UW4A 5LT5A 1QE1B 3R7BB 2YX1A 2RU3A 4QR2A 3NGTA 2R42A 2MHNA 3UN5A 4F3QA 1QAIA 2W7OA 4X4UA 2RS8A 3E8OA 1XNRF 4DFJA 4IR1A 1XNQF 4P2FA 3OHBA 3MXHP 2LA4A 4IQXA 4QR0A 2ATCB 3W8PA 1C1CB 2E5LJ 2NREA 2WB1D 4LBHA 1E6VA 3ZZPA 1R0BG 1DTTA 1UAWA 2HHHJ 4XPCA 5ETSA 9ATCB 2R2SA 3TEGA 4X4NA 4URQU 1C1BA 4XO0A 3DDIA 5HBMB 1RA6A 1Z1ZA 5F8MA 2HZAA 1RHQB 2OPPB 3BO3A 2DCLA 2DRAA 2FLOA 1NO8A 4AT1B 1T94A 5D0EA 2MKSA 4NEZA 1PYTA 2XMVA 3R27A 4ECSA 4DN0A 1RT6A 2QMUB 3PCOB 1YJ7A 2CZ9A 4BBYA 3LJPA 1IBMF 2HVEA 5KTQA 2QLFB 3MEGA 3DM2B 5KFTA 1WACA 1FD8A 1SCJB 3AODA 3KLHB 3SCIE 3VVUA 3MM7A 3QPIA 3PJWA 1CSJA 2HHXA 3GIJA 1Z2LA 3IRXA 3OXGA 2ASLA 1W7WA 3OW2R 3WZ0A 3BQ0A 5H9FJ 3CJTA 3N6MA 3LGHA 3OQ2A 1NK6A 3PRBA 2HWIA 3ZTOA 2XO7A 3MEKA 2G0IA 1CVJA 1VQOS 1H7WA 1NSQA 4DR1F 5L46A 2VL1A 1MWQA 5C42B 4DV5F 1GAOA 3BO2A 3M6XA 1J5EF 1LXJA 4HT5A 2J6TA 1MYLA 2OPSA 1HMVB 5KFNA 2ZH7A 1H3DA 3G2XA 2AJQA 3MM9B 4OI3A 4O3QA 3LPEA 5J1PA 2IMWP 1KLNA 2JEFA 3PKYA 1RYRA 2DY1A 1R89A 5BR8J 2AYBA 2B8PA 2XHWA 1H0HB 3DLEB 4DL0C 4CLUA 4WJBA 2F65A 1X4CA 2DR8A 4O44B 2CAXA 1S7IA 1HBNA 2YNGA 3DU5A 1WI6A 1NZ8A 3OSNA 3GV5B 2RE1A 3M8PA 2ZH6A 3V4IB 1X9SA 2HURA 4WPAA 2XC9A 1YK9A 4DZ6A 2UXCJ 5DG8A 3V6JA 4LF7F 1BMQB 2V4JA 1FJEB 2V2ZA 4FS2A 2V2KA 1WTBA 2JDJA 3NGUA 2GGPB 3DCAA 4FKXA 3KNGA 2NPIA 4D3GA 4WYLA 4QIWD 2VFUA 4LF4F 2YQ1A 3AQPA 2GS8A 1S9EB 2XEXA 5A8KA 2R8IA 4WZMA 3HD2A 2FVPA 3JYTB 1N36J 3HVTA 4DMZA 1PAEX 3DOMB 1T7PA 3G86A 2BRLA 3CDWA 1CC7A 2Y8WA 4BLGA 2RRBA 3NP5A 3WHIA 3US5A 3KK2A 1WC6A 3OXFA 2XS7A 2OSRA 3K7RA 2Z2YB 2XMKA 5L1KA 2K06A 5HI7A 3MMBA 2X1BA 3QNWB 3FSYA 1A0OB 1FTRA 2CKWA 2F9JA 3RBZA 1KEKA 1CJVB 1VRUA 2CG8A 4WIQA 1JWWA 3KUGA 4CM0A 2O3DA 2HAIA 5CD4H 2ADCA 2BJ1A 3EVMA 2KZZA 3TVKA 5FDLA 3PV8A 1E6VB 4O0IA 4OYWA 1S10A 4ICLA 4B9LA 3GCWP 1NDKA 4YOEA 1MLAA 2XNRA 1RISA 2OPQA 4C48A 3L3CA 2ZBIA 4ZP6A 4DWIA 4WFBQ 1K0VA 1ULRA 4LRFA 1RTZA 2HNZA 1U1LA 2R7QA 2O5DA 3GYGA 2HRUA 1EA4A 4DR3J 2EFVA 2HVZA 3DLLQ 4FPRA 3AQOA 2FHJD 4OLOA 3PRVA 4EWTA 1RT6B 1IBKJ 1XBWA 5SZTA 2PEHA 2RUSA 1TK0A 1FRMA 3J7AN 2BYCA 4O3OA 2ASDA 4JI7J 3C6TA 2W2MP 2MQPA 2YKNA 1SL2A 2V67A 3MEGB 3R5GA 3AD7C 2JEIA 4ZPCA 2BNWA 3T9NA 3MM7B 3CCJS 3OPKA 4TKTA 3RAQA 4NLUA 3O6QA 3CEDA 3M7VA 2PFDA 2R7TA 2BW2A 3BSNA 4YY3F 3S8SA 4J9QA 2B6AA 1L3KA 4JI8J 2MKIA 1Q53A 1BQMB 1C0UA 1X7VA 1TAQA 4ZLNA 2VFRA 3TP2A 1YQHA 3IA0A 3BH6B 4CLTA 3C2PA 2MDAA 2PA8D 1LW0B 3FK4A 5AJ3J 3L9ZA 1Q81T 3D28A 1VHIA 2MKYA 3NG8A 4R5PA 4RJVA 2VG6A 2K7KA 4P6QA 3RYLA 2CPFA 3CDBA 5A2QU 1X5OA 2K6LA 2KI2A 3FKBA 2GVDA 3RRGA 1HBNB 2W9CA 2DO0A 3T1YJ 2J5AA 2PT0A 3IC1A 4LRCA 4DL2A 1ZZNA 3C14A 2DGXA 3DMJA 2CIMA 2HIQA 1IWAA 2V4JB 4LFBJ 3X1LB 5BYRA 1B64A 2I2YA 1XR7A 4TU8A 3GFXA 4X62J 3UN3A 2J8AA 1YIJS 2EC0A 4G3IA 2LQJA 3TAQA 3ELHA 1RU2A 2X1GA 4TY8B 1UETA 3LWMA 2QJ3A 4PQAA 4X4TA 3ZXWA 1HFEL 2MQLA 3I4HX 4J9PA 4RW4B 2F63A 1WDDA 4C3MA 2G1DA 4MMOA 3NNAA 2PDAA 3MECB 2BKPA 1YRUA 2OEMA 4ELUA 4DF8A 2V4QA 4ZN3A 4QPXA 3TQEA 1JKHA 4F0MA 3KK2B 4JI3F 1NH8A 4LSLA 4KH0B 4J90A 4DR2F 1V6HA 2GVZA 4KGXB 4M5DA 4E2FB 1ZM9A 2LECA 1ZBTA 1BD6A 4ED1A 1I94F 2UVWA 2AGPA 3DOLB 3V6DA 3AHPA 4L75A 2YBVA 4DS4A 3IM8A 2IDLA 2MQMA 1KHWA 3FBCA 1R6VA 4ICLB 3BO4A 4CH0S 1S5ZA 3AFGA 4UOHA 4PKDB 1QUVA 5IT0A 1RBAA 3UDLA 1X4EA 1TKDA 3CD0A 2FD2A 3ZTPA 4WP8A 4K4SA 5KFPA 1B70B 2MLYA 3ENWA 4HHUA 3FQKA 1TMJA 2HNZB 4EUVA 1UVMA 3G6VA 3OXLA 1YHQS 4FPIA 4OHZA 5DLFA 4GO5X 1I51B 4MIWA 1N6QA 3SDEA 2KG0A 1KHVA 1K44A 3EZUA 2CG4A 4KO0A 1OIAA 4JI6J 4NI2A 1FXLA 1IRQA 2YKNB 2QX0A 3MEDA 2RILA 2HKEA 3TI0A 1Y5IB 3GR0A 4ZCMA 4W92B 2PMWA 2OFHX 4NCAA 2D3ZA 2Z2MA 2J0WA 5JVHQ 3RB4A 3RRKA 2CNLB 8RUCA 4EBDA 2B6AB 1HNWF 3G6YA 5A8RA 3H5UA 3I6PA 3M6UA 5B0EA 4AL7A 4ZPWR 1HBMA 2QL9B 2UUBJ 4LFAJ 1GX6A 4C8OA 2OMOA 2ZH2A 4NRUA 3T41A 1XC9A 2I38A 1HQEB 4ZPBA 3MMCA 3TX8A 5A0YA 1AUDA 3VGTA 2DR5A 3IWNC 4AAIA 1JX4A 3D1HA 3K5OA 3EX7B 2VG6B 2C42A 2AEJA 1U0HB 2MZ1A 3V4MA 5GAEI 3QRRA 1UZHA 1HNXJ 3KLGA 2GMLA 4IFVB 2RHSB 2UU9J 4FVMA 3C14B 3DLHA 4OFZA 3TO8A 3QGPA 5T14A 4IH5A 5F9LA 2JLGA 3TUIC 3KJQB 2E5LF 2ZDOA 4OYOA 2VKZG 4OYMA 2DITA 2ZVIA 1IJFB 3DI6B 3NNEA 1HARA 2HHHF 1RCXB 5ETNA 1NBEB 5F3ZA 4I4BA 3SCKE 3U1NA 1QTNB 4CO3A 1G1XA 1LFWA 4MT1A 2E44A 4C98A 5CYJA 3FC9A 3BKFA 2G0JA 4NLSA 3SCJE 1XMQF 2GV1A 4O3SA 1OY6A 5KG7A 5D4OA 3TQ1A 1JLCA 5L39A 2MKHA 3KG0A 3CIMA 2I9SA 5L8RC 1VLOA 3NRBA 2MQOA 3DLBA 2NXJA 1AYEA 2E1PA 1DAXA 3JQJA 2AYMA 1T02A 1DHMA 2R4FA 4LJMA 3OLBA 2DKOB 5I3PA 4J9UE 3EPIA 2GVZB 2E5HA 4RZRA 1WG1A 4M5DB 1UW9A 4WK3A 1VDHA 1PJ5A 1WTFA 2CWXA 1YWXA 2Q2KA 5JVGQ 2QZ8A 3V6DB 3UDCA 4ECXA 3ADAC 7FDRA 4BCAA 2UUCJ 4G1QA 3RTVA 1D9FA 4PEOA 4IFYB 4M5MA 1IJEB 1RI7A 4HHJA 3W5XA 4LF6J 1LK7A 1T9XA 1WF2A 3OSPA 1BE4A 3Q2SC 4QR1A 3W3SA 2A2CA 1KRPA 3PACA 1DJ0A 1IKXA 4ES1A 2DNKA 5D6GA 2DNMA 2AKWB 1A9NB 2BRKA 2AN7A 1QJHA 1QLNA 3GSDA 4XAKA 3Q2TC 3Q8SB 2CPIA 3RB3A 3DXBA 4CLPA 5BR8F 5A8WA 1FD2A 1U7LA 2JWNA 1N6QB 1EAYC 2LKZA 4HDGA 4FBTA 2OPRB 5KG3A 4KO0B 1C4CA 2GA7A 3QZ7A 2CQDA 3BPDA 4F4WA 3GTYX 2VZ9A 1IUJA 2MKKA 3H59A 3NS6A 2MKJA 2MY8A 1SIWB 2G2YA 2XULA 1DBDA 5F8IA 4J9NA 3CWJA 1RWOB 4MH8A 3MEDB 1NK8A 3CCSS 2IM3A 1RP5A 2BDPA 1OSCA 1BQXA 2KRRA 4HI1A 3V81A 3CCTA 4B3OA 2DNNA 3S6EA 3BN4A 1JMTA 2CXEA 4OI2A 4NE9C 2J7KA 4DV1F 3QJJA 3OVAA 1TVRA 4A8XA 2RAQA 1U02A 1UPMB 2DIUA 2X51A 3T19A 4OZLA 3NAHA 1PYSB 2OJ3A 4HKQA 4EEYA 1HNZJ 1WOSA 4TU9A 1B99A 4V1Ak 3K8VA 3CGIA 3LQVA 1DARA 4O23A 2AYEA 2RH3A 2XS2A 2HQGA 4PUOB 1UWAA 4DXLA 1WKKA 2GJIA 3QT7A 2KYXA 3JXOA 2QLWA 1FWPA 4DL5A 1LOUA 1VQSA 4LMZA 2RF2A 2LQ5A 3FGVA 1ZPWX 1I3OB 1WHXA 3T5LA 1DFDA 1H73A 2OFGX 2BV3A 3F41A 1P9QC 4WCEQ 5LJ3Y 3OLAA 3H0PA 1YX2A 3RAMA 4GVLA 3OVSA 5DG7A 2ZJPQ 4O3PA 1WHVA 2XWXA 3GFZA 3BH7B 3AH6A 5AE3A 1VQKS 2KXNB 3CC7S 1NJIT 2EEYA 3FEZA 5KFRA 3H2UB 4Y3CA 4ZJQA 4Q8EA 1SI9A 2FJDB 4I56A 2ZZMA 5KT4A 4K5SA 2VBZA 4UW2A 1EIYB 4LSNA 3QAUA 1JLFB 4P74A 3S1TA 4MTPA 4ZP9A 2PD1A 4DR3F 2HQIA 3R5CA 5CXTA 2BUNA 2VQFF 4ECYA 4HACA 1IBKF 4K2JA 4UUXA 2CZ4A 3EE3A 3DGPB 4JI7F 2W7AA 4ANEA 3VAKA 4KTQA 3CULA 4KSEB 2V2QA 3MPVA 4B3SJ 3W63A 2ALZA 5LOQA 1Q16A 5D4NA 2U2FA 1TL3B 2IYGA 1S9GB 4DQRA 2J6UA 3GSIA 3MUMP 4ZVGA 1RT3A 4G1QB 4ED2A 1LWFA 3HF5A 2W24A 3E01A 4Z2XA 1UJ4A 3HJVA 4A8OA 3TZXA 4UF4A 5KFQA 4DI6A 4ZHRB 2IRXA 2BBEA 2EKNA 2D1CA 1TZ0A 2DEJA 1RDRA 1YI2S 5AXKA 2EG2A 5HVGA 3QATA 3V2UC 1F6TA 1RTHA 4F4KA 1FK9B 2D3UA 4KGVB 4PG6A 1ZM2A 4J91A 4F04B 2JZ5A 3NCPA 1I1GA 3HFVA 4NOHA 2K3IA 5AJ3F 2DVIA 3DRPB 4ZPVR 2HZVA 3H90A 2XNQA 4PYDA 1SJRA 1KLMB 2R2RA 1JJCB 2YKQA 3TWZA 4D3HA 5E3QA 4HV0A 4Y65A 3IGNA 5A8WB 2QGFB 4C8LA 1JLAA 4GVBB 1H2UX 4MJWA 2K3KA 1U1NA 4FNHA 4RKUC 1S99A 1W25A 3F56A 1VK3A 3RU0A 1Q0NA 2QRRA 4LFBF 4DU7A 4Y2IA 2XGQA 3V81B 3OTEA 2PC6A 3K17A 1MROA 2O66A 3BREA 1FXRA 1AZSA 4FF2A 3NKYA 3BEGB 4X62F 2IMOA 1RLCL 3CJ8A 3NBPB 1PYOB 5E3CA 2ROPA 1H98A 3CCES 4DQIA 1IQTA 1D9AA 3CNQP 4ITSA 4E8UA 1N4LA 2CQ2A 5EN1A 5C24B 4JI2F 2XMAA 1FJCA 2ADBA 3GG0A 4OZ1A 3KLFA 2WRMA 1KBRA 2MGZB 3QYYA 2WVDA 3NMRA 2E1CA 4DPTA 4QU6A 3GYNA 4OX8A 3ILOA 1XWLA 5SUHA 1EX8A 1Z4UA 3MDFA 2OH2A 2R2TA 2ZJRQ 2BMBA 2K7JA 4OHYA 3LP0A 3VAFA 3MR7A 3NGDA 1F5AA 1RCOB 1SB6A 2Y1RI 4A8QA 1X0PA 2WW8A 4ELTA 2JC1A 3NEKA 1F2GA 1X4BA 4NXMJ 4Y6IA 5ETQA 4ES2A 2J7WA 2JL9A 1RTJA 4B3RJ 4J9RA 1ZA1B 2C2ZB 2QT7A 2OEKA 1CS4A 4ALZA 4KGKA 2CWKA 4MIBA 2LU2A 4EYHB 4USTA 1YBTA 4CO4A 4CH7A 2BEFA 1CQNA 3TAMA 2NXEA 3R97A 1JIHA 2ZNZA 1HQUA 1IM6A 5KG4A 5K8OA 1RYSA 2UV8G 1AFJA 3I32A 1V5VA 1XN9A 5KFYA 3M2VA 1HYSA 2P9CA 3QJLA 2BNZA 3FCVA 4MKVA 4NRTA 1SKSA 2SXLA 1XMOJ 3HHDA 2ZZNA 2Y3YA 5ETPA 2DPIA 3QFWA 2KRBA 2VKRA 4QW9A 2ZC3A 2V34A 2VOOA 4KFBA 1Q8KA 4BWMA 3PW4A 2HHWA 4N47A 1RA7A 4TQRA 1U8WA 1SVDA 1YJNS 1HLWA 2IJFA 1VS3A 1RTHB 3MCMA 4UY85 3GIMA 3A3PB 2UUBF 2GMHA 1ZAWA 4RWXA 2XSJA 2GMJA 2LA6A 3IBWA 1RU1A 1R31A 1U47A 2W2OP 3JQMA 4FF4A 1H2VZ 4ZPTR 4DV4F 1FX4A 1EARA 1FERA 2DHXA 4YP3A 3K57A 5T41A 1JLAB 1S6UA 4DFMA 1MW7A 4JP8A 3CF5Q 2M2BA 1KQSR 5CABA 3PHTA 4EU0A 1VISA 1HNXF 1RAEB 2IYIA 3PRDA 3GILA 3N28A 2UU9F 4OJGA 1DQAA 4DUYJ 3JTPA 1VQNS 2H1OE 2BQ3A 2IJNA 3HHLA 2CPYA 8AT1B 1U1MA 3MD3A 3OTDA 4FNIA 3HKZD 3J80U 3TANA 1DLOA 1ZH5A 4B9VA 4KB7A 2W9BA 4HYKA 3KHRA 4WIIA 3GJRB 4NEYA 4CO2A 5CCMA 4LRVA 4MFBA 2Q66A 1NNDA 1E6YA 4MJKA 1L3TA 2YWKA 5IZHA 4LUBA 2MZRA 2NXNA 1XJWB 2RVJA 4XTTA 2BA3A 2BJ8A 4KR0B 1P27B 2HHVA 4KV8A 1AA1B 3ET6A 4OMFG 1PO6A 3M8SA 2CPEA 2NSBA 2Q6BA 1WORA 3I55S 2L9WA 3NCQA 2WHOA 1RHRB 4RW7A 2HHPA 3THVA 1URRA 3I0RB 2JEJA 4GO7X 1IBLJ 4K0KJ 1ICEB 1HR0F 3T6BA 5KT3A 1Q95G 1AW0A 4DFKA 1RT1A 3GIKA 4DL6A 3BZQA 1F0XA 4LF9F 4LF6F 5EWFA 3CSKA 3VAGA 4ANCA 2A3JA 2YQ3A 4ZJOA 3PW2A 5GVQA 1RTJB 3L95X 2G13A 4Q2MA 5KFXA 5KFBA 2OTJS 4U67Q 2ZH4A 1DURA 1CS4B 5H1SV 2JOQA 1REVA 4Z7CA 4LF1A 4NWBA 1IKWB 5E2QA 4TYBA 4I0WA 1IKYA 1KD1T 1SV5A 3KDOA 2KYZA 3G96A 2EW9A 1RBLA 4ECQA 4HTJA 3IS9A 4DV6J 4RW8A 3TAMB 1ROFA 3MD1A 1HNVA 1NH7A 3M9MB 1HQUB 1BDVA 3TZWA 5DJBA 1JJHA 2HS3A 2DCUB 1Q82T 3CJ5A 5E0OA 1CC8A 3Q8UA 4MK9A 4IO1A 4KPYA 1VFJA 3DKDA 3PW0A 1HWIA 4RW9A 1Q7LB 2XGPA 3M2VB 4Z37A 4JI0J 1R43A 2XLIA 5FJ4A 5KT6A 1RHJB 3HLUA 2X1FA 4NLYA 3JSRA 4N76A 4IKAA 2EWHA 1JLEA 2MMYA 3LGNA 4DSIA 4ED8A 2PA3A 4ED6A 1Y5LB 5KG6A 4LIRA 5DO2A 3GFHA 3KJVB 5KFKA 3UDVA 1R0AB 1RAJA 2VFSA 3LA0A 4OZ3A 3W62A 3KOAA 4C8YA 4RBUA 2C2KB 4KFBB 3DGVA 2KL8A 4PXBA 4F4AA 4QBUA 1BQNB 4Y28C 3NCRA 2DNYA 4YQWA 5K5MA 5KFVA 4CLZA 1KFSA 1HNZF 3AT1B 1FRXA 5B0DA 2XSJB 1WKJA 1BC6A 2CQPA 2C1EB 3MAHA 5IXUA 2QO3A 5L38A 1MWYA 1JLBA 1T9WA 6FD1A 3ENVA 3CC4S 3OFHA 4EZ9A 3W9IA 3HSJA 3BKUA 3UN2A 1EKSA 5CCLA 1N88A 5E5NA 3HXMA 1F9FA 2C2DA 1OJ4A 3EPGA 4LBPA 3WDOA 5KOXA 3CW2C 1P6TA 3L7PA 3UWTA 4DV3J 3OR1A 3NL0A 4NX9A 2EC2A 2B4UA 2CNNB 5K8MA 4WU2A 4NCGA 3T5KA 3HHLB 2NUHA 4DLEA 3ZO7A 1NKBA 2LXUA 1FDDA 1GTHA 1KOOA 4L76A 1YRXA 4Q8FA 3M9NB 1SL1A 2LQ8A 1FCAA 1DLOB 4A8YA 2VFTA 3K5LA 2F8EX 4DOZA 2OAUA 1U4BA 1I5OB 2W4DA 1B7YB 2K1OA 4RUCA 1X93A 4MFBB 4DR7J 4WE1A 3EGVA 3RBXA 4L74A 5GADU 3T9ZA 4KV8B 2PGCA 1Y0HA 1BUXA 1ZTWA 4QYZJ 2D3O1 1NK7A 2KT5A 3ZZOA 2WB4A 1HI8A 4NZ0A 3ILIA 1RHUB 4ZVPB 3CO9A 4P9SA 1FNMA 4RW7B 4HT7A 1NJXA 5EDWA 2XG8A 2F40A 1T3NA 4LR7A 3J81Y 3VAIA 4YHHJ 1RJJA 2CJ9A 2VDIA 5IC4B 5BXIA 3JTNA 5A6WA 4ID5B 3RR7A 2LVWA 2HYIB 3BGFA 2WOMB 2LEBA 3EGZA 5ETLA 3M30A 5DM6Q 2UUAJ 3CJKA 1SJ1A 4K4VA 1VK8A 1UPPA 2H9ZA 3KLIA 1FEEA 1S1XA 1O5JA 1NDCA 4NLOA 3OV7A 4A46A 5LMUF 2J76E 5HANA 5KFCA 2HBZB 3JB9k 1QUPA 4OYAA 1REVB 3PR4A 5BYSA 4NLRA 2VUGA 3HP6A 3LP1B 4U9RA 1SV5B 1KVIA 3KKFA 4XPEA 2Y8YA 2HHTA 3VEBA 1WEZA 2VOPA 1X4DA 3IS9B 2OHDA 2GPEA 2BKOA 4WXOA 3K0JA 4DSJA 2IA0A 2IBOA 1QAXA 2MEWA 2BZ2A 1CJUB 5GAHU 2W8KA 1K9MT 2B9XA 3HHKA 4RR5A 4TLQA 1VQ9S 4IOCQ 2MLXA 1VGYA 5I42B 1FTCA 1EETA 3I9V9 2A6OA 2MQ8A 3DFEA 1JLEB 2ROEA 3BJYA 3PKMA 3DRRB 1P1LA 1WF0A 4RNFA 5D0GA 1Y00A 3MF5A 3TA0A 4YR0A 1B7FA 2IA6A 2N7YA 1RGVA 4AL6A 1KQGB 3B82A 3Q0AA 1N5YA 2ADLA 3FBEA 1U26A 4YR3A 1W26A 3P49B 3MTJA 3OVBA 1WEYA 3CD7A 3JSMB 4KHPJ 3FCHA 2FLLA 4Y00A 2JBVA 2RKIA 4PAAA 1NLKL 3U1LA 5HATA 2HHQA 4QYRA 5I3UA 2W2PP 2W2NP 4G1PA 4X66J 3R2CJ 3PW7A 4FBUA 3MR3A 4A8FA 1VBKA 2HQDA 2P6SA 2F4FA 5F41A 4M1KA 3M8QB 2H4YB 3KUHA 4OHXA 3OJSA 1VBYA 5HQLA 1WC5A 2IDEA 1AT1B 4H4MA 2WZ1A 2DK2A 4RPFA 3B78A 4OZ2A 4OIXA 2N4CA 2C3PA 2CYYA 2MQNA 5J1NA 2XQCA 1WHWA 1F5BA 3CJSA 4NCGB 2GJFA 3PJXA 2G4BA 2HGMA 3K2YA 3ITHA 1JXVA 5IQQA 2G9OA 2IPOB 4B3RF 4PG4A 2MZQA 3CIZA 2J7UA 4ED4A 4DPUA 5DDQC 3VEAA 3H4DA 2ACYA 1MMDA 2NS1B 2FJBB 3PXGa 1CG2A 4TQSA 3S7RA 2UXDJ 1I6JA 4WE1B 4QIEA 2H4WB 3RG6A 2HHUA 1RAGB 4JYAF 4FYYB 2H5IB 2IHR1 1QD1A 4ME7E 2KH9A 1JLGA 1QSSA 2BSQE 1XR6A 2H5EA 1Q1KA 1X4AA 3MCOA 1RACB 4PWWA 4M95A 2L41A 1GXUA 3O3LA 3W9JA 1R8PA 4YDDB 3HHLC 3I82A 1N34F 1RWVB 1U9PA 2Z8QA 4P71A 2ZH3A 1M5HA 2HWTA 2DBBA 4DCOB 4NL5A 1LWXA 2C2RA 1TFYA 5LMNF 3FBFA 4DR6J 2VQEJ 1XMOF 3UR3C 3FMWA 4QIVA 5M2RA 3H5SA 1HPZB 2KFYA 2IRYA 2PI5A 3ISZA 4R8UB 4NZ7A 2V6AA 5FLXY 4NXNJ 3EM1A 2FVRA 3KLIB 4J9KA 2RB7A 2OPPA 2O67A 1B01A 5HL7Q 3DOKA 4M5HA 4ECUA 2MLZA 1J27A 4C8KA 4CT8A 2A6MA 5F9NA 2DT9A 1YTYA 5LM7E 2WW4A 3EZ5A 3OTCA 3PO5A 1RBOB 3QLHA 1KOHA 3RJMB 4MAKA 4X4OA 3FVYA 5KT2A 1Q86T 3DM2A 3C8YA 3MTKA 4CLFA 1M5SA 3KLHA 3SQGA 1FRKA 4X65F 3MR6A 4CQ1A 1B0TA 1X5SA 4CP5A 2KU7A 1YZ7A 4ATNA 5EX0A 2KM8B 2CPGA 3R7SB 3KUEA 4DUYF 2BOPA 3PW5A 1OYEA 3MM8A 2VODA 3IFEA 3TNVA 1BY9A 1D1UA 3PX6A 3HJFA 4PRFA 3EDRB 3JSYA 1GNKA 2GW8A 2HFUA 2WSCC 1WD6A 3CMQA 2VPWB 1N5YB 2I8EA 3M32A 3VZIA 4OZNA 2AJ4A 1FNOA 2GCFA 2HNYB 3CD5A 1DTQA 3CUNA 2R3VA 5D15A 4P7VA 1FJGJ 3ZZYA 2HNDA 2BJ9A 3W65A 5I3UB 1LW2A 4RWWA 3AJ2A 2DNQA 3MZIA 4CNZA 3DLEA 2VB6A 2XZTB 4OX7A 2P6TA 3MURP 2AW0A 4O44A 2JHEA 3D0IE 4LF8J 3VALA 1VQ4S 3ZNJ1 4KHRA 1S48A 5JUMA 5KFLA 3CCZA 4ZVUB 1IWGA 2HSEB 1HQ2A 2B9WA 4OJ3A 1VI7A 2M8HA 2VC0A 2DXDA 2KZMA 3FDSA 2N3OA 3OFFA 4JI5F 5HQ8A 4H4MB 3T1HF 3G9CA 2JVRA 1IBLF 1S6PA 2GJ2A 4K0KF 2NXCA 2HLTA 3FQLA 4OX9J 1TUWA 3GFYA 4OI1A 2ACMA 3GG1A 2DXFA 3SXLA 1LKZA 4R0JA 3R5JB 1S59A 2JC0A 2FHOB 1UJ5A 3ITHB 3BF4A 1M5VC 1OMSA 2DGQA 1S9EA 4OYXA 2MYFA 2LP4A 2LLZA 2VPZB 3JYTA 1HI0P 4X64F 3DOMA 3CO0P 1SKUB 1SXLA 2NXUA 1N33F 1JNRB 1YJWS 4K4YA 3W64A 3U27A 1UMJA 3DYAB 1FRHA 4LIWA 4CLLA 4TYAA 2YPYA 4PQUB 4DV6F 2F8MA 1JLGB 2XY5A 2F9DA 1Y3KA 2YPZA 3CCMS 2JNJA 2UZAA 4O4RA 1F5CA 3IRWP 1CULA 1EQ0A 4W4MA 2UXBF 1CJVA 4IDKA 4JI0F 2FLNA 3MUTP 1IVZA 3BBCA 5HSPA 4KJIA 4KHMA 1FFSB 2XM3A 3ZZRA 2XY7A 4M94A 3CJ3A 5C7PA 3M1VB 4ECWA 3JAMU 3OTOF 3GV7B 3IGVA 5C5JA 2GHPA 2DGVA 2B56A 4M5LA 2ZC4A 1LV5A 5EGYA 5IT9U 5G0RA 2Y0SD 4NLDA 3K58A 2CVEA 4WZQA 5CA5A 2XMTA 3DOKB 3QGGA 2UV8A 1Q8BA 1HNIB 2EPIA 1RT2B 1R8HA 1UFLA 4DSFA 2WTFA 4MK8A 3MR2A 2B9EA 1R0CB 1JJ4A 2JLEA 2KKHA 4A47A 2W4CA 2V8GA 3QOQA 3QLHB 2VASA 2KT2A 2VA2A 2GO9A 2DIVA 3THTA 2FJXA 1KWMA 1RADB 3SQGB 2AIRB 2YVSA 1TKTB 3VW4A 2JXHA 2DRBA 5GMDA 2CQGA 2OD6A 5GMEA 4DPOA 4DV3F 4OV1A 2RNEA 1U1QA 3H5XA 3GV8B 3MM8B 2ZWPA 2LXIA 5KFUA 4RNHA 1S49A 2MKCA 4CYUA 2BVZA 1SUQB 2V2VA 4UZCA 1TUVA 1BQMA 3JTOA 1RT5A 3FSIA 4WF9Q 1FI4A 5DZ6A 1LW0A 2RJZA 2DGWA 3M32B 3U02A 2FZCB 2CJXB 1S1WB 1OYDA 1FRIA 4EMDA 1DTQB 4DR7F 4Q2LA 3GYXB 3WIVA 1Q5YA 2HNDB 1G6BA 4BHQA 3UCGA 3DRXA 1LW2B 2IRUA 1GTEA 1LFPA 3X3UA 4L73A 2XCAA 1PC5A 3EXYA 1N5SA 1VQ6S 3R5AA 5THWA 4DR4F 4X4SA 3MPDA 2MTLA 3PIPQ 5E3AA 3NGKA 2AZ3A 4XK8C 4YHHF 1KVJA 4IH6A 1S6PB 5AE1A 5DGBA 1ZOTA 4ECZA 4CO0A 4DR5J 1NM2A 2K9IA 2WONB 1MG7A 3RRHA 2BE2A 1F1BB 1TKXB 4WTOB 4WYWA 2KHDA 2BQUA 1SC3B 3PNIA 2UUAF 2XI3A 3FRZA 4Y0FA 2G2ZA 4ECTA 3L7UA 3I31A 1SH0A 3ILJA 3KXDA 4BDPA 5HK4A 2GZOA 3TA1A 4I6WA 2R8KA 4TY8A 3AAWB 1NDLA 3DRSB 4QU7A 2DNZA 1EB0A 1AUSL 3Q23A 1K8AT 1JLQA 2DYAA 4RW4A 2AMCB 2Z57B 3M8ZA 2QN6B 5DETA 2ZNYA 2R2UA 3QIPB 4B9UA 3MECA 4YDXA 1O8BA 3BDEA 4R25A 1UVNA 4IRCA 4J9SA 3CMES 3B54A 1RAFB 1CBKA 2UVVA 1FKOA 2VONA 3VR1A 1VQ5S 4QZVB 3W60A 2EI5A 3A8KA 4F8RA 4B02A 3CJ4A 4DG1B 3F44A 2H5JB 4ZVOB 3I4PA 5A2QY 4NPOA 4ED7A 2ZUGA 1CULB 2O1PA 2W8LA 3DOLA 1TQLA 3B8HA 1QVGR 1TP7A 3SSQA 4IDKB 1VMBA 1IBMJ 2QA2A 3ISNC 4Y2MA 4C11A 2J9DE 3N6NA 4Q5VA 4Y2AA 1M5KC 4GRSA 4X4QA 1U0SA 1YLXA 4KKOB 5HROB 1VQ8S 3CPWR 1SH3A 3BBBA 1T9YA 2KT3A 1FRJA 2KN4A 4OI6A 4O4GB 3C16A 2M8DB 1URNA 2YKPA 2RD5C 5G0RB 2VA3A 2C22A 3DLJA 3PX4A 4DR1J 2CQ1A 1CJKA 4RU2A 4KHPF 3DLGA 2DNRA 4TVAB 4RUHA 4ED0A 4DL7A 5IV3A 5KFOA 4IG0B 3GQCA 1RAHB 2R8JA 2AF6A 3RW7A 1SQEA 2VJVA 1NU4A 2OKQA 1U24A 1M1KT 1RKJA 5B0FA 3DHWC 3I9ZA 1QM9A 4UY8T 2QA4G 1PG5B 5L9NA 3TUPA 4RX6A 3AXKA 2HHSA 2WK4A 3PY8A 5IWAF 2DJWA 2ZHBA 4RBVA 8ATCB 4YMEA 2FVSA 1L3VA 1UVKA 5KFDA 3IBFB 1HWUA 3OFEA 1T3OA 1D8ZA 4CYUB 1U6BA 4P2SA 2RRNA 1CLFA 1HA1A 1H74A 2V8PA 2D74B 1RT5B 4PWDB 4IO9Q 3DN9A 3ISND 2LFVA 5MLCV 4I6AA 3HVWA 4H4OA 5DS7A 1MN7A 2FC9A 2R7XA 2L9DA 4LF4J 1TMMA 1S79A 4JI1J 4KYZA 1HQEA 4YEAA 2UXDF 1RLDA 3DRYA 3NS7B 1HD1A 3HM9A 2JRSA 2M9KA 3NY0A 1UVIA 1OY8A 3SSSA 3HVAA 2NSCA 2VICA 2WCXA 2DNLA 4BWJA 1HBUA 2JLFA 1U0HA 2V9KA 4PZVA 4Q44A 3LP2A 1PC4A 2QLBB 2AJFE 4G1IA 4IFVA 1F60B 1RTIA 2BABA 5B08A 2W9AA 2B7BB 2YH1A 3M2RB 1GMWD 3G8QA 2H1YA 4NLXA 1XEZA 4A4JA 2R7OA 3TAPA 2AJ0A 1LQ9A 3KTQA 3T1AA 4DR6F 2VQEF 4Q43A 3DI6A 4ILMA 5ETRA 2BM0A 2POKA 2BE2B 1SC1B 1KDNA 3H5YA 3M2UB 5EHHA 5GAGI 2AJ2A 4KIAA 2CDQA 3BM7A 4NXNF 3WX4A 2M52A 3H20A 4LSZB 2YWHA 4N8NA 4W90B 2LEAA 3NWRA 3A8JA 2LCWA 2HBQB 4YUDA 4B3TF 2JSXA 1PSDA 1JLQB 5EWEA 1NJZA 5ETKA 2CPDA 2HGNA 4TU7A 3VGUA 2NLWA 3FMTA 5J1EA 2FHJA 4AQYJ 3SQOP 4RLEA 4M8LA 1FKOB 3NWGA 4M63A 3GIIA 2MSSA 1SQGA 4GC6A 4YFUA 3POTB 1SJ4P 3NMAA 3ETOA 4WWSA 2CZVC 2PMZD 1HW9A 2MB0B 3ZZTA 1B3TA 2MJNA 3QQCD 1CEZA 4C11B 3P96A 1IQZA 1VJWA 5M2PA 4IFYA 5F0UA 4WXWA 2VIHA 4CT9A 3NGRA 3SV4A 4RUBA 3D3BJ 3UNGC 3PX0A 2DNOA 3H7HB 4W98A 2DISA 4XIUA 2EKYA 4C9DA 5K20B 3C16B 4YY3J 4PPDA 2NPFA 4ZKAA 3VAHA 4DF4A 2QV6A 4FDFA 1CJKB 1TUGB 2IM2A 1FJGF 4ZOSA 5B09A 3DLGB 3N6LA 1KC8T 1V3SA 2Z30B 2RS2A 3R2DJ 3O8WA 2HBRB 1S0OA 2C2OB 2Z4PA 2ASJA 2H65B 1M90T 1WG4A 2OPRA 4LF8F 2X3GA 4PWUA 3RGIA 4KC5A 3LTOA 2LEPA 2OI2A 2K8GA 3CC2S 1SIWA 4B9TA 4UOGA 2VG7B 2FQQB 2Z56B 3M6WA 4I7FB 5BYQA 2CPHA 1M0SA 4DV0J 2R9LA 4ILLA 1TTHB 5DGAA 5LSOA 4LREA 4M5NA 4OX9F 5D8HB 3MGJA 2HQFA 4C97A 1RWNB 2QSWA 5KFHA 3GJSB 4FP9A 5L9XA 3V6HA 2CQ3A 4EGLA 3HD1A 2ZE2B 3OUYA 3G5OA 4KGZB 1S6OA 5D4PA 4H4OB 1YZ6A 4DV7F 1N0UA 2GNKA 2RBFA 2Q3PA 3G82A 1MYKA 1IKVB 1B4SA 5GADI 4PUOA 2CQHA 3HSGA 2GFFA 2ZD1B 4QWBA 1H6KX 4GMKA 1FE4A 3UCZP 5LSRA 1UTAA 4KT0C 2R7VA 1NSKL 2AV5A 4QPTA 5T7LA 2DNGA 4USVA 1HBUB 1S57A 3K5NA 4U7UD 2E5GA 3LP2B 1T9TA 1Q7YT 1Y7PA 1ZPVA 4ILRA 4JI3J 1RTIB 1H38A 2H48B 4M5GA 2XS5A 1D8YA 3D1QA 4OV6A 2D9PA 2M88A 1CJTB 1S1UB 1EKRA 4NYOA 5CYMB 3B4MA 2APOA 3KDNA 4WK1A 4LRAA 3EYZA 3HT3A 3G4SS 1IR2A 5KFJA 4JI4J 1RB0A 4FF1A 2DGSA 3GXQA 1JLFA 4UTGA 2ZBRA 3Q89A 3EWGA 3UD5A 4DSEA 3W8GA 2E66A 1ZETA 4DPXA 2VHGA 4V19X 2XLKA 4Q0BA 5J1EB 1T9UA 2HRYA 3LAKA 2N7CA 3KHLA 3DGPA 4KQZA 3PYEA 4K4ZA 5HLFB 4FN5A 2FVCA 3IR7A 4NASA 5GAHI 4CO1A 3UD3P 1TL3A 1S9GA 4U96A 2XZDB 2E1RA 2N4DA 3C15B 2ABYA 2LU1A 2RQMA 2PN6A 3TJ8A 3QSIA 4N7TA 3ZZZA 2MY7A 1F9HA 3DU6A 2KVIA 1LWEA 4ZHRA 4HH1A 3N5FA 2P9EA 3UPFA 3GB0A 3LALA 2E29A 3CB4A 5CZXA 3LO3A 4K50A 4WP9A 5FLXU 1FK9A 3NO7A 4PXDA 3KG4A 4LR8A 3GIRA 5KFAA 2B9YA 2C3UA 3K8WA 3DRPA 2V50A 3EMTA 4F26A 1KLMA 2WVBA 1MMLA 1FEHA 2KDOA 2PIIA 5JJBA 4YB7A 4IH7A 5IM0A 4X4RA 3EGWB 5CHCB 3E3XA 4GVBA 1YJUA 2RUGA 1GMVA 3IMQJ 1LNQA 1B0PA 4MKAA 5MAOA 1GQEA 4U8YA 4OQJA 2CJKA 3IWXA 2B51A 3ILLA 2XY6A 3U1MA 1NPKA 1Y9OA 3D6TB 1S0MA 4LRBA 2UXCF 2LDYA 5KFWA 4DR5F 2CPJA 2FC8A 3P45B 2W1BA 4UQTA 1U49A 3W2VB 3T5JA 5B0GA 3NBPA 3VGVA 1UVLA 1X9MA 1SL0A 3IAM9 3A8IA 1TU0B 2A18A 3AJ1A 3A3NB 1HL6A 3OUYB 1N36F 3N0VA 5C24A 3OL7A 1WOPA 3D5MA 1YBAA 3DNCA 3WC0A 3G82B 1XMQJ 1S72S 1TAUA 4MYUA 1HHQA 2C28A 4DL4A 2MGZA 1VRQC 3CJRA 5F3TA 2F4VJ 3MOJB 4L6V3 1UEKA 2GAGC 3QSYB 2QYCA 1TL4A 2VD3A 2PMHA 5T7LB 5AT1B 5B0CA 4P73A 2DHSA 3I5BA 4QWEA 5IS2A 4I69A 4LF2A 4TY9A 2RQ4A 4HH0A 5KFSA 2IY5B 4USHA 3N4WA 1X31C 2ZJQQ 1D3WA 2GO8A 2B0GA 4TNOA 1T03B 5H9EK 2C3YA 2GIRA 1TKZB 3BYRA 2FHMA 3T6JA 4G65A 5GMKa 2P2CB 2ZM6J 4USKA 4F2RA 1FFGB 4UQGA 4LVNP 4LR9A 3JSBA 1VC6A 3BBFA 2ZOGA 2N3LA 3MAAA 4ZMMA 2I6WA 2QFJA 5KT7A 5DQHA 2MQQA 5DG9A 3C6UA 3CD6S 3WC2A 3MM6A 3UDEA 1R8CA 4B08A 3IN5A 3FBBA 3WX8A 3EDQB 4DEZA 3TZZA 1S0VA 2EK1A 1L3UA 4Q0BB 1KQFB 3A4TA 4K7QA 3HCXA 3Q86A 4C7QA 3GWCA 3A1YG 3FFIB 2HQCA 5G4DA 1QAJA 5IQ6A 3D4JA 3IR7B 1L3SA 3CDEA 1HHSA 3HT0A 3FZBA 5BJRA 5DQGA 4KH1B 2MZTA 2QL7B 3CXCR 3KG1A 2LYVA 4PG7A 3CJ2A 3JQKA 1HWLA 2LQ9A 1UWBA 4HTIA 5E7OB 3H87C 1LWEB 2ZHAA 1XQIA 1R8BA 1U1KA 2QG9B 5J2NA 1N52B 3MCSA 2XMWA 4OZ0A 3R1LA 1D09B 1N5TA 1S1VA 4JI8F 3ZZUA 2ZBQA 2B4OA 5J2QA 4JV5J 3P6YC 4CNYA 1FKPB 5HMXA 1TK5A 5KG5A 5L1IA 4JI1F 4DV1J 1VC5A 2HFVA 1X4HA 3LWLA 2MZSA 4PPZA 3FMBA 3SV3A 4ES3A 4KE5A 2D69A 1PJ7A 2EFGA 2FJEB 1NUEA 3R5DA 4F7VA 5IM0B 1WSRA 4CH1A 5EUHA 1MNTA 4F50A 4EK2A 4DN9A 2UP1A 4QIGA 2CQ4A 2DR7A 1KSPA 3HSDA 4M5JA 3W7BA 1NDPA 3NS5A 3T1YF 2VDHA 2HZCA 2C3MA 5IV4A 1YJ9S 4DDFA 3FEYB 2JH3A 2OELA 3VVTA 4LVOP 4UOCA 2LQBA 2AZ1A 1WELA 5DDOC 2CJQA 3H25A 3PYGA 5H9FK 3RUBL 1RWPB 4K59A 2UVRA 3CVKA 3BYPA 3KMSA 1DTTB 2RMLA 3NXZA 1IBCB 2J9CA 1P94A 1NRKA 1C1BB 4EO8A 3IBCB 2IM1A 2W4PA 1QY7A 4WFZA 1LK5A 2YNHA 2XHCA 3EJMA 2J9EA 5HMWA 4AQYF 2HPUA 3LH2S 1IR1A 3O5TB 1RAIB 4JB8B 3GR1A 4NLWA 2P9GA 3R7NB 4UUWA 3Q8QB 1Y3JA 4OZ5A 2VQFJ 2HQ3A 3WIUA 1DQ9A 4ZVFA 3N5BA 5C2GA 4H54A 3TOQA 1QAYA 4LT6A 3I0RA 4ID8A 3OJUA 3LGMA 2ZKUA 3EVWA 4NLTA 2IJRA 5E3RA 3T3FA 3AY0A 2AP6A 4P2XA 1GEHA 1SKRA 4FS1A 4ED5A 1WG5A 2VF3A 2ZWOA 4ZVHA 4ER8A 2KHCA 1VCTA 4DJBA 1Y10A 3IRXB 1U1PA 1U1OA 2G1HA 4ZVEA 3TR5A 3SEOA 2YNFA 3J80Y 1S9FA 2CFXA 2XMJA 1PCAA 2KFNA 3MAAB 2ZHOA 1KNZA 1KQKA 1B28A 1ZM4A 1IKWA 4OYIA 1RWXB 2RU9A 1RWWB 2VPXB 3C6UB 1N32J 1HWKA 2QLJB 4JUZA 3MM6B 4I67A 3MCNA 1QTMA 2Q6CA 3OL8A 1YGYA 5HMZA 1S7HA 4ANDA 5C25A 1S12A 1TV6A 5F8JA 2OPSB 2YWEA 1CPZA 4DUZJ 1FJ7A 4ZVRB 1HKAA 3UW1A 3HULA 3VTIA 3D0GE 4JI6F 1BHNA 1WNEA 3R1HA 2WBRA 4FF3A 4DX7A 4OYBA 2E9RX 2M7SA 3PFOA 1MU2A 4ZK7M 4FYDA 1GK8A 4I2PA 3GE9A 2YNGB 2FUG9 4DV0F 3KJVA 3M8PB 4IG3A 5KFFA 1UWBB 2EBEA 3FSXA 1R0AA 4RU9A 2KXFA 2XBPA 3I0SA 3FZ2A 2J6SA 2OD4A 3VWSA 5J2NB 4LBIA 1MSWD 1RT4A 1S1VB 1UA0A 1BQNA 4DCPB 3IP0A 1OQ6A 1X8DA 5J2QB 3TUZC 4LFAF 1RK8A 5KT5A 4JV2A 2CPZA 2FZGB 4P10A 1LEOA 2ZKTA 5ETMA 2AHOB 2V8VA 1Y11A 3IAS9 5A8KB 2JFDA 3J7ZT 3HVTB 4OI0A 1U6FA 3CJQA 3NGSA 4JI2J 2OUGA 4RO0A 2DGTA 1D0EA 4GKJJ 2BANA 2QSFA 5LJ5Y 2DGUA 2J8SA 3MUVP 3CCWA 3H2VE 4CI0B 5HMYA 3MMBB 2DGOA 2XMUA 1U2FA 3RW6A 3TEHB 2YQ0A 2HFNA 2MHEA 4PXCA 1R3NA 2BE7D 3QGIA 2RSQA 3PIOQ 1VRUB 2L3MA 2BJ7A 4USMA 3QJPA 1O6XA 3Q8PB 1IN0A 3ZTSA 2AQ4A 2J9DA 5FDLB 1P9YA 4JI4F 5ETOA 7FD1A 3VCDA 1N5VA 3P5TL 4J5OA 1A6LA 1ZS6A 3N9UC 3TJAA 1UA1A 2OPQB 4A8WA 3AOAA 4D8JA 5LXYA 2YNHB 4V19J 1U1RA 3TRGA 4F4ZA 2PSZA 4J7CA 3KJNB 1FXDA 2QYGA 4DS5A 4Y2CA 5HJXA 3V5RA 3AD8C 1AFIA 5CYQA 5B0BA 4WFNQ 1WUUA 4C6AA 1BLUA 2GHVC 3P3DA 4LQ9A 2J0SD 3RB6A 1REGX 3C6TB 5B0AA 2UUCF 3H40A 4ZA1A 1RE1B 4ID5A 1UEUA 3AA8A 1OY9A 2M3DA 3D1OA 1NJWA 3MM5A 1NLAA 2WOMA 2DR9A 2LMIA 2F7VA 5GAGU 4F4YA 3KMQA 4KPCA 2DD8S 1X9WA 2RDJA 1IR0A 1RABB 1UZDA 4I2QA 2YNFB 4P75A 3UFCX 2K2PA 4OHVA 4YB5A 2FJVA 1VBZA 1PILA 5HQMA 3D9BA 1VOMA 2PE8A 4F3OA 4K4UA 3LP1A 4I64A 4PG5A 1C0UB 1V3RA 2WVFA 2FGCA 5F8GA 4UOFA 2HS4A 4ZPDA 3I96A 4EBEA 1FVSA 5C25B 2BM1A 3ZTRA 1R27B 1TV6B 4DZDA 2RT3A 2B5JA 3W5YA 2KFZA 4ECRA 2ZFHA 5F8LA 3SZ2A 1OPIA 5E41A 1CJUA 1XK8A 3ZC4A 5DLGA 4R5PB 1TK8A 2OMLA 4K8RA 4DV4J 5HP1A 1T95A 3Q8VA 5KG0A 1SPBP 1T11A 2H3EB 3A12A 4DBQA 2U1AA 5U47A 5I42A 1YDLA 5KAKA 1MU2B 2GVDB 4I2PB 3JS9A 4FZVA 3DRRA 1NPPA 4DQPA 2VBYA 2W9CB 3E51A 4FYVB 4IG3B 3DDKA 2GIQA 3I0SB 4J9MA 3DMJB 1RT4B 1G2EA 2V94A 1WC0A 2I1RA 3PTWA 5CD4A 5K8PA 2Z2ZA 4F67A 2ZOFA 2K29A 1BAZA 2MSTA 1B0VA 3JSMA 3PYDA 3HMJG
chains in the Genus database with same CATH topology
4D8JA 2CAXA 2K6LA 2WVFA 1MNTA 2FGCA 1ARRA 2HZVA 2K9IA 1Q5VA 2K1OA 4FXEA 2BA3A 2BJ8A 1IRQA 1PARA 2AY0A 1X93A 1B01A 3QSIA 2BNWA 4HV0A 2BJ3A 2JXIA 3VEAA 2WVDA 2BJ1A 2JXGA 1QTGA 3LGHA 1ARQA 3VEBA 3H87C 2WVCA 4ME7E 1BDVA 3BKTA 2BJ9A 3FT7A 3BKUA 1NLAA 2WVEA 2BSQE 2GPEA 1Q5YA 2HZAA 3PHTA 2BJ7A 3GXQA 2BNZA 1MYLA 2RBFA 1MYKA 3QOQA 3FMTA 2Y3YA 2H1OE 2WVBA 2PC6A 3BKFA 2CAJA 2KELA 1U9PA 1P94A 1B28A 1BDTA 1EA4A 2K29A 1BAZA 2K5JA 2CADA 2NZCA 2CA9A 2CPGA 3VW4A 2JXHA 3OD2A 2F1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8J A;  2CAX A;  2K6L A;  2WVF A;  1MNT A;  2FGC A;  1ARR A;  2HZV A;  2K9I A;  1Q5V A;  2K1O A;  4FXE A;  2BA3 A;  2BJ8 A;  1IRQ A;  1PAR A;  2AY0 A;  1X93 A;  1B01 A;  3QSI A;  2BNW A;  4HV0 A;  2BJ3 A;  2JXI A;  3VEA A;  2WVD A;  2BJ1 A;  2JXG A;  1QTG A;  3LGH A;  1ARQ A;  3VEB A;  3H87 C;  2WVC A;  4ME7 E;  1BDV A;  3BKT A;  2BJ9 A;  3FT7 A;  3BKU A;  1NLA A;  2WVE A;  2BSQ E;  2GPE A;  1Q5Y A;  2HZA A;  3PHT A;  2BJ7 A;  3GXQ A;  2BNZ A;  1MYL A;  2RBF A;  1MYK A;  3QOQ A;  3FMT A;  2Y3Y A;  2H1O E;  2WVB A;  2PC6 A;  3BKF A;  2CAJ A;  2KEL A;  1U9P A;  1P94 A;  1B28 A;  1BDT A;  1EA4 A;  2K29 A;  1BAZ A;  2K5J A;  2CAD A;  2NZC A;  2CA9 A;  2CPG A;  3VW4 A;  2JXH A;  3OD2 A;  2F1F A; 
#chains in the Genus database with same CATH topology
 2XMM A;  1MWZ A;  9RUB A;  1UKU A;  4K2X A;  5JXS A;  1NK4 A;  4IRK A;  2AGO A;  2NCK L;  4FVC A;  1K1Q A;  2F4V F;  4ZCI A;  3M8Q A;  4URS A;  3UR0 A;  2BKN A;  3QZ8 A;  2AY0 A;  1WWH A;  2HVI A;  1UJ6 A;  4KBI A;  2V5H G;  2ILZ A;  3I56 S;  4BS2 A;  2RIJ A;  5DDR C;  1YRT A;  2FZK B;  3BDP A;  1RAA B;  1EJ7 L;  3R8Y A;  2BAN B;  2WVC A;  1JKH B;  1ZAX A;  3PEJ A;  2IVY A;  4LSL B;  1Y5N B;  4H4K A;  2BAC A;  2EG1 A;  5FII A;  1S6Q A;  5KOW A;  3OR2 A;  2HK2 A;  3C46 A;  1RQ0 A;  2QC3 A;  4GC7 A;  1HHT P;  2EXU A;  3ZFV A;  4BC9 A;  5K14 A;  1NPR A;  2B8Q A;  3LOU A;  3NAI A;  1HR0 J;  2ZM6 F;  4EBC A;  3CJ0 A;  1GH8 A;  3Q22 A;  1VYA A;  4LF9 J;  1JQG A;  1T0T V;  4JOU A;  4NCB A;  4DPW A;  2JEG A;  3AA9 A;  3EUN A;  4OYZ A;  3HKW A;  1K47 A;  3TX0 A;  1JJ2 R;  1ACM B;  2YTC A;  3AOC A;  1P8G A;  3R9L A;  5A76 A;  3H4B A;  1WF1 A;  5J2M A;  4RNN A;  1VLY A;  3RR8 A;  1GX5 A;  1DZ5 A;  4J37 A;  1EP4 A;  1L5U A;  2VBW A;  1NKC A;  5DRK A;  4CLY A;  4CM2 A;  3CTR A;  3SIP B;  5JMN A;  1AB8 A;  4B9S A;  2GQC A;  3J7A 1;  2R8G A;  2JXG A;  2NQP A;  3UVJ A;  4B3S F;  2Y9H A;  5CYQ B;  4LFC J;  5DDP C;  2X1A A;  4ZIW A;  3PZP A;  1WOO A;  2COL A;  3SDE B;  1J5O A;  2HLU A;  4DQS A;  3G6X A;  1RT7 A;  1JXL A;  4HHH A;  2G2O A;  4NI2 B;  1UFK A;  4KAI A;  1FES A;  3MM5 B;  1HPZ A;  3V6K A;  4R8U A;  2FYX A;  1FF2 A;  2YY3 A;  2WSF C;  1NAQ A;  3MFH A;  2H51 B;  3NLC A;  4IOA Q;  1FO1 A;  4Z7Y A;  3QO9 A;  4ZVS B;  4USJ C;  4ECV A;  4JV5 F;  4I2Q B;  4CLS A;  4LF5 J;  3UO0 A;  5C2C A;  4Y34 A;  5A6P A;  4NYP A;  4RUA A;  2KJW A;  1QDU B;  3HO1 A;  2N82 B;  5A8R B;  1X5T A;  2XWY A;  1C0T A;  3FJ2 A;  4DV2 J;  2FJW A;  1HBM B;  2EVZ A;  3CCR S;  3I87 A;  2GQ2 A;  2H3A A;  2CNK B;  2ZDP A;  4IOB A;  2B5J B;  4CDI A;  2FGO A;  3MMC B;  2K1R A;  5A0Y B;  2UVU A;  1C2P A;  1F9E B;  2IBK A;  5CZV A;  1N48 A;  5HP1 B;  3W5Z A;  4TLR A;  1YJV A;  2KTQ A;  3SFU A;  1SBR A;  2V68 A;  1VQY A;  2M4M A;  1X4G A;  4USW A;  3EXC X;  2C2M B;  4AE5 A;  4LQ3 A;  1X0F A;  1Q8I A;  3EIC A;  3SMZ A;  3KLG B;  4DSK A;  1T05 A;  4DHV A;  5CQG A;  5RUB A;  2HMI A;  5KFG A;  5B7W A;  1NZA A;  4B9N A;  2NZC A;  2C2N A;  4PXE A;  2FPH X;  2HNY A;  1QSL A;  2E7V A;  2DHG A;  3KFW X;  5AXL A;  2ZBP A;  4L3N A;  1Q79 A;  2QFI A;  3O44 A;  1VIO A;  2KO1 A;  4J9L A;  4K4T A;  2I0X A;  2I5J A;  1JLC B;  4YS2 A;  1ZA2 B;  3GJT B;  3H42 A;  2WSE C;  3W2W A;  3QRQ A;  2Z2L A;  3SI8 A;  2FY1 A;  2HAF A;  1QTG A;  4I6Y A;  4TXS A;  2L9N A;  2W7P A;  1FDA A;  4S0M A;  4ZP7 A;  1BWE A;  1BWV A;  3DLK A;  4Y2K A;  4CRJ A;  2DHH A;  5IOL A;  3VAM A;  2O01 C;  3BGO P;  3C66 A;  2AD9 A;  4EFA C;  4B3M J;  2GC8 A;  1S6Q B;  3OR2 B;  4A48 A;  3NNH A;  1FHT A;  2AJ1 A;  2W01 A;  4NXM F;  5K14 B;  2DPJ A;  3SBM A;  2EFQ A;  2ROG A;  3KK1 A;  2V0N A;  1V3Z A;  2CRL A;  4NMX A;  3PM9 A;  3Q8Y A;  1OHN A;  3BSO A;  1QVF R;  1EHW A;  3PR5 B;  2V8D A;  3GLJ A;  3DYA A;  2E7W A;  1N32 F;  1SJQ A;  4E98 A;  3VQT A;  5J2M B;  4PQU A;  1JK9 B;  3P8B B;  1PGZ A;  1IKX B;  3D2W A;  5LMU J;  2YH0 A;  1SC4 B;  3BQ1 A;  2CJY B;  2Q79 A;  4KRW A;  2HWH A;  2XZW A;  4L72 B;  4DUZ F;  1EP4 B;  4HR2 A;  3UE2 A;  2AEF A;  2YX4 A;  2OP5 A;  3J7Y I;  2E5J A;  2V63 A;  1RTD A;  1CQM A;  4U8V A;  2AEM A;  3UVJ B;  3VV2 B;  2XCP A;  1TL1 A;  3M8R A;  3BQ2 A;  1J5O B;  2DNP A;  3CE8 A;  1RT7 B;  4L3K A;  1TL7 A;  4WFX A;  3M1V A;  3MHY A;  3UI3 A;  2VG5 A;  2HEK A;  4O3R A;  1NHV A;  1ARO P;  3FCW A;  2D9O A;  3M9O B;  2CQI A;  5IFM A;  4XDC A;  2B4V A;  2E9T A;  3PYF A;  1YJT A;  4WKY A;  2YWF A;  4ETX A;  3BV8 A;  1SIZ A;  1N0V C;  3QO9 B;  4ERD A;  4F02 A;  4O3N A;  3MPW A;  4J9V A;  4OYP A;  3W66 A;  4B3O B;  1XTZ A;  1X4F A;  4NLG A;  1HNI A;  1FT8 A;  4YB6 A;  1RT2 A;  4C8N A;  4NLP A;  2ERR A;  1VJQ A;  1TVR B;  4M5K A;  3AJD A;  5LL6 d;  3D6M B;  2G0C A;  3L7O A;  4HLB A;  3F0N A;  2F3J A;  1C0T B;  5HVH A;  1Q8L A;  1O0P A;  4ZP8 A;  2CUY A;  3HDS A;  2MJU A;  3GJQ B;  2Y1J A;  4A8S A;  5LXR A;  3F73 A;  2FTR A;  3C3L A;  1DRZ A;  4F0K A;  1QSY A;  3HFZ B;  3EZO A;  4NYZ A;  3HK2 A;  4A8M P;  4AXJ A;  2K1R B;  1TKT A;  4DSL A;  2BOA A;  4GKJ F;  3BR8 A;  1WI8 A;  3LAM A;  1U09 A;  2RF2 B;  1MN9 A;  2ALY B;  3M8W A;  3SCL E;  5EX3 A;  2BR0 A;  1N8R T;  1X5P A;  2BE9 B;  3ETM A;  4NLV A;  1OWX A;  2IC3 A;  1VC0 A;  1H2T Z;  4EI2 A;  3EVO A;  3H98 A;  1SUQ A;  1T05 B;  1SKW A;  3ULH A;  1VQL S;  2CA9 A;  2HMI B;  2VV5 A;  3OD2 A;  2CJA A;  3HHL D;  3PDN A;  5HAO A;  2B3T B;  3JAM Y;  1M5P C;  2FHK A;  2A0F B;  4WP3 A;  3MMA A;  2RDD A;  3CCQ S;  1S1W A;  3AB4 B;  3UQS A;  5IT9 Y;  4IUF A;  4RW6 A;  3H8Y A;  2ZH1 A;  4DPY A;  4ENO A;  1EZZ B;  1JB0 C;  3MEE A;  4IRD A;  4X2B A;  4C0H A;  2I5J B;  3CDU A;  4LSN B;  1FKA F;  4JYA J;  4U7U K;  3W2W B;  3D68 A;  2DH7 A;  2RQC A;  4QW8 A;  4PAB A;  4X4P A;  1WJ9 A;  4MKY A;  4PG8 A;  1SJ3 P;  1NB2 A;  4HAC B;  3BSA A;  2VU5 A;  1RKI A;  3DLK B;  1GXT A;  4B17 A;  3CDA A;  4NLQ A;  3LPY A;  3G8S A;  3SYZ A;  2WON A;  4OHW A;  3QWU A;  3KHG A;  3C19 A;  3KNA A;  1RHK B;  1N34 J;  1TKX A;  3LAN A;  4DU8 A;  1Q16 B;  2K5J A;  2IFX A;  4QQB A;  3UCU P;  3IR5 B;  1ZM3 A;  3VQS A;  5LMN J;  3D6H B;  5AE2 A;  1RT3 B;  1LWF B;  3KK1 B;  2DH8 A;  3E01 B;  4USI A;  3DRS A;  4DLG A;  2KB2 A;  3GPA A;  1FWL A;  1ARR A;  1X60 A;  1BGX T;  4C3K A;  2EFP A;  4ZLP A;  2VH7 A;  4OX6 A;  1VQ7 S;  3QIP A;  1N5Q A;  1HWJ A;  4CIO A;  1Y4Z B;  1NK5 A;  1YVF A;  2DNH A;  3R6G B;  4QJV A;  5E33 A;  2ZZT A;  3IWL A;  4YN3 B;  1J2V A;  4PYA A;  3D7S B;  1ZAV A;  2ATL A;  1RHM B;  2AU0 A;  5K8N A;  3G87 A;  4DUT A;  5CAA A;  4DG1 A;  3QAE A;  2FJA B;  3MPY A;  3GMG A;  4H4K C;  1N56 A;  4ZVT B;  2QEX S;  1RTD B;  5KG1 A;  3KYL A;  3SSR A;  2Q43 A;  3TA2 A;  1FA0 A;  1TL1 B;  2B4P A;  4RL1 A;  2JVO A;  3I5C A;  3O1L A;  4KKO A;  5HRO A;  4X65 J;  2KG1 A;  1S4E A;  2BX6 A;  1TL7 B;  1YBU A;  4IYQ A;  4ZIV A;  1BDT A;  2B43 A;  2GAH C;  4WFY A;  2VG5 B;  4PR6 A;  2XYG B;  1W2I A;  2OEJ A;  1RWK B;  3HX9 A;  4X4V A;  3K89 A;  4O4G A;  1SJF A;  4P7T A;  4ZS6 A;  5F8H A;  2DXE A;  2HRT A;  3D3C J;  4WFA Q;  2CPX A;  4RNM A;  1WSV A;  1JXE A;  3PVX A;  1MRO B;  1AZS B;  2VFV A;  2A1B A;  2JFK A;  1FDB A;  1YKW A;  3HZG A;  3A8E A;  2QLX A;  2OTL S;  1KS2 A;  2ZBC A;  1D9D A;  3ZZ0 A;  4KY3 A;  4IG0 A;  4U95 A;  2KJV A;  1OO0 B;  2QL5 B;  3I5A A;  4OI4 A;  3O2I A;  1VQM S;  3FRY A;  3GZ7 A;  3BB5 A;  1NSA A;  2AWZ A;  2HIY A;  1OS5 A;  4GKK J;  3VHQ A;  4DQQ A;  1VQP S;  2OSQ A;  3HI9 A;  3RBE A;  1PBA A;  4AUK A;  1FX2 A;  3P5B P;  4ZCK A;  3HSZ A;  3KLF B;  1VR6 A;  2VPY B;  3BGR A;  4MKB A;  2AT1 B;  3CCV S;  1NJY A;  1FRL A;  3DDN A;  2ZH8 A;  4HEA 9;  2MPU A;  3W9H A;  3J7Z 5;  1NB7 A;  1U45 A;  1FWK A;  2VC1 A;  3R5B A;  3W1Y C;  1S1T A;  2W2Q P;  3M8Y A;  4A8K A;  1WKL A;  1M5O C;  5LSL A;  2IC3 B;  3LP0 B;  4JI5 J;  3T1H J;  3NNC A;  3M05 A;  3QRP A;  1S0N A;  4PWD A;  2F8H A;  3BSC A;  3DC2 A;  3D54 A;  2WBM A;  1U2C A;  1TEL A;  3MMA B;  5DM7 Q;  1Q5V A;  3QBC A;  2ZH9 A;  3D66 A;  2DRD A;  2YNI A;  3PEH A;  4CLK A;  2V9W A;  4RW6 B;  1UEV A;  2MZJ A;  3MEE B;  5D3G A;  3QGH A;  4P2M A;  2Y1L B;  4X64 J;  2E1A A;  4HI2 A;  1H72 C;  1GFW B;  1N33 J;  3BKT A;  3BPS P;  4ZN1 A;  2Z58 B;  2KM8 C;  3FT7 A;  1SQF A;  2AX1 A;  3ZTQ A;  3WQP A;  5ETV A;  1HBO A;  3Q83 A;  1R8A A;  5J2P A;  1M1G A;  1VBX A;  2Z0G A;  1Z2Z A;  3R3T A;  1VHF A;  2CQ0 A;  2QIF A;  1DQ8 A;  1NHU A;  4WBF A;  2QTW A;  4LFC F;  3M2R A;  3TVZ A;  3OL6 A;  4QCL A;  2XYH B;  1O51 A;  2KEL A;  2UXB J;  5ETT A;  1HYS B;  3M2U A;  1XNR J;  1KON A;  1XNQ J;  4O0N A;  2GX8 A;  1V5I B;  1FNX H;  1PIE A;  2E5I A;  2GIF A;  4ELV A;  1HIY A;  4URG A;  1UL3 A;  1FFW B;  3OTB A;  4J9O A;  3OTO J;  4BC7 A;  1KP6 A;  4OJ1 A;  4LF5 F;  3TW0 A;  2QMX A;  3PFE A;  3MPU B;  3ONQ A;  4AXI A;  3IXQ A;  3Q8R B;  1IM4 A;  2ASY A;  4P52 A;  2XLJ A;  2DY9 A;  4Q45 A;  3QT5 A;  1VRT A;  4DV2 F;  1OQ3 A;  1RZM A;  2QE5 A;  1ZTT A;  2OGU A;  3POT A;  3OHA A;  4JV1 A;  4MIA A;  1UFW A;  5KFE A;  3GON A;  2DHA A;  2D41 A;  2YWW A;  4B9M A;  1C4A A;  1H7X A;  4FYW B;  1Q78 A;  4NA2 A;  3NOG A;  1U8S A;  1PKU A;  4C4W A;  3ENQ A;  2RDI A;  2IM0 A;  4JBC A;  3BS9 A;  4F3M A;  4AYB D;  3KLV A;  6AT1 B;  3ICL A;  3D67 A;  2NYH A;  1ELO A;  3VAJ A;  2IIH A;  2ZOM A;  2J0Q D;  3BR9 A;  3RBD A;  1APS A;  4EYI B;  2J0X A;  3WBZ A;  2V4R A;  2UUT A;  2ZH5 A;  1S77 D;  2XO6 A;  5I4M A;  3ZNU A;  3HHE A;  3PG9 A;  2JX2 A;  1EQM A;  3SFG A;  1PAR A;  2HS0 A;  5CH7 B;  4U6P A;  2CQB A;  4FXV A;  3MAQ A;  1YG0 A;  1KTQ A;  4DV5 J;  3IG1 A;  3AD9 C;  4K5R A;  1J5E J;  4HVZ A;  2W9B B;  4X66 F;  1OPZ A;  2KOE A;  2XYP B;  4I1T A;  4ZLJ A;  2DTJ A;  3BN7 A;  4OZJ A;  2CQC A;  1U48 A;  1WHY A;  1E6Y B;  3CT9 A;  3KLE A;  1R6Y A;  2MXY A;  4YB1 P;  3ET6 B;  2DR6 A;  2IVF B;  1WC1 A;  3BGU A;  5KFZ A;  2B7C B;  2DEI A;  2VG7 A;  1PJ6 A;  2PO4 A;  1G7C B;  4C8Z A;  4I7F A;  3BGR B;  2IVM A;  4DR4 J;  4CLW A;  5KG2 A;  4FXD A;  4QWC A;  2RQK A;  3B4D A;  2FB0 A;  3HHN B;  4B3M F;  2FVQ A;  5GAE U;  4OL8 A;  1NME B;  3TJ9 A;  1U6Z A;  1S1T B;  2PFF B;  1LXN A;  5ADZ A;  4CTA A;  1RUS A;  4LF7 J;  4WU3 A;  1V9O A;  1IXK A;  2BW7 A;  5L1L A;  2ZIT A;  5K9F A;  4N56 A;  2IAJ A;  3G8T A;  2FIU A;  2ZE2 A;  1RT1 B;  2Y1I A;  5IC6 B;  2BJ3 A;  2R7W A;  2XTJ P;  2R7U A;  6FDR A;  1IKV A;  1KR4 A;  1P1T A;  4KGM A;  4OJH A;  2YNI B;  3PHE A;  2AGQ A;  3GP9 A;  1PBU A;  2ZD1 A;  4ZJL A;  4IR9 A;  2R7R A;  3MI7 X;  5D3G B;  1RSC A;  2PEB A;  4C3L A;  3G6E S;  1NK0 A;  4ETZ A;  2GHW A;  4IQM A;  1NCL A;  3N01 A;  2RRA A;  1T8E A;  2NUU G;  3CCL S;  1IKY B;  2L48 A;  2E7X A;  1LWC A;  1YIT S;  1HBO B;  5J2P B;  5IT4 A;  2RHQ B;  4PCQ A;  3PO4 A;  4RW8 B;  1S97 A;  3PJ9 A;  1JNZ B;  3R6L B;  3FEX B;  1YJR A;  1HNV B;  4HL9 A;  2LDI A;  2D7S A;  3DHX A;  4FKY A;  1BXN A;  1TL5 A;  3RAX A;  3G71 S;  4USU A;  1CJT A;  4CO5 A;  1S1U A;  1NHK L;  5CYM A;  2EFO A;  1WDT A;  2QA4 S;  1MMN A;  4RW9 B;  4NA1 A;  3MMJ A;  1XMB A;  2HFO A;  1XIQ A;  1ZYQ A;  4ZIT A;  5HVF A;  3IM9 A;  1FE0 A;  2C3O A;  3RZA A;  4C8M A;  5DQI A;  2HW3 A;  1F3F A;  1WC3 A;  1UP1 A;  4DX5 A;  1S76 D;  3KJF B;  2OIH A;  3AOB A;  1UVJ A;  2VBX A;  4FYX B;  4TN2 A;  1OSD A;  4AL5 A;  5D77 A;  3VZH A;  4C0O C;  1K1S A;  2EFN A;  5L1J A;  2M0G B;  5FD1 A;  2HVH A;  2WAQ D;  4RNO A;  4QWA A;  2V69 A;  1VRT B;  2WVE A;  5HJY A;  2E9Z A;  3U7J A;  2YKO A;  4OLP A;  2F5G A;  5HLF A;  4QYZ K;  1FDN A;  4QWD A;  1G4C A;  3HPO A;  2Y0B B;  1AXQ A;  2YKM A;  4NA3 A;  2XSF A;  1JLB B;  4WKR A;  4F36 A;  1NEE A;  2FDN A;  3C15 A;  4N8O A;  3OBI A;  3J81 U;  4E0D A;  2HK3 A;  2BJE A;  2F1F A;  3MOZ A;  4M5I A;  3NOC A;  1W2B R;  2R7S A;  3DXS X;  2HGL A;  2NYI A;  3OR1 B;  2DB1 A;  1SC6 A;  5IWA J;  1KTV A;  2LXF A;  4FXE A;  5KFM A;  3M4X A;  3L4B C;  3K5M A;  3QMQ A;  2R8H A;  1PAU B;  3UD4 P;  2HG4 A;  5D0R A;  4WTY A;  3IG1 B;  3J81 j;  3Q24 A;  2XB2 D;  5KFI A;  3MWB A;  1U25 A;  1N54 B;  2ILY A;  1DY3 A;  4EZ6 A;  2BQR A;  2X3D A;  4UZB A;  3KLE B;  4DX6 A;  3TZY A;  2Q1L A;  2CJB A;  3KK3 A;  3K59 A;  3S01 A;  2E1M C;  4I68 A;  4EO6 A;  1S4F A;  2DO4 A;  1F3V A;  2EK6 A;  1QE1 A;  2A2B A;  3AXM A;  3VF0 B;  2HBY B;  2M5Y A;  1GMW A;  4CWB A;  3P4U B;  1RAO A;  2ZUA A;  3VGS A;  4RBT A;  1GT8 A;  1WC4 A;  3W2V A;  2YXL A;  4QOT A;  3OT9 A;  1KFD A;  4CTA B;  2CVI A;  1C1C A;  3IO1 A;  3TYT A;  3MFI A;  1U2R A;  1NK9 A;  2P8I A;  2IAJ B;  1OG7 A;  5F8N A;  2JJ4 D;  4DL3 A;  1K73 T;  1SH2 A;  1A7G E;  3GU0 A;  3M30 B;  4DX8 H;  2XI2 A;  1XER A;  3TAR A;  4Q7A A;  3CJK B;  7AT1 B;  5HBM A;  4CZC A;  1S1X B;  3TUJ C;  4XDD A;  4AFF A;  3RB0 A;  3H2L A;  1F2H A;  1GMU A;  1XR5 A;  4B3T J;  1NXI A;  2GQQ A;  4MYT A;  3QWP A;  1TR0 A;  3N79 A;  3D0H E;  3KWM A;  2VJU A;  4R0E A;  1HW8 A;  1RXO B;  1FVQ A;  3T5H A;  1KKH A;  4C0B A;  3A3O B;  5EWG A;  1RWM B;  4FXW A;  1LWC B;  1HI1 A;  2DH9 A;  5E3P A;  3IR6 B;  2OO4 A;  5D4L A;  1R7I A;  3KHH A;  4DR2 J;  2AX0 A;  2FLP A;  1T03 A;  2W25 A;  5ITH A;  4X84 A;  1GXL A;  3HZE A;  1I94 J;  2HVD A;  2PI4 A;  3FUY A;  1TKZ A;  5D0H A;  4N5S A;  2P5V A;  3CCU S;  2ZVS A;  3K5P A;  2YKA A;  1K0T A;  4F0H A;  2QA1 A;  1TFW A;  1KN6 A;  3UNY A;  1EET B;  3HVR A;  4JV0 A;  4ZLL A;  1Q4R A;  2KXH A;  3EGN A;  3E2E A;  2AYG A;  1KVK A;  3QT8 A;  4P72 A;  1RWU A;  2EBG A;  1ARQ A;  5F0W A;  5C42 A;  2ZEJ A;  2BXJ A;  4N77 A;  3W61 A;  4ZDN A;  2BJD A;  4DFP A;  2V8H A;  4AD6 A;  5M2U A;  3D6F B;  4G6V B;  4QIF A;  1HMV A;  1UCN A;  1VIX A;  3GCX P;  5I3Q A;  4N41 A;  2A10 A;  3MM9 A;  4F25 A;  3MR5 A;  3FNN A;  2CDR B;  3QID A;  1HD0 A;  4U7C A;  2RKI B;  5HO4 A;  4GKK F;  2A2D A;  3FFI A;  5DZ7 A;  2CAJ A;  3J7Y U;  2CNO B;  1WEX A;  2OLW A;  2CAD A;  2YKM B;  3A13 A;  4MK7 A;  2HFZ A;  4ED3 A;  3CMA S;  5D78 A;  1M1H A;  2D3O R;  1NKE A;  4DCJ B;  4NML A;  3V4I A;  4LRD A;  1YSJ A;  2NR0 A;  3HFK A;  3OFG A;  2X7I A;  5H9E J;  2KKE A;  3THP A;  2GGP A;  2JXI A;  4F4X A;  1FKP A;  1NSP A;  3TVY A;  3M6V A;  5AXM A;  1ITP A;  4ZVQ B;  1T9V A;  2M70 A;  3LUY A;  1HNW J;  2BA9 A;  4NZ6 A;  5HN0 A;  3OL9 A;  1G3O A;  2QMW A;  3B6B A;  2KVQ E;  3LW5 C;  5AXN A;  2UUW A;  2YWG A;  3AB2 B;  4K4W A;  4HDH A;  4ZPA A;  3L09 A;  4K4X A;  2C2E A;  4C2M A;  2H54 B;  3BGL A;  3QT6 A;  4ZCL A;  2NZ4 A;  4DV7 J;  4CCH A;  3ENA A;  1MNE A;  2HFS A;  3QFH A;  3KK3 B;  4UT4 A;  2L08 A;  2FY8 A;  2YX7 A;  4YR2 A;  1ZZF A;  3LF0 A;  4F2S A;  1UW4 A;  5LT5 A;  1QE1 B;  3R7B B;  2YX1 A;  2RU3 A;  4QR2 A;  3NGT A;  2R42 A;  2MHN A;  3UN5 A;  4F3Q A;  1QAI A;  2W7O A;  4X4U A;  2RS8 A;  3E8O A;  1XNR F;  4DFJ A;  4IR1 A;  1XNQ F;  4P2F A;  3OHB A;  3MXH P;  2LA4 A;  4IQX A;  4QR0 A;  2ATC B;  3W8P A;  1C1C B;  2E5L J;  2NRE A;  2WB1 D;  4LBH A;  1E6V A;  3ZZP A;  1R0B G;  1DTT A;  1UAW A;  2HHH J;  4XPC A;  5ETS A;  9ATC B;  2R2S A;  3TEG A;  4X4N A;  4URQ U;  1C1B A;  4XO0 A;  3DDI A;  5HBM B;  1RA6 A;  1Z1Z A;  5F8M A;  2HZA A;  1RHQ B;  2OPP B;  3BO3 A;  2DCL A;  2DRA A;  2FLO A;  1NO8 A;  4AT1 B;  1T94 A;  5D0E A;  2MKS A;  4NEZ A;  1PYT A;  2XMV A;  3R27 A;  4ECS A;  4DN0 A;  1RT6 A;  2QMU B;  3PCO B;  1YJ7 A;  2CZ9 A;  4BBY A;  3LJP A;  1IBM F;  2HVE A;  5KTQ A;  2QLF B;  3MEG A;  3DM2 B;  5KFT A;  1WAC A;  1FD8 A;  1SCJ B;  3AOD A;  3KLH B;  3SCI E;  3VVU A;  3MM7 A;  3QPI A;  3PJW A;  1CSJ A;  2HHX A;  3GIJ A;  1Z2L A;  3IRX A;  3OXG A;  2ASL A;  1W7W A;  3OW2 R;  3WZ0 A;  3BQ0 A;  5H9F J;  3CJT A;  3N6M A;  3LGH A;  3OQ2 A;  1NK6 A;  3PRB A;  2HWI A;  3ZTO A;  2XO7 A;  3MEK A;  2G0I A;  1CVJ A;  1VQO S;  1H7W A;  1NSQ A;  4DR1 F;  5L46 A;  2VL1 A;  1MWQ A;  5C42 B;  4DV5 F;  1GAO A;  3BO2 A;  3M6X A;  1J5E F;  1LXJ A;  4HT5 A;  2J6T A;  1MYL A;  2OPS A;  1HMV B;  5KFN A;  2ZH7 A;  1H3D A;  3G2X A;  2AJQ A;  3MM9 B;  4OI3 A;  4O3Q A;  3LPE A;  5J1P A;  2IMW P;  1KLN A;  2JEF A;  3PKY A;  1RYR A;  2DY1 A;  1R89 A;  5BR8 J;  2AYB A;  2B8P A;  2XHW A;  1H0H B;  3DLE B;  4DL0 C;  4CLU A;  4WJB A;  2F65 A;  1X4C A;  2DR8 A;  4O44 B;  2CAX A;  1S7I A;  1HBN A;  2YNG A;  3DU5 A;  1WI6 A;  1NZ8 A;  3OSN A;  3GV5 B;  2RE1 A;  3M8P A;  2ZH6 A;  3V4I B;  1X9S A;  2HUR A;  4WPA A;  2XC9 A;  1YK9 A;  4DZ6 A;  2UXC J;  5DG8 A;  3V6J A;  4LF7 F;  1BMQ B;  2V4J A;  1FJE B;  2V2Z A;  4FS2 A;  2V2K A;  1WTB A;  2JDJ A;  3NGU A;  2GGP B;  3DCA A;  4FKX A;  3KNG A;  2NPI A;  4D3G A;  4WYL A;  4QIW D;  2VFU A;  4LF4 F;  2YQ1 A;  3AQP A;  2GS8 A;  1S9E B;  2XEX A;  5A8K A;  2R8I A;  4WZM A;  3HD2 A;  2FVP A;  3JYT B;  1N36 J;  3HVT A;  4DMZ A;  1PAE X;  3DOM B;  1T7P A;  3G86 A;  2BRL A;  3CDW A;  1CC7 A;  2Y8W A;  4BLG A;  2RRB A;  3NP5 A;  3WHI A;  3US5 A;  3KK2 A;  1WC6 A;  3OXF A;  2XS7 A;  2OSR A;  3K7R A;  2Z2Y B;  2XMK A;  5L1K A;  2K06 A;  5HI7 A;  3MMB A;  2X1B A;  3QNW B;  3FSY A;  1A0O B;  1FTR A;  2CKW A;  2F9J A;  3RBZ A;  1KEK A;  1CJV B;  1VRU A;  2CG8 A;  4WIQ A;  1JWW A;  3KUG A;  4CM0 A;  2O3D A;  2HAI A;  5CD4 H;  2ADC A;  2BJ1 A;  3EVM A;  2KZZ A;  3TVK A;  5FDL A;  3PV8 A;  1E6V B;  4O0I A;  4OYW A;  1S10 A;  4ICL A;  4B9L A;  3GCW P;  1NDK A;  4YOE A;  1MLA A;  2XNR A;  1RIS A;  2OPQ A;  4C48 A;  3L3C A;  2ZBI A;  4ZP6 A;  4DWI A;  4WFB Q;  1K0V A;  1ULR A;  4LRF A;  1RTZ A;  2HNZ A;  1U1L A;  2R7Q A;  2O5D A;  3GYG A;  2HRU A;  1EA4 A;  4DR3 J;  2EFV A;  2HVZ A;  3DLL Q;  4FPR A;  3AQO A;  2FHJ D;  4OLO A;  3PRV A;  4EWT A;  1RT6 B;  1IBK J;  1XBW A;  5SZT A;  2PEH A;  2RUS A;  1TK0 A;  1FRM A;  3J7A N;  2BYC A;  4O3O A;  2ASD A;  4JI7 J;  3C6T A;  2W2M P;  2MQP A;  2YKN A;  1SL2 A;  2V67 A;  3MEG B;  3R5G A;  3AD7 C;  2JEI A;  4ZPC A;  2BNW A;  3T9N A;  3MM7 B;  3CCJ S;  3OPK A;  4TKT A;  3RAQ A;  4NLU A;  3O6Q A;  3CED A;  3M7V A;  2PFD A;  2R7T A;  2BW2 A;  3BSN A;  4YY3 F;  3S8S A;  4J9Q A;  2B6A A;  1L3K A;  4JI8 J;  2MKI A;  1Q53 A;  1BQM B;  1C0U A;  1X7V A;  1TAQ A;  4ZLN A;  2VFR A;  3TP2 A;  1YQH A;  3IA0 A;  3BH6 B;  4CLT A;  3C2P A;  2MDA A;  2PA8 D;  1LW0 B;  3FK4 A;  5AJ3 J;  3L9Z A;  1Q81 T;  3D28 A;  1VHI A;  2MKY A;  3NG8 A;  4R5P A;  4RJV A;  2VG6 A;  2K7K A;  4P6Q A;  3RYL A;  2CPF A;  3CDB A;  5A2Q U;  1X5O A;  2K6L A;  2KI2 A;  3FKB A;  2GVD A;  3RRG A;  1HBN B;  2W9C A;  2DO0 A;  3T1Y J;  2J5A A;  2PT0 A;  3IC1 A;  4LRC A;  4DL2 A;  1ZZN A;  3C14 A;  2DGX A;  3DMJ A;  2CIM A;  2HIQ A;  1IWA A;  2V4J B;  4LFB J;  3X1L B;  5BYR A;  1B64 A;  2I2Y A;  1XR7 A;  4TU8 A;  3GFX A;  4X62 J;  3UN3 A;  2J8A A;  1YIJ S;  2EC0 A;  4G3I A;  2LQJ A;  3TAQ A;  3ELH A;  1RU2 A;  2X1G A;  4TY8 B;  1UET A;  3LWM A;  2QJ3 A;  4PQA A;  4X4T A;  3ZXW A;  1HFE L;  2MQL A;  3I4H X;  4J9P A;  4RW4 B;  2F63 A;  1WDD A;  4C3M A;  2G1D A;  4MMO A;  3NNA A;  2PDA A;  3MEC B;  2BKP A;  1YRU A;  2OEM A;  4ELU A;  4DF8 A;  2V4Q A;  4ZN3 A;  4QPX A;  3TQE A;  1JKH A;  4F0M A;  3KK2 B;  4JI3 F;  1NH8 A;  4LSL A;  4KH0 B;  4J90 A;  4DR2 F;  1V6H A;  2GVZ A;  4KGX B;  4M5D A;  4E2F B;  1ZM9 A;  2LEC A;  1ZBT A;  1BD6 A;  4ED1 A;  1I94 F;  2UVW A;  2AGP A;  3DOL B;  3V6D A;  3AHP A;  4L75 A;  2YBV A;  4DS4 A;  3IM8 A;  2IDL A;  2MQM A;  1KHW A;  3FBC A;  1R6V A;  4ICL B;  3BO4 A;  4CH0 S;  1S5Z A;  3AFG A;  4UOH A;  4PKD B;  1QUV A;  5IT0 A;  1RBA A;  3UDL A;  1X4E A;  1TKD A;  3CD0 A;  2FD2 A;  3ZTP A;  4WP8 A;  4K4S A;  5KFP A;  1B70 B;  2MLY A;  3ENW A;  4HHU A;  3FQK A;  1TMJ A;  2HNZ B;  4EUV A;  1UVM A;  3G6V A;  3OXL A;  1YHQ S;  4FPI A;  4OHZ A;  5DLF A;  4GO5 X;  1I51 B;  4MIW A;  1N6Q A;  3SDE A;  2KG0 A;  1KHV A;  1K44 A;  3EZU A;  2CG4 A;  4KO0 A;  1OIA A;  4JI6 J;  4NI2 A;  1FXL A;  1IRQ A;  2YKN B;  2QX0 A;  3MED A;  2RIL A;  2HKE A;  3TI0 A;  1Y5I B;  3GR0 A;  4ZCM A;  4W92 B;  2PMW A;  2OFH X;  4NCA A;  2D3Z A;  2Z2M A;  2J0W A;  5JVH Q;  3RB4 A;  3RRK A;  2CNL B;  8RUC A;  4EBD A;  2B6A B;  1HNW F;  3G6Y A;  5A8R A;  3H5U A;  3I6P A;  3M6U A;  5B0E A;  4AL7 A;  4ZPW R;  1HBM A;  2QL9 B;  2UUB J;  4LFA J;  1GX6 A;  4C8O A;  2OMO A;  2ZH2 A;  4NRU A;  3T41 A;  1XC9 A;  2I38 A;  1HQE B;  4ZPB A;  3MMC A;  3TX8 A;  5A0Y A;  1AUD A;  3VGT A;  2DR5 A;  3IWN C;  4AAI A;  1JX4 A;  3D1H A;  3K5O A;  3EX7 B;  2VG6 B;  2C42 A;  2AEJ A;  1U0H B;  2MZ1 A;  3V4M A;  5GAE I;  3QRR A;  1UZH A;  1HNX J;  3KLG A;  2GML A;  4IFV B;  2RHS B;  2UU9 J;  4FVM A;  3C14 B;  3DLH A;  4OFZ A;  3TO8 A;  3QGP A;  5T14 A;  4IH5 A;  5F9L A;  2JLG A;  3TUI C;  3KJQ B;  2E5L F;  2ZDO A;  4OYO A;  2VKZ G;  4OYM A;  2DIT A;  2ZVI A;  1IJF B;  3DI6 B;  3NNE A;  1HAR A;  2HHH F;  1RCX B;  5ETN A;  1NBE B;  5F3Z A;  4I4B A;  3SCK E;  3U1N A;  1QTN B;  4CO3 A;  1G1X A;  1LFW A;  4MT1 A;  2E44 A;  4C98 A;  5CYJ A;  3FC9 A;  3BKF A;  2G0J A;  4NLS A;  3SCJ E;  1XMQ F;  2GV1 A;  4O3S A;  1OY6 A;  5KG7 A;  5D4O A;  3TQ1 A;  1JLC A;  5L39 A;  2MKH A;  3KG0 A;  3CIM A;  2I9S A;  5L8R C;  1VLO A;  3NRB A;  2MQO A;  3DLB A;  2NXJ A;  1AYE A;  2E1P A;  1DAX A;  3JQJ A;  2AYM A;  1T02 A;  1DHM A;  2R4F A;  4LJM A;  3OLB A;  2DKO B;  5I3P A;  4J9U E;  3EPI A;  2GVZ B;  2E5H A;  4RZR A;  1WG1 A;  4M5D B;  1UW9 A;  4WK3 A;  1VDH A;  1PJ5 A;  1WTF A;  2CWX A;  1YWX A;  2Q2K A;  5JVG Q;  2QZ8 A;  3V6D B;  3UDC A;  4ECX A;  3ADA C;  7FDR A;  4BCA A;  2UUC J;  4G1Q A;  3RTV A;  1D9F A;  4PEO A;  4IFY B;  4M5M A;  1IJE B;  1RI7 A;  4HHJ A;  3W5X A;  4LF6 J;  1LK7 A;  1T9X A;  1WF2 A;  3OSP A;  1BE4 A;  3Q2S C;  4QR1 A;  3W3S A;  2A2C A;  1KRP A;  3PAC A;  1DJ0 A;  1IKX A;  4ES1 A;  2DNK A;  5D6G A;  2DNM A;  2AKW B;  1A9N B;  2BRK A;  2AN7 A;  1QJH A;  1QLN A;  3GSD A;  4XAK A;  3Q2T C;  3Q8S B;  2CPI A;  3RB3 A;  3DXB A;  4CLP A;  5BR8 F;  5A8W A;  1FD2 A;  1U7L A;  2JWN A;  1N6Q B;  1EAY C;  2LKZ A;  4HDG A;  4FBT A;  2OPR B;  5KG3 A;  4KO0 B;  1C4C A;  2GA7 A;  3QZ7 A;  2CQD A;  3BPD A;  4F4W A;  3GTY X;  2VZ9 A;  1IUJ A;  2MKK A;  3H59 A;  3NS6 A;  2MKJ A;  2MY8 A;  1SIW B;  2G2Y A;  2XUL A;  1DBD A;  5F8I A;  4J9N A;  3CWJ A;  1RWO B;  4MH8 A;  3MED B;  1NK8 A;  3CCS S;  2IM3 A;  1RP5 A;  2BDP A;  1OSC A;  1BQX A;  2KRR A;  4HI1 A;  3V81 A;  3CCT A;  4B3O A;  2DNN A;  3S6E A;  3BN4 A;  1JMT A;  2CXE A;  4OI2 A;  4NE9 C;  2J7K A;  4DV1 F;  3QJJ A;  3OVA A;  1TVR A;  4A8X A;  2RAQ A;  1U02 A;  1UPM B;  2DIU A;  2X51 A;  3T19 A;  4OZL A;  3NAH A;  1PYS B;  2OJ3 A;  4HKQ A;  4EEY A;  1HNZ J;  1WOS A;  4TU9 A;  1B99 A;  4V1A k;  3K8V A;  3CGI A;  3LQV A;  1DAR A;  4O23 A;  2AYE A;  2RH3 A;  2XS2 A;  2HQG A;  4PUO B;  1UWA A;  4DXL A;  1WKK A;  2GJI A;  3QT7 A;  2KYX A;  3JXO A;  2QLW A;  1FWP A;  4DL5 A;  1LOU A;  1VQS A;  4LMZ A;  2RF2 A;  2LQ5 A;  3FGV A;  1ZPW X;  1I3O B;  1WHX A;  3T5L A;  1DFD A;  1H73 A;  2OFG X;  2BV3 A;  3F41 A;  1P9Q C;  4WCE Q;  5LJ3 Y;  3OLA A;  3H0P A;  1YX2 A;  3RAM A;  4GVL A;  3OVS A;  5DG7 A;  2ZJP Q;  4O3P A;  1WHV A;  2XWX A;  3GFZ A;  3BH7 B;  3AH6 A;  5AE3 A;  1VQK S;  2KXN B;  3CC7 S;  1NJI T;  2EEY A;  3FEZ A;  5KFR A;  3H2U B;  4Y3C A;  4ZJQ A;  4Q8E A;  1SI9 A;  2FJD B;  4I56 A;  2ZZM A;  5KT4 A;  4K5S A;  2VBZ A;  4UW2 A;  1EIY B;  4LSN A;  3QAU A;  1JLF B;  4P74 A;  3S1T A;  4MTP A;  4ZP9 A;  2PD1 A;  4DR3 F;  2HQI A;  3R5C A;  5CXT A;  2BUN A;  2VQF F;  4ECY A;  4HAC A;  1IBK F;  4K2J A;  4UUX A;  2CZ4 A;  3EE3 A;  3DGP B;  4JI7 F;  2W7A A;  4ANE A;  3VAK A;  4KTQ A;  3CUL A;  4KSE B;  2V2Q A;  3MPV A;  4B3S J;  3W63 A;  2ALZ A;  5LOQ A;  1Q16 A;  5D4N A;  2U2F A;  1TL3 B;  2IYG A;  1S9G B;  4DQR A;  2J6U A;  3GSI A;  3MUM P;  4ZVG A;  1RT3 A;  4G1Q B;  4ED2 A;  1LWF A;  3HF5 A;  2W24 A;  3E01 A;  4Z2X A;  1UJ4 A;  3HJV A;  4A8O A;  3TZX A;  4UF4 A;  5KFQ A;  4DI6 A;  4ZHR B;  2IRX A;  2BBE A;  2EKN A;  2D1C A;  1TZ0 A;  2DEJ A;  1RDR A;  1YI2 S;  5AXK A;  2EG2 A;  5HVG A;  3QAT A;  3V2U C;  1F6T A;  1RTH A;  4F4K A;  1FK9 B;  2D3U A;  4KGV B;  4PG6 A;  1ZM2 A;  4J91 A;  4F04 B;  2JZ5 A;  3NCP A;  1I1G A;  3HFV A;  4NOH A;  2K3I A;  5AJ3 F;  2DVI A;  3DRP B;  4ZPV R;  2HZV A;  3H90 A;  2XNQ A;  4PYD A;  1SJR A;  1KLM B;  2R2R A;  1JJC B;  2YKQ A;  3TWZ A;  4D3H A;  5E3Q A;  4HV0 A;  4Y65 A;  3IGN A;  5A8W B;  2QGF B;  4C8L A;  1JLA A;  4GVB B;  1H2U X;  4MJW A;  2K3K A;  1U1N A;  4FNH A;  4RKU C;  1S99 A;  1W25 A;  3F56 A;  1VK3 A;  3RU0 A;  1Q0N A;  2QRR A;  4LFB F;  4DU7 A;  4Y2I A;  2XGQ A;  3V81 B;  3OTE A;  2PC6 A;  3K17 A;  1MRO A;  2O66 A;  3BRE A;  1FXR A;  1AZS A;  4FF2 A;  3NKY A;  3BEG B;  4X62 F;  2IMO A;  1RLC L;  3CJ8 A;  3NBP B;  1PYO B;  5E3C A;  2ROP A;  1H98 A;  3CCE S;  4DQI A;  1IQT A;  1D9A A;  3CNQ P;  4ITS A;  4E8U A;  1N4L A;  2CQ2 A;  5EN1 A;  5C24 B;  4JI2 F;  2XMA A;  1FJC A;  2ADB A;  3GG0 A;  4OZ1 A;  3KLF A;  2WRM A;  1KBR A;  2MGZ B;  3QYY A;  2WVD A;  3NMR A;  2E1C A;  4DPT A;  4QU6 A;  3GYN A;  4OX8 A;  3ILO A;  1XWL A;  5SUH A;  1EX8 A;  1Z4U A;  3MDF A;  2OH2 A;  2R2T A;  2ZJR Q;  2BMB A;  2K7J A;  4OHY A;  3LP0 A;  3VAF A;  3MR7 A;  3NGD A;  1F5A A;  1RCO B;  1SB6 A;  2Y1R I;  4A8Q A;  1X0P A;  2WW8 A;  4ELT A;  2JC1 A;  3NEK A;  1F2G A;  1X4B A;  4NXM J;  4Y6I A;  5ETQ A;  4ES2 A;  2J7W A;  2JL9 A;  1RTJ A;  4B3R J;  4J9R A;  1ZA1 B;  2C2Z B;  2QT7 A;  2OEK A;  1CS4 A;  4ALZ A;  4KGK A;  2CWK A;  4MIB A;  2LU2 A;  4EYH B;  4UST A;  1YBT A;  4CO4 A;  4CH7 A;  2BEF A;  1CQN A;  3TAM A;  2NXE A;  3R97 A;  1JIH A;  2ZNZ A;  1HQU A;  1IM6 A;  5KG4 A;  5K8O A;  1RYS A;  2UV8 G;  1AFJ A;  3I32 A;  1V5V A;  1XN9 A;  5KFY A;  3M2V A;  1HYS A;  2P9C A;  3QJL A;  2BNZ A;  3FCV A;  4MKV A;  4NRT A;  1SKS A;  2SXL A;  1XMO J;  3HHD A;  2ZZN A;  2Y3Y A;  5ETP A;  2DPI A;  3QFW A;  2KRB A;  2VKR A;  4QW9 A;  2ZC3 A;  2V34 A;  2VOO A;  4KFB A;  1Q8K A;  4BWM A;  3PW4 A;  2HHW A;  4N47 A;  1RA7 A;  4TQR A;  1U8W A;  1SVD A;  1YJN S;  1HLW A;  2IJF A;  1VS3 A;  1RTH B;  3MCM A;  4UY8 5;  3GIM A;  3A3P B;  2UUB F;  2GMH A;  1ZAW A;  4RWX A;  2XSJ A;  2GMJ A;  2LA6 A;  3IBW A;  1RU1 A;  1R31 A;  1U47 A;  2W2O P;  3JQM A;  4FF4 A;  1H2V Z;  4ZPT R;  4DV4 F;  1FX4 A;  1EAR A;  1FER A;  2DHX A;  4YP3 A;  3K57 A;  5T41 A;  1JLA B;  1S6U A;  4DFM A;  1MW7 A;  4JP8 A;  3CF5 Q;  2M2B A;  1KQS R;  5CAB A;  3PHT A;  4EU0 A;  1VIS A;  1HNX F;  1RAE B;  2IYI A;  3PRD A;  3GIL A;  3N28 A;  2UU9 F;  4OJG A;  1DQA A;  4DUY J;  3JTP A;  1VQN S;  2H1O E;  2BQ3 A;  2IJN A;  3HHL A;  2CPY A;  8AT1 B;  1U1M A;  3MD3 A;  3OTD A;  4FNI A;  3HKZ D;  3J80 U;  3TAN A;  1DLO A;  1ZH5 A;  4B9V A;  4KB7 A;  2W9B A;  4HYK A;  3KHR A;  4WII A;  3GJR B;  4NEY A;  4CO2 A;  5CCM A;  4LRV A;  4MFB A;  2Q66 A;  1NND A;  1E6Y A;  4MJK A;  1L3T A;  2YWK A;  5IZH A;  4LUB A;  2MZR A;  2NXN A;  1XJW B;  2RVJ A;  4XTT A;  2BA3 A;  2BJ8 A;  4KR0 B;  1P27 B;  2HHV A;  4KV8 A;  1AA1 B;  3ET6 A;  4OMF G;  1PO6 A;  3M8S A;  2CPE A;  2NSB A;  2Q6B A;  1WOR A;  3I55 S;  2L9W A;  3NCQ A;  2WHO A;  1RHR B;  4RW7 A;  2HHP A;  3THV A;  1URR A;  3I0R B;  2JEJ A;  4GO7 X;  1IBL J;  4K0K J;  1ICE B;  1HR0 F;  3T6B A;  5KT3 A;  1Q95 G;  1AW0 A;  4DFK A;  1RT1 A;  3GIK A;  4DL6 A;  3BZQ A;  1F0X A;  4LF9 F;  4LF6 F;  5EWF A;  3CSK A;  3VAG A;  4ANC A;  2A3J A;  2YQ3 A;  4ZJO A;  3PW2 A;  5GVQ A;  1RTJ B;  3L95 X;  2G13 A;  4Q2M A;  5KFX A;  5KFB A;  2OTJ S;  4U67 Q;  2ZH4 A;  1DUR A;  1CS4 B;  5H1S V;  2JOQ A;  1REV A;  4Z7C A;  4LF1 A;  4NWB A;  1IKW B;  5E2Q A;  4TYB A;  4I0W A;  1IKY A;  1KD1 T;  1SV5 A;  3KDO A;  2KYZ A;  3G96 A;  2EW9 A;  1RBL A;  4ECQ A;  4HTJ A;  3IS9 A;  4DV6 J;  4RW8 A;  3TAM B;  1ROF A;  3MD1 A;  1HNV A;  1NH7 A;  3M9M B;  1HQU B;  1BDV A;  3TZW A;  5DJB A;  1JJH A;  2HS3 A;  2DCU B;  1Q82 T;  3CJ5 A;  5E0O A;  1CC8 A;  3Q8U A;  4MK9 A;  4IO1 A;  4KPY A;  1VFJ A;  3DKD A;  3PW0 A;  1HWI A;  4RW9 A;  1Q7L B;  2XGP A;  3M2V B;  4Z37 A;  4JI0 J;  1R43 A;  2XLI A;  5FJ4 A;  5KT6 A;  1RHJ B;  3HLU A;  2X1F A;  4NLY A;  3JSR A;  4N76 A;  4IKA A;  2EWH A;  1JLE A;  2MMY A;  3LGN A;  4DSI A;  4ED8 A;  2PA3 A;  4ED6 A;  1Y5L B;  5KG6 A;  4LIR A;  5DO2 A;  3GFH A;  3KJV B;  5KFK A;  3UDV A;  1R0A B;  1RAJ A;  2VFS A;  3LA0 A;  4OZ3 A;  3W62 A;  3KOA A;  4C8Y A;  4RBU A;  2C2K B;  4KFB B;  3DGV A;  2KL8 A;  4PXB A;  4F4A A;  4QBU A;  1BQN B;  4Y28 C;  3NCR A;  2DNY A;  4YQW A;  5K5M A;  5KFV A;  4CLZ A;  1KFS A;  1HNZ F;  3AT1 B;  1FRX A;  5B0D A;  2XSJ B;  1WKJ A;  1BC6 A;  2CQP A;  2C1E B;  3MAH A;  5IXU A;  2QO3 A;  5L38 A;  1MWY A;  1JLB A;  1T9W A;  6FD1 A;  3ENV A;  3CC4 S;  3OFH A;  4EZ9 A;  3W9I A;  3HSJ A;  3BKU A;  3UN2 A;  1EKS A;  5CCL A;  1N88 A;  5E5N A;  3HXM A;  1F9F A;  2C2D A;  1OJ4 A;  3EPG A;  4LBP A;  3WDO A;  5KOX A;  3CW2 C;  1P6T A;  3L7P A;  3UWT A;  4DV3 J;  3OR1 A;  3NL0 A;  4NX9 A;  2EC2 A;  2B4U A;  2CNN B;  5K8M A;  4WU2 A;  4NCG A;  3T5K A;  3HHL B;  2NUH A;  4DLE A;  3ZO7 A;  1NKB A;  2LXU A;  1FDD A;  1GTH A;  1KOO A;  4L76 A;  1YRX A;  4Q8F A;  3M9N B;  1SL1 A;  2LQ8 A;  1FCA A;  1DLO B;  4A8Y A;  2VFT A;  3K5L A;  2F8E X;  4DOZ A;  2OAU A;  1U4B A;  1I5O B;  2W4D A;  1B7Y B;  2K1O A;  4RUC A;  1X93 A;  4MFB B;  4DR7 J;  4WE1 A;  3EGV A;  3RBX A;  4L74 A;  5GAD U;  3T9Z A;  4KV8 B;  2PGC A;  1Y0H A;  1BUX A;  1ZTW A;  4QYZ J;  2D3O 1;  1NK7 A;  2KT5 A;  3ZZO A;  2WB4 A;  1HI8 A;  4NZ0 A;  3ILI A;  1RHU B;  4ZVP B;  3CO9 A;  4P9S A;  1FNM A;  4RW7 B;  4HT7 A;  1NJX A;  5EDW A;  2XG8 A;  2F40 A;  1T3N A;  4LR7 A;  3J81 Y;  3VAI A;  4YHH J;  1RJJ A;  2CJ9 A;  2VDI A;  5IC4 B;  5BXI A;  3JTN A;  5A6W A;  4ID5 B;  3RR7 A;  2LVW A;  2HYI B;  3BGF A;  2WOM B;  2LEB A;  3EGZ A;  5ETL A;  3M30 A;  5DM6 Q;  2UUA J;  3CJK A;  1SJ1 A;  4K4V A;  1VK8 A;  1UPP A;  2H9Z A;  3KLI A;  1FEE A;  1S1X A;  1O5J A;  1NDC A;  4NLO A;  3OV7 A;  4A46 A;  5LMU F;  2J76 E;  5HAN A;  5KFC A;  2HBZ B;  3JB9 k;  1QUP A;  4OYA A;  1REV B;  3PR4 A;  5BYS A;  4NLR A;  2VUG A;  3HP6 A;  3LP1 B;  4U9R A;  1SV5 B;  1KVI A;  3KKF A;  4XPE A;  2Y8Y A;  2HHT A;  3VEB A;  1WEZ A;  2VOP A;  1X4D A;  3IS9 B;  2OHD A;  2GPE A;  2BKO A;  4WXO A;  3K0J A;  4DSJ A;  2IA0 A;  2IBO A;  1QAX A;  2MEW A;  2BZ2 A;  1CJU B;  5GAH U;  2W8K A;  1K9M T;  2B9X A;  3HHK A;  4RR5 A;  4TLQ A;  1VQ9 S;  4IOC Q;  2MLX A;  1VGY A;  5I42 B;  1FTC A;  1EET A;  3I9V 9;  2A6O A;  2MQ8 A;  3DFE A;  1JLE B;  2ROE A;  3BJY A;  3PKM A;  3DRR B;  1P1L A;  1WF0 A;  4RNF A;  5D0G A;  1Y00 A;  3MF5 A;  3TA0 A;  4YR0 A;  1B7F A;  2IA6 A;  2N7Y A;  1RGV A;  4AL6 A;  1KQG B;  3B82 A;  3Q0A A;  1N5Y A;  2ADL A;  3FBE A;  1U26 A;  4YR3 A;  1W26 A;  3P49 B;  3MTJ A;  3OVB A;  1WEY A;  3CD7 A;  3JSM B;  4KHP J;  3FCH A;  2FLL A;  4Y00 A;  2JBV A;  2RKI A;  4PAA A;  1NLK L;  3U1L A;  5HAT A;  2HHQ A;  4QYR A;  5I3U A;  2W2P P;  2W2N P;  4G1P A;  4X66 J;  3R2C J;  3PW7 A;  4FBU A;  3MR3 A;  4A8F A;  1VBK A;  2HQD A;  2P6S A;  2F4F A;  5F41 A;  4M1K A;  3M8Q B;  2H4Y B;  3KUH A;  4OHX A;  3OJS A;  1VBY A;  5HQL A;  1WC5 A;  2IDE A;  1AT1 B;  4H4M A;  2WZ1 A;  2DK2 A;  4RPF A;  3B78 A;  4OZ2 A;  4OIX A;  2N4C A;  2C3P A;  2CYY A;  2MQN A;  5J1N A;  2XQC A;  1WHW A;  1F5B A;  3CJS A;  4NCG B;  2GJF A;  3PJX A;  2G4B A;  2HGM A;  3K2Y A;  3ITH A;  1JXV A;  5IQQ A;  2G9O A;  2IPO B;  4B3R F;  4PG4 A;  2MZQ A;  3CIZ A;  2J7U A;  4ED4 A;  4DPU A;  5DDQ C;  3VEA A;  3H4D A;  2ACY A;  1MMD A;  2NS1 B;  2FJB B;  3PXG a;  1CG2 A;  4TQS A;  3S7R A;  2UXD J;  1I6J A;  4WE1 B;  4QIE A;  2H4W B;  3RG6 A;  2HHU A;  1RAG B;  4JYA F;  4FYY B;  2H5I B;  2IHR 1;  1QD1 A;  4ME7 E;  2KH9 A;  1JLG A;  1QSS A;  2BSQ E;  1XR6 A;  2H5E A;  1Q1K A;  1X4A A;  3MCO A;  1RAC B;  4PWW A;  4M95 A;  2L41 A;  1GXU A;  3O3L A;  3W9J A;  1R8P A;  4YDD B;  3HHL C;  3I82 A;  1N34 F;  1RWV B;  1U9P A;  2Z8Q A;  4P71 A;  2ZH3 A;  1M5H A;  2HWT A;  2DBB A;  4DCO B;  4NL5 A;  1LWX A;  2C2R A;  1TFY A;  5LMN F;  3FBF A;  4DR6 J;  2VQE J;  1XMO F;  3UR3 C;  3FMW A;  4QIV A;  5M2R A;  3H5S A;  1HPZ B;  2KFY A;  2IRY A;  2PI5 A;  3ISZ A;  4R8U B;  4NZ7 A;  2V6A A;  5FLX Y;  4NXN J;  3EM1 A;  2FVR A;  3KLI B;  4J9K A;  2RB7 A;  2OPP A;  2O67 A;  1B01 A;  5HL7 Q;  3DOK A;  4M5H A;  4ECU A;  2MLZ A;  1J27 A;  4C8K A;  4CT8 A;  2A6M A;  5F9N A;  2DT9 A;  1YTY A;  5LM7 E;  2WW4 A;  3EZ5 A;  3OTC A;  3PO5 A;  1RBO B;  3QLH A;  1KOH A;  3RJM B;  4MAK A;  4X4O A;  3FVY A;  5KT2 A;  1Q86 T;  3DM2 A;  3C8Y A;  3MTK A;  4CLF A;  1M5S A;  3KLH A;  3SQG A;  1FRK A;  4X65 F;  3MR6 A;  4CQ1 A;  1B0T A;  1X5S A;  4CP5 A;  2KU7 A;  1YZ7 A;  4ATN A;  5EX0 A;  2KM8 B;  2CPG A;  3R7S B;  3KUE A;  4DUY F;  2BOP A;  3PW5 A;  1OYE A;  3MM8 A;  2VOD A;  3IFE A;  3TNV A;  1BY9 A;  1D1U A;  3PX6 A;  3HJF A;  4PRF A;  3EDR B;  3JSY A;  1GNK A;  2GW8 A;  2HFU A;  2WSC C;  1WD6 A;  3CMQ A;  2VPW B;  1N5Y B;  2I8E A;  3M32 A;  3VZI A;  4OZN A;  2AJ4 A;  1FNO A;  2GCF A;  2HNY B;  3CD5 A;  1DTQ A;  3CUN A;  2R3V A;  5D15 A;  4P7V A;  1FJG J;  3ZZY A;  2HND A;  2BJ9 A;  3W65 A;  5I3U B;  1LW2 A;  4RWW A;  3AJ2 A;  2DNQ A;  3MZI A;  4CNZ A;  3DLE A;  2VB6 A;  2XZT B;  4OX7 A;  2P6T A;  3MUR P;  2AW0 A;  4O44 A;  2JHE A;  3D0I E;  4LF8 J;  3VAL A;  1VQ4 S;  3ZNJ 1;  4KHR A;  1S48 A;  5JUM A;  5KFL A;  3CCZ A;  4ZVU B;  1IWG A;  2HSE B;  1HQ2 A;  2B9W A;  4OJ3 A;  1VI7 A;  2M8H A;  2VC0 A;  2DXD A;  2KZM A;  3FDS A;  2N3O A;  3OFF A;  4JI5 F;  5HQ8 A;  4H4M B;  3T1H F;  3G9C A;  2JVR A;  1IBL F;  1S6P A;  2GJ2 A;  4K0K F;  2NXC A;  2HLT A;  3FQL A;  4OX9 J;  1TUW A;  3GFY A;  4OI1 A;  2ACM A;  3GG1 A;  2DXF A;  3SXL A;  1LKZ A;  4R0J A;  3R5J B;  1S59 A;  2JC0 A;  2FHO B;  1UJ5 A;  3ITH B;  3BF4 A;  1M5V C;  1OMS A;  2DGQ A;  1S9E A;  4OYX A;  2MYF A;  2LP4 A;  2LLZ A;  2VPZ B;  3JYT A;  1HI0 P;  4X64 F;  3DOM A;  3CO0 P;  1SKU B;  1SXL A;  2NXU A;  1N33 F;  1JNR B;  1YJW S;  4K4Y A;  3W64 A;  3U27 A;  1UMJ A;  3DYA B;  1FRH A;  4LIW A;  4CLL A;  4TYA A;  2YPY A;  4PQU B;  4DV6 F;  2F8M A;  1JLG B;  2XY5 A;  2F9D A;  1Y3K A;  2YPZ A;  3CCM S;  2JNJ A;  2UZA A;  4O4R A;  1F5C A;  3IRW P;  1CUL A;  1EQ0 A;  4W4M A;  2UXB F;  1CJV A;  4IDK A;  4JI0 F;  2FLN A;  3MUT P;  1IVZ A;  3BBC A;  5HSP A;  4KJI A;  4KHM A;  1FFS B;  2XM3 A;  3ZZR A;  2XY7 A;  4M94 A;  3CJ3 A;  5C7P A;  3M1V B;  4ECW A;  3JAM U;  3OTO F;  3GV7 B;  3IGV A;  5C5J A;  2GHP A;  2DGV A;  2B56 A;  4M5L A;  2ZC4 A;  1LV5 A;  5EGY A;  5IT9 U;  5G0R A;  2Y0S D;  4NLD A;  3K58 A;  2CVE A;  4WZQ A;  5CA5 A;  2XMT A;  3DOK B;  3QGG A;  2UV8 A;  1Q8B A;  1HNI B;  2EPI A;  1RT2 B;  1R8H A;  1UFL A;  4DSF A;  2WTF A;  4MK8 A;  3MR2 A;  2B9E A;  1R0C B;  1JJ4 A;  2JLE A;  2KKH A;  4A47 A;  2W4C A;  2V8G A;  3QOQ A;  3QLH B;  2VAS A;  2KT2 A;  2VA2 A;  2GO9 A;  2DIV A;  3THT A;  2FJX A;  1KWM A;  1RAD B;  3SQG B;  2AIR B;  2YVS A;  1TKT B;  3VW4 A;  2JXH A;  2DRB A;  5GMD A;  2CQG A;  2OD6 A;  5GME A;  4DPO A;  4DV3 F;  4OV1 A;  2RNE A;  1U1Q A;  3H5X A;  3GV8 B;  3MM8 B;  2ZWP A;  2LXI A;  5KFU A;  4RNH A;  1S49 A;  2MKC A;  4CYU A;  2BVZ A;  1SUQ B;  2V2V A;  4UZC A;  1TUV A;  1BQM A;  3JTO A;  1RT5 A;  3FSI A;  4WF9 Q;  1FI4 A;  5DZ6 A;  1LW0 A;  2RJZ A;  2DGW A;  3M32 B;  3U02 A;  2FZC B;  2CJX B;  1S1W B;  1OYD A;  1FRI A;  4EMD A;  1DTQ B;  4DR7 F;  4Q2L A;  3GYX B;  3WIV A;  1Q5Y A;  2HND B;  1G6B A;  4BHQ A;  3UCG A;  3DRX A;  1LW2 B;  2IRU A;  1GTE A;  1LFP A;  3X3U A;  4L73 A;  2XCA A;  1PC5 A;  3EXY A;  1N5S A;  1VQ6 S;  3R5A A;  5THW A;  4DR4 F;  4X4S A;  3MPD A;  2MTL A;  3PIP Q;  5E3A A;  3NGK A;  2AZ3 A;  4XK8 C;  4YHH F;  1KVJ A;  4IH6 A;  1S6P B;  5AE1 A;  5DGB A;  1ZOT A;  4ECZ A;  4CO0 A;  4DR5 J;  1NM2 A;  2K9I A;  2WON B;  1MG7 A;  3RRH A;  2BE2 A;  1F1B B;  1TKX B;  4WTO B;  4WYW A;  2KHD A;  2BQU A;  1SC3 B;  3PNI A;  2UUA F;  2XI3 A;  3FRZ A;  4Y0F A;  2G2Z A;  4ECT A;  3L7U A;  3I31 A;  1SH0 A;  3ILJ A;  3KXD A;  4BDP A;  5HK4 A;  2GZO A;  3TA1 A;  4I6W A;  2R8K A;  4TY8 A;  3AAW B;  1NDL A;  3DRS B;  4QU7 A;  2DNZ A;  1EB0 A;  1AUS L;  3Q23 A;  1K8A T;  1JLQ A;  2DYA A;  4RW4 A;  2AMC B;  2Z57 B;  3M8Z A;  2QN6 B;  5DET A;  2ZNY A;  2R2U A;  3QIP B;  4B9U A;  3MEC A;  4YDX A;  1O8B A;  3BDE A;  4R25 A;  1UVN A;  4IRC A;  4J9S A;  3CME S;  3B54 A;  1RAF B;  1CBK A;  2UVV A;  1FKO A;  2VON A;  3VR1 A;  1VQ5 S;  4QZV B;  3W60 A;  2EI5 A;  3A8K A;  4F8R A;  4B02 A;  3CJ4 A;  4DG1 B;  3F44 A;  2H5J B;  4ZVO B;  3I4P A;  5A2Q Y;  4NPO A;  4ED7 A;  2ZUG A;  1CUL B;  2O1P A;  2W8L A;  3DOL A;  1TQL A;  3B8H A;  1QVG R;  1TP7 A;  3SSQ A;  4IDK B;  1VMB A;  1IBM J;  2QA2 A;  3ISN C;  4Y2M A;  4C11 A;  2J9D E;  3N6N A;  4Q5V A;  4Y2A A;  1M5K C;  4GRS A;  4X4Q A;  1U0S A;  1YLX A;  4KKO B;  5HRO B;  1VQ8 S;  3CPW R;  1SH3 A;  3BBB A;  1T9Y A;  2KT3 A;  1FRJ A;  2KN4 A;  4OI6 A;  4O4G B;  3C16 A;  2M8D B;  1URN A;  2YKP A;  2RD5 C;  5G0R B;  2VA3 A;  2C22 A;  3DLJ A;  3PX4 A;  4DR1 J;  2CQ1 A;  1CJK A;  4RU2 A;  4KHP F;  3DLG A;  2DNR A;  4TVA B;  4RUH A;  4ED0 A;  4DL7 A;  5IV3 A;  5KFO A;  4IG0 B;  3GQC A;  1RAH B;  2R8J A;  2AF6 A;  3RW7 A;  1SQE A;  2VJV A;  1NU4 A;  2OKQ A;  1U24 A;  1M1K T;  1RKJ A;  5B0F A;  3DHW C;  3I9Z A;  1QM9 A;  4UY8 T;  2QA4 G;  1PG5 B;  5L9N A;  3TUP A;  4RX6 A;  3AXK A;  2HHS A;  2WK4 A;  3PY8 A;  5IWA F;  2DJW A;  2ZHB A;  4RBV A;  8ATC B;  4YME A;  2FVS A;  1L3V A;  1UVK A;  5KFD A;  3IBF B;  1HWU A;  3OFE A;  1T3O A;  1D8Z A;  4CYU B;  1U6B A;  4P2S A;  2RRN A;  1CLF A;  1HA1 A;  1H74 A;  2V8P A;  2D74 B;  1RT5 B;  4PWD B;  4IO9 Q;  3DN9 A;  3ISN D;  2LFV A;  5MLC V;  4I6A A;  3HVW A;  4H4O A;  5DS7 A;  1MN7 A;  2FC9 A;  2R7X A;  2L9D A;  4LF4 J;  1TMM A;  1S79 A;  4JI1 J;  4KYZ A;  1HQE A;  4YEA A;  2UXD F;  1RLD A;  3DRY A;  3NS7 B;  1HD1 A;  3HM9 A;  2JRS A;  2M9K A;  3NY0 A;  1UVI A;  1OY8 A;  3SSS A;  3HVA A;  2NSC A;  2VIC A;  2WCX A;  2DNL A;  4BWJ A;  1HBU A;  2JLF A;  1U0H A;  2V9K A;  4PZV A;  4Q44 A;  3LP2 A;  1PC4 A;  2QLB B;  2AJF E;  4G1I A;  4IFV A;  1F60 B;  1RTI A;  2BAB A;  5B08 A;  2W9A A;  2B7B B;  2YH1 A;  3M2R B;  1GMW D;  3G8Q A;  2H1Y A;  4NLX A;  1XEZ A;  4A4J A;  2R7O A;  3TAP A;  2AJ0 A;  1LQ9 A;  3KTQ A;  3T1A A;  4DR6 F;  2VQE F;  4Q43 A;  3DI6 A;  4ILM A;  5ETR A;  2BM0 A;  2POK A;  2BE2 B;  1SC1 B;  1KDN A;  3H5Y A;  3M2U B;  5EHH A;  5GAG I;  2AJ2 A;  4KIA A;  2CDQ A;  3BM7 A;  4NXN F;  3WX4 A;  2M52 A;  3H20 A;  4LSZ B;  2YWH A;  4N8N A;  4W90 B;  2LEA A;  3NWR A;  3A8J A;  2LCW A;  2HBQ B;  4YUD A;  4B3T F;  2JSX A;  1PSD A;  1JLQ B;  5EWE A;  1NJZ A;  5ETK A;  2CPD A;  2HGN A;  4TU7 A;  3VGU A;  2NLW A;  3FMT A;  5J1E A;  2FHJ A;  4AQY J;  3SQO P;  4RLE A;  4M8L A;  1FKO B;  3NWG A;  4M63 A;  3GII A;  2MSS A;  1SQG A;  4GC6 A;  4YFU A;  3POT B;  1SJ4 P;  3NMA A;  3ETO A;  4WWS A;  2CZV C;  2PMZ D;  1HW9 A;  2MB0 B;  3ZZT A;  1B3T A;  2MJN A;  3QQC D;  1CEZ A;  4C11 B;  3P96 A;  1IQZ A;  1VJW A;  5M2P A;  4IFY A;  5F0U A;  4WXW A;  2VIH A;  4CT9 A;  3NGR A;  3SV4 A;  4RUB A;  3D3B J;  3UNG C;  3PX0 A;  2DNO A;  3H7H B;  4W98 A;  2DIS A;  4XIU A;  2EKY A;  4C9D A;  5K20 B;  3C16 B;  4YY3 J;  4PPD A;  2NPF A;  4ZKA A;  3VAH A;  4DF4 A;  2QV6 A;  4FDF A;  1CJK B;  1TUG B;  2IM2 A;  1FJG F;  4ZOS A;  5B09 A;  3DLG B;  3N6L A;  1KC8 T;  1V3S A;  2Z30 B;  2RS2 A;  3R2D J;  3O8W A;  2HBR B;  1S0O A;  2C2O B;  2Z4P A;  2ASJ A;  2H65 B;  1M90 T;  1WG4 A;  2OPR A;  4LF8 F;  2X3G A;  4PWU A;  3RGI A;  4KC5 A;  3LTO A;  2LEP A;  2OI2 A;  2K8G A;  3CC2 S;  1SIW A;  4B9T A;  4UOG A;  2VG7 B;  2FQQ B;  2Z56 B;  3M6W A;  4I7F B;  5BYQ A;  2CPH A;  1M0S A;  4DV0 J;  2R9L A;  4ILL A;  1TTH B;  5DGA A;  5LSO A;  4LRE A;  4M5N A;  4OX9 F;  5D8H B;  3MGJ A;  2HQF A;  4C97 A;  1RWN B;  2QSW A;  5KFH A;  3GJS B;  4FP9 A;  5L9X A;  3V6H A;  2CQ3 A;  4EGL A;  3HD1 A;  2ZE2 B;  3OUY A;  3G5O A;  4KGZ B;  1S6O A;  5D4P A;  4H4O B;  1YZ6 A;  4DV7 F;  1N0U A;  2GNK A;  2RBF A;  2Q3P A;  3G82 A;  1MYK A;  1IKV B;  1B4S A;  5GAD I;  4PUO A;  2CQH A;  3HSG A;  2GFF A;  2ZD1 B;  4QWB A;  1H6K X;  4GMK A;  1FE4 A;  3UCZ P;  5LSR A;  1UTA A;  4KT0 C;  2R7V A;  1NSK L;  2AV5 A;  4QPT A;  5T7L A;  2DNG A;  4USV A;  1HBU B;  1S57 A;  3K5N A;  4U7U D;  2E5G A;  3LP2 B;  1T9T A;  1Q7Y T;  1Y7P A;  1ZPV A;  4ILR A;  4JI3 J;  1RTI B;  1H38 A;  2H48 B;  4M5G A;  2XS5 A;  1D8Y A;  3D1Q A;  4OV6 A;  2D9P A;  2M88 A;  1CJT B;  1S1U B;  1EKR A;  4NYO A;  5CYM B;  3B4M A;  2APO A;  3KDN A;  4WK1 A;  4LRA A;  3EYZ A;  3HT3 A;  3G4S S;  1IR2 A;  5KFJ A;  4JI4 J;  1RB0 A;  4FF1 A;  2DGS A;  3GXQ A;  1JLF A;  4UTG A;  2ZBR A;  3Q89 A;  3EWG A;  3UD5 A;  4DSE A;  3W8G A;  2E66 A;  1ZET A;  4DPX A;  2VHG A;  4V19 X;  2XLK A;  4Q0B A;  5J1E B;  1T9U A;  2HRY A;  3LAK A;  2N7C A;  3KHL A;  3DGP A;  4KQZ A;  3PYE A;  4K4Z A;  5HLF B;  4FN5 A;  2FVC A;  3IR7 A;  4NAS A;  5GAH I;  4CO1 A;  3UD3 P;  1TL3 A;  1S9G A;  4U96 A;  2XZD B;  2E1R A;  2N4D A;  3C15 B;  2ABY A;  2LU1 A;  2RQM A;  2PN6 A;  3TJ8 A;  3QSI A;  4N7T A;  3ZZZ A;  2MY7 A;  1F9H A;  3DU6 A;  2KVI A;  1LWE A;  4ZHR A;  4HH1 A;  3N5F A;  2P9E A;  3UPF A;  3GB0 A;  3LAL A;  2E29 A;  3CB4 A;  5CZX A;  3LO3 A;  4K50 A;  4WP9 A;  5FLX U;  1FK9 A;  3NO7 A;  4PXD A;  3KG4 A;  4LR8 A;  3GIR A;  5KFA A;  2B9Y A;  2C3U A;  3K8W A;  3DRP A;  2V50 A;  3EMT A;  4F26 A;  1KLM A;  2WVB A;  1MML A;  1FEH A;  2KDO A;  2PII A;  5JJB A;  4YB7 A;  4IH7 A;  5IM0 A;  4X4R A;  3EGW B;  5CHC B;  3E3X A;  4GVB A;  1YJU A;  2RUG A;  1GMV A;  3IMQ J;  1LNQ A;  1B0P A;  4MKA A;  5MAO A;  1GQE A;  4U8Y A;  4OQJ A;  2CJK A;  3IWX A;  2B51 A;  3ILL A;  2XY6 A;  3U1M A;  1NPK A;  1Y9O A;  3D6T B;  1S0M A;  4LRB A;  2UXC F;  2LDY A;  5KFW A;  4DR5 F;  2CPJ A;  2FC8 A;  3P45 B;  2W1B A;  4UQT A;  1U49 A;  3W2V B;  3T5J A;  5B0G A;  3NBP A;  3VGV A;  1UVL A;  1X9M A;  1SL0 A;  3IAM 9;  3A8I A;  1TU0 B;  2A18 A;  3AJ1 A;  3A3N B;  1HL6 A;  3OUY B;  1N36 F;  3N0V A;  5C24 A;  3OL7 A;  1WOP A;  3D5M A;  1YBA A;  3DNC A;  3WC0 A;  3G82 B;  1XMQ J;  1S72 S;  1TAU A;  4MYU A;  1HHQ A;  2C28 A;  4DL4 A;  2MGZ A;  1VRQ C;  3CJR A;  5F3T A;  2F4V J;  3MOJ B;  4L6V 3;  1UEK A;  2GAG C;  3QSY B;  2QYC A;  1TL4 A;  2VD3 A;  2PMH A;  5T7L B;  5AT1 B;  5B0C A;  4P73 A;  2DHS A;  3I5B A;  4QWE A;  5IS2 A;  4I69 A;  4LF2 A;  4TY9 A;  2RQ4 A;  4HH0 A;  5KFS A;  2IY5 B;  4USH A;  3N4W A;  1X31 C;  2ZJQ Q;  1D3W A;  2GO8 A;  2B0G A;  4TNO A;  1T03 B;  5H9E K;  2C3Y A;  2GIR A;  1TKZ B;  3BYR A;  2FHM A;  3T6J A;  4G65 A;  5GMK a;  2P2C B;  2ZM6 J;  4USK A;  4F2R A;  1FFG B;  4UQG A;  4LVN P;  4LR9 A;  3JSB A;  1VC6 A;  3BBF A;  2ZOG A;  2N3L A;  3MAA A;  4ZMM A;  2I6W A;  2QFJ A;  5KT7 A;  5DQH A;  2MQQ A;  5DG9 A;  3C6U A;  3CD6 S;  3WC2 A;  3MM6 A;  3UDE A;  1R8C A;  4B08 A;  3IN5 A;  3FBB A;  3WX8 A;  3EDQ B;  4DEZ A;  3TZZ A;  1S0V A;  2EK1 A;  1L3U A;  4Q0B B;  1KQF B;  3A4T A;  4K7Q A;  3HCX A;  3Q86 A;  4C7Q A;  3GWC A;  3A1Y G;  3FFI B;  2HQC A;  5G4D A;  1QAJ A;  5IQ6 A;  3D4J A;  3IR7 B;  1L3S A;  3CDE A;  1HHS A;  3HT0 A;  3FZB A;  5BJR A;  5DQG A;  4KH1 B;  2MZT A;  2QL7 B;  3CXC R;  3KG1 A;  2LYV A;  4PG7 A;  3CJ2 A;  3JQK A;  1HWL A;  2LQ9 A;  1UWB A;  4HTI A;  5E7O B;  3H87 C;  1LWE B;  2ZHA A;  1XQI A;  1R8B A;  1U1K A;  2QG9 B;  5J2N A;  1N52 B;  3MCS A;  2XMW A;  4OZ0 A;  3R1L A;  1D09 B;  1N5T A;  1S1V A;  4JI8 F;  3ZZU A;  2ZBQ A;  2B4O A;  5J2Q A;  4JV5 J;  3P6Y C;  4CNY A;  1FKP B;  5HMX A;  1TK5 A;  5KG5 A;  5L1I A;  4JI1 F;  4DV1 J;  1VC5 A;  2HFV A;  1X4H A;  3LWL A;  2MZS A;  4PPZ A;  3FMB A;  3SV3 A;  4ES3 A;  4KE5 A;  2D69 A;  1PJ7 A;  2EFG A;  2FJE B;  1NUE A;  3R5D A;  4F7V A;  5IM0 B;  1WSR A;  4CH1 A;  5EUH A;  1MNT A;  4F50 A;  4EK2 A;  4DN9 A;  2UP1 A;  4QIG A;  2CQ4 A;  2DR7 A;  1KSP A;  3HSD A;  4M5J A;  3W7B A;  1NDP A;  3NS5 A;  3T1Y F;  2VDH A;  2HZC A;  2C3M A;  5IV4 A;  1YJ9 S;  4DDF A;  3FEY B;  2JH3 A;  2OEL A;  3VVT A;  4LVO P;  4UOC A;  2LQB A;  2AZ1 A;  1WEL A;  5DDO C;  2CJQ A;  3H25 A;  3PYG A;  5H9F K;  3RUB L;  1RWP B;  4K59 A;  2UVR A;  3CVK A;  3BYP A;  3KMS A;  1DTT B;  2RML A;  3NXZ A;  1IBC B;  2J9C A;  1P94 A;  1NRK A;  1C1B B;  4EO8 A;  3IBC B;  2IM1 A;  2W4P A;  1QY7 A;  4WFZ A;  1LK5 A;  2YNH A;  2XHC A;  3EJM A;  2J9E A;  5HMW A;  4AQY F;  2HPU A;  3LH2 S;  1IR1 A;  3O5T B;  1RAI B;  4JB8 B;  3GR1 A;  4NLW A;  2P9G A;  3R7N B;  4UUW A;  3Q8Q B;  1Y3J A;  4OZ5 A;  2VQF J;  2HQ3 A;  3WIU A;  1DQ9 A;  4ZVF A;  3N5B A;  5C2G A;  4H54 A;  3TOQ A;  1QAY A;  4LT6 A;  3I0R A;  4ID8 A;  3OJU A;  3LGM A;  2ZKU A;  3EVW A;  4NLT A;  2IJR A;  5E3R A;  3T3F A;  3AY0 A;  2AP6 A;  4P2X A;  1GEH A;  1SKR A;  4FS1 A;  4ED5 A;  1WG5 A;  2VF3 A;  2ZWO A;  4ZVH A;  4ER8 A;  2KHC A;  1VCT A;  4DJB A;  1Y10 A;  3IRX B;  1U1P A;  1U1O A;  2G1H A;  4ZVE A;  3TR5 A;  3SEO A;  2YNF A;  3J80 Y;  1S9F A;  2CFX A;  2XMJ A;  1PCA A;  2KFN A;  3MAA B;  2ZHO A;  1KNZ A;  1KQK A;  1B28 A;  1ZM4 A;  1IKW A;  4OYI A;  1RWX B;  2RU9 A;  1RWW B;  2VPX B;  3C6U B;  1N32 J;  1HWK A;  2QLJ B;  4JUZ A;  3MM6 B;  4I67 A;  3MCN A;  1QTM A;  2Q6C A;  3OL8 A;  1YGY A;  5HMZ A;  1S7H A;  4AND A;  5C25 A;  1S12 A;  1TV6 A;  5F8J A;  2OPS B;  2YWE A;  1CPZ A;  4DUZ J;  1FJ7 A;  4ZVR B;  1HKA A;  3UW1 A;  3HUL A;  3VTI A;  3D0G E;  4JI6 F;  1BHN A;  1WNE A;  3R1H A;  2WBR A;  4FF3 A;  4DX7 A;  4OYB A;  2E9R X;  2M7S A;  3PFO A;  1MU2 A;  4ZK7 M;  4FYD A;  1GK8 A;  4I2P A;  3GE9 A;  2YNG B;  2FUG 9;  4DV0 F;  3KJV A;  3M8P B;  4IG3 A;  5KFF A;  1UWB B;  2EBE A;  3FSX A;  1R0A A;  4RU9 A;  2KXF A;  2XBP A;  3I0S A;  3FZ2 A;  2J6S A;  2OD4 A;  3VWS A;  5J2N B;  4LBI A;  1MSW D;  1RT4 A;  1S1V B;  1UA0 A;  1BQN A;  4DCP B;  3IP0 A;  1OQ6 A;  1X8D A;  5J2Q B;  3TUZ C;  4LFA F;  1RK8 A;  5KT5 A;  4JV2 A;  2CPZ A;  2FZG B;  4P10 A;  1LEO A;  2ZKT A;  5ETM A;  2AHO B;  2V8V A;  1Y11 A;  3IAS 9;  5A8K B;  2JFD A;  3J7Z T;  3HVT B;  4OI0 A;  1U6F A;  3CJQ A;  3NGS A;  4JI2 J;  2OUG A;  4RO0 A;  2DGT A;  1D0E A;  4GKJ J;  2BAN A;  2QSF A;  5LJ5 Y;  2DGU A;  2J8S A;  3MUV P;  3CCW A;  3H2V E;  4CI0 B;  5HMY A;  3MMB B;  2DGO A;  2XMU A;  1U2F A;  3RW6 A;  3TEH B;  2YQ0 A;  2HFN A;  2MHE A;  4PXC A;  1R3N A;  2BE7 D;  3QGI A;  2RSQ A;  3PIO Q;  1VRU B;  2L3M A;  2BJ7 A;  4USM A;  3QJP A;  1O6X A;  3Q8P B;  1IN0 A;  3ZTS A;  2AQ4 A;  2J9D A;  5FDL B;  1P9Y A;  4JI4 F;  5ETO A;  7FD1 A;  3VCD A;  1N5V A;  3P5T L;  4J5O A;  1A6L A;  1ZS6 A;  3N9U C;  3TJA A;  1UA1 A;  2OPQ B;  4A8W A;  3AOA A;  4D8J A;  5LXY A;  2YNH B;  4V19 J;  1U1R A;  3TRG A;  4F4Z A;  2PSZ A;  4J7C A;  3KJN B;  1FXD A;  2QYG A;  4DS5 A;  4Y2C A;  5HJX A;  3V5R A;  3AD8 C;  1AFI A;  5CYQ A;  5B0B A;  4WFN Q;  1WUU A;  4C6A A;  1BLU A;  2GHV C;  3P3D A;  4LQ9 A;  2J0S D;  3RB6 A;  1REG X;  3C6T B;  5B0A A;  2UUC F;  3H40 A;  4ZA1 A;  1RE1 B;  4ID5 A;  1UEU A;  3AA8 A;  1OY9 A;  2M3D A;  3D1O A;  1NJW A;  3MM5 A;  1NLA A;  2WOM A;  2DR9 A;  2LMI A;  2F7V A;  5GAG U;  4F4Y A;  3KMQ A;  4KPC A;  2DD8 S;  1X9W A;  2RDJ A;  1IR0 A;  1RAB B;  1UZD A;  4I2Q A;  2YNF B;  4P75 A;  3UFC X;  2K2P A;  4OHV A;  4YB5 A;  2FJV A;  1VBZ A;  1PIL A;  5HQM A;  3D9B A;  1VOM A;  2PE8 A;  4F3O A;  4K4U A;  3LP1 A;  4I64 A;  4PG5 A;  1C0U B;  1V3R A;  2WVF A;  2FGC A;  5F8G A;  4UOF A;  2HS4 A;  4ZPD A;  3I96 A;  4EBE A;  1FVS A;  5C25 B;  2BM1 A;  3ZTR A;  1R27 B;  1TV6 B;  4DZD A;  2RT3 A;  2B5J A;  3W5Y A;  2KFZ A;  4ECR A;  2ZFH A;  5F8L A;  3SZ2 A;  1OPI A;  5E41 A;  1CJU A;  1XK8 A;  3ZC4 A;  5DLG A;  4R5P B;  1TK8 A;  2OML A;  4K8R A;  4DV4 J;  5HP1 A;  1T95 A;  3Q8V A;  5KG0 A;  1SPB P;  1T11 A;  2H3E B;  3A12 A;  4DBQ A;  2U1A A;  5U47 A;  5I42 A;  1YDL A;  5KAK A;  1MU2 B;  2GVD B;  4I2P B;  3JS9 A;  4FZV A;  3DRR A;  1NPP A;  4DQP A;  2VBY A;  2W9C B;  3E51 A;  4FYV B;  4IG3 B;  3DDK A;  2GIQ A;  3I0S B;  4J9M A;  3DMJ B;  1RT4 B;  1G2E A;  2V94 A;  1WC0 A;  2I1R A;  3PTW A;  5CD4 A;  5K8P A;  2Z2Z A;  4F67 A;  2ZOF A;  2K29 A;  1BAZ A;  2MST A;  1B0V A;  3JSM A;  3PYD A;  3HMJ G; 
#chains in the Genus database with same CATH homology
 4D8J A;  2CAX A;  2K6L A;  2WVF A;  1MNT A;  2FGC A;  1ARR A;  2HZV A;  2K9I A;  1Q5V A;  2K1O A;  4FXE A;  2BA3 A;  2BJ8 A;  1IRQ A;  1PAR A;  2AY0 A;  1X93 A;  1B01 A;  3QSI A;  2BNW A;  4HV0 A;  2BJ3 A;  2JXI A;  3VEA A;  2WVD A;  2BJ1 A;  2JXG A;  1QTG A;  3LGH A;  1ARQ A;  3VEB A;  3H87 C;  2WVC A;  4ME7 E;  1BDV A;  3BKT A;  2BJ9 A;  3FT7 A;  3BKU A;  1NLA A;  2WVE A;  2BSQ E;  2GPE A;  1Q5Y A;  2HZA A;  3PHT A;  2BJ7 A;  3GXQ A;  2BNZ A;  1MYL A;  2RBF A;  1MYK A;  3QOQ A;  3FMT A;  2Y3Y A;  2H1O E;  2WVB A;  2PC6 A;  3BKF A;  2CAJ A;  2KEL A;  1U9P A;  1P94 A;  1B28 A;  1BDT A;  1EA4 A;  2K29 A;  1BAZ A;  2K5J A;  2CAD A;  2NZC A;  2CA9 A;  2CPG A;  3VW4 A;  2JXH A;  3OD2 A;  2F1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...