2WVBA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
130
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTAIAMDEHNSLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 36
structure length 130
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvbA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvbA02
1X93A 3GXQA 2BNWA 2WVBA 2BNZA 3BKFA 4HV0A 2HZAA 3BKTA 2BA3A 4FXEA 1PARA 1BDVA 2JXGA 2CAJA 2WVFA 3H87C 3QOQA 2CPGA 2GPEA 1B01A 1Q5VA 4ME7E 2H1OE 3FMTA 1U9PA 1NLAA 2K5JA 3OD2A 1BDTA 3PHTA 1EA4A 3VEAA 2CA9A 2K29A 1BAZA 3LGHA 1P94A 2BJ7A 1QTGA 2JXHA 2WVDA 2BJ8A 2K6LA 2WVEA 1Q5YA 2F1FA 2AY0A 4D8JA 1ARRA 2K1OA 2BJ9A 3QSIA 2K9IA 2WVCA 2JXIA 2CAXA 3VEBA 1MNTA 2PC6A 1ARQA 3FT7A 1MYLA 2BJ1A 2HZVA 2BSQE 3VW4A 2NZCA 2BJ3A 3BKUA 1MYKA 2Y3YA 2RBFA 1B28A 1IRQA 2KELA 2CADA 2FGCA
chains in the Genus database with same CATH superfamily
2KZZA 4FXWA 1JMTA 2ACYA 3NNCA 1UW9A 4RW4A 4I7FB 5AJ3J 4B9MA 3R5AA 1VQLS 1RTZA 2BXJA 3CWJA 4PRFA 1VS3A 2VB6A 1RT1A 1QJHA 4ZVQB 2ZJPQ 2CPJA 2M0GB 2NXUA 3ENVA 2XYHB 4MIAA 4WK3A 2DB1A 4BC9A 1VR6A 4KE5A 1PGZA 4NXMJ 3K59A 1NDLA 1T3NA 4ZJQA 2A10A 2QL9B 4JBCA 1IJEB 2HAFA 2V4RA 4B3OB 4NLOA 2P9EA 2HRYA 5A8KB 3IP0A 4MAKA 4P6QA 1FTRA 4J9RA 2DEJA 1QSLA 3ONQA 2VJUA 3I9V9 1RT6A 2LVWA 1GQEA 1IKXA 2DGSA 2XBPA 1M5KC 2AHOB 5F8HA 4YFUA 2EC2A 4DR1F 3EUNA 3ILIA 2F65A 3QZ8A 2KT5A 2VG6A 3F41A 4JV5J 2ALZA 2UV8G 3X1LB 5FIIA 4YOEA 5GAEI 1HQEA 2C2OB 4HLBA 2HHVA 2AW0A 2AJFE 1SB6A 3FFIA 1PC5A 4F4YA 1DZ5A 3MR7A 4PWDA 3MAQA 3OLBA 3PW0A 4ME7E 5KT7A 3MR3A 1Q8IA 1X4FA 3ZZTA 3AB2B 1QE1A 3A3OB 2IFXA 2YKAA 5LXYA 2XM3A 1IR0A 2X51A 3HI9A 3GJTB 2ZM6F 1VQSA 1EX8A 1IKWB 5D15A 2FVCA 4FPIA 1E6VA 7AT1B 2MQQA 5EWGA 1FKAF 4B3TF 4PQUB 2AMCB 1RT3A 1OWXA 2WSEC 3D0GE 3T9NA 5GADI 3KK2B 3MM8B 3NO7A 2QA2A 2OHDA 4P2XA 3QO9B 2MZSA 2IMWP 1NEEA 4DR4F 1PCAA 1NXIA 1S9GB 3KK3A 2DR7A 3Q8SB 2KELA 1R31A 2HGNA 3G8QA 2BV3A 3H42A 3KLHA 4F4ZA 1WACA 5HAOA 4FYXB 3M32A 1NAQA 2VG6B 2JVRA 1Z4UA 2GX8A 2JLFA 1EIYB 1EQMA 1L3SA 2ADBA 4RL1A 1KHVA 2V68A 3FVYA 2A6OA 1U1PA 3DXSX 1U45A 4PUOB 3ZNJ1 4KY3A 2YKPA 2JL9A 3ZZPA 1VQMS 5E5NA 4DG1B 2BRKA 4YY3J 4O3RA 1T05B 1LK5A 4DL4A 3H4BA 4JI7J 1ZS6A 1QDUB 2AZ1A 2A2BA 3MTKA 2LQJA 1M5OC 3M05A 5L1LA 2IA0A 3KUGA 2MSTA 4M5DB 4QJVA 3RBEA 4IUFA 4F4AA 3PTWA 4NCGA 1JXEA 2AEFA 5K8PA 3OTDA 4IFVA 4DWIA 2XLJA 1HWUA 3CO9A 3A3PB 4QR1A 3K17A 5C24A 4OHZA 4DX6A 2BEFA 5KT2A 4U8YA 3PIOQ 4DDFA 2BNWA 1NDKA 2GMHA 1TL1A 2F5GA 1OY9A 1MMDA 1RU2A 1FFGB 4IDKB 4UOCA 1HWJA 3DGPA 4XK8C 4C11A 1U26A 2D74B 2IVYA 2VONA 3W7BA 3L09A 1P9QC 1AZSA 1S6PA 2RU9A 1RHJB 1LFPA 2VQFF 3MCMA 3FGVA 5J2QB 5L1IA 3O5TB 2X1AA 2IHR1 1OG7A 2YNHA 4UF4A 2F7VA 2VV5A 1W26A 3FQLA 2M3DA 3BGFA 1SCJB 1ZM3A 2UU9J 1RWNB 2XI3A 4IH5A 3LP1A 3IMQJ 1SIWA 3CJKA 2HK3A 3D5MA 4NPOA 2B4PA 3MD1A 2JH3A 2LKZA 1S6QB 4ZCKA 3K57A 3T5JA 3ISNC 1RTDA 2QT7A 2J7WA 4YS2A 3G96A 3OBIA 2I6WA 2ACMA 5IFMA 5J1PA 1F5BA 5KG5A 3MM8A 2FYXA 2JJ4D 3TZWA 2J8AA 3ZTRA 1KS2A 4YMEA 5BR8J 4DR3J 3OXFA 1TVRB 3P96A 5B0FA 1LK7A 3G6VA 2O67A 3MF5A 4HI2A 4ZITA 4DSIA 5HVFA 4JI0J 1R8HA 3MCOA 1S6QA 2PEHA 3M8ZA 3PDNA 2ROGA 5D78A 3TP2A 4DJBA 2POKA 3OR2A 5LXRA 4MT1A 2KM8B 3SCIE 3VGTA 1S10A 1T95A 1SC4B 2DGOA 1RB0A 3WX4A 4ZLLA 2NUUG 1S1TA 2HQDA 2A3JA 4J9VA 3I0RA 3RAQA 1R0CB 4FP9A 4RNNA 2WVCA 2AJQA 1V9OA 4CO5A 3PYGA 1VQ5S 3KNAA 2F3JA 1KNZA 4CLWA 3G9CA 2VBZA 4CLZA 3CPWR 1I94F 2E5LF 3ZZYA 2VG7B 2CQHA 4USUA 2DXDA 2WB4A 3ZTOA 5DQHA 3V6DA 1N34J 4PR6A 2V9WA 4A8FA 2BE9B 4ES1A 4DQRA 2BX6A 2BA9A 4KGZB 1FFSB 1R0BG 4NLWA 4QWDA 1HQ2A 2DTJA 1HBOB 1RT7A 3CMAS 4Q0BB 5C25B 2HNZB 5C24B 1U0SA 5A2QY 3CIMA 1BC6A 6FD1A 3MECB 1VOMA 1TKTB 4OV6A 4DR6F 3KHHA 4NA3A 4ZK7M 3NMAA 3FUYA 2OSQA 5HI7A 4M5HA 1GMWD 2GVZA 3TAMB 2JEFA 4I0WA 2LA6A 2WK4A 4FF1A 4DU7A 5I3PA 1Q8KA 4J91A 3TA2A 3OR1B 1W7WA 3OUYA 1QE1B 1HARA 2HVEA 3CW2C 1TP7A 4UT4A 2VH7A 2IJFA 2BSQE 2HHQA 4WCEQ 4NLPA 2I5JB 3EMTA 3V4MA 3R1LA 1YJ7A 4KBIA 4S0MA 1IM6A 2AU0A 2W2PP 1VQKS 3GIJA 5KT3A 3JYTA 4ZVHA 2FHJD 4ES2A 2A0FB 4ER8A 1RHUB 2V2ZA 1MWQA 1FXRA 1FJGJ 2HFZA 2I5JA 4ELTA 4IR9A 4O0IA 2R2SA 1KOOA 4HT7A 5E3RA 2EKYA 3FMBA 2F8HA 3NBPB 3C16A 3Q8RB 3CMQA 5GMEA 2R7UA 4B9TA 2E9TA 1P1TA 2FLPA 1DBDA 2AGOA 3W5ZA 4CO0A 5KFVA 3TA1A 4WFBQ 2IM0A 1RWMB 5KFRA 4NZ7A 3KLFB 1FDBA 3DCAA 3MM7B 3GYNA 3RUBL 4RW6A 4DV6J 4JI1J 2Q66A 3EPIA 1HD1A 2MJUA 1Y5NB 1TKZA 1IWGA 2DD8S 4DV2F 1SPBP 3AFGA 4FZVA 3EGZA 1XK8A 1W25A 4KHRA 2M8DB 3UDVA 2F8MA 3BH6B 3LJPA 3IG1B 1AB8A 1U8SA 1Y5LB 2KHDA 1DARA 2M5YA 2RNEA 2VG7A 2C3UA 3B4MA 2VF3A 3CCQS 3QWUA 2UUAF 1UFWA 1IBMF 4NI2B 4AL7A 2W9BA 1LWCA 2FB0A 2RJZA 4J9UE 1BQMA 2DNOA 4NLYA 3WHIA 2C2DA 3HHLD 3M6XA 2H3AA 2HRTA 2VJVA 5BXIA 1WKLA 5J1EA 1ARRA 3AXKA 4F02A 3CD7A 3DXBA 5KFNA 4X62J 4OX9F 2CAXA 2XLKA 4DOZA 3VW4A 5HK4A 1GH8A 2P9CA 1LW2B 3KG4A 5SUHA 2IBOA 1S9EB 2Z56B 3KNGA 4YB5A 2NSBA 4JUZA 5DDOC 4C8OA 2BACA 3AQPA 3SBMA 1JJ4A 4LIRA 1QAXA 2VC1A 3M8RA 4JV1A 1Q16A 2XZDB 4B9LA 1BLUA 3EGNA 5E3QA 2YXLA 1RBOB 2CQIA 2L9WA 3DRXA 5CQGA 4F3MA 4WJBA 1RTDB 4R0EA 4TU7A 2RT3A 4M94A 3JQKA 2LXUA 3JSYA 3TOQA 4CH1A 2PD1A 2I1RA 3E01B 2V34A 4JI0F 1EAYC 1H3DA 4OIXA 1VC0A 4I2QB 4Q8EA 5KG6A 3D54A 1N4LA 4DPUA 3G8TA 3BB5A 4LQ9A 4N5SA 1U6FA 3N5FA 3OVBA 4QPXA 5JVHQ 2JXIA 1CULB 1KQSR 4MH8A 4F67A 2D7SA 3HD1A 3MECA 1N54B 5J2NA 1JLQB 5HANA 1KOHA 1KQGB 5FD1A 1EP4A 1ZTTA 1KLNA 4DFJA 3QIDA 1VBKA 2HHSA 4EFAC 2BKOA 3G86A 3C6TA 4ZVFA 2QA1A 2GGPB 1O5JA 1X5OA 2E7WA 3MI7X 2KRBA 1R6VA 2YKNB 1FE4A 3HX9A 3TVZA 3FKBA 5IZHA 5CH7B 1YKWA 1Z2LA 3HT0A 3TVYA 4ED5A 5KFAA 2AX1A 1UZHA 2WVEA 4P75A 5EGYA 5KT6A 5IT0A 4DV4J 1HNWJ 1YJUA 1S79A 3OJSA 4MTPA 2LQ8A 3SYZA 1OYEA 3G87A 4LF8J 2MKYA 2FUG9 2LU2A 2DKOB 2YPZA 3QIPA 3LTOA 1VRUA 4OI2A 4QZVB 3VEBA 2QLWA 4X65F 4AL6A 5IWAF 1ZETA 3OR2B 3VQTA 1YIJS 4OX6A 4DQQA 1FKPA 4M95A 5A0YA 3ENWA 4OI1A 2Z58B 2G2YA 4JI2J 5HJYA 2V8PA 2Q2KA 1SQGA 2ZNYA 3DU5A 4C9DA 4IG0B 1NPKA 1VMBA 2Q1LA 2DH8A 2MQOA 2ZOGA 2BANB 3M8QB 3MM5B 4ES3A 2GZOA 3IR7A 1S1XB 5JUMA 3CCUS 1HPZB 1T11A 2P5VA 2XO6A 3IBCB 3H5YA 3OL6A 2OKQA 3HHLB 3ITHB 1TK0A 1T9WA 1TL7A 3LPYA 2E1RA 4LSNB 4WE1B 1HBUB 2B7BB 2EFVA 3SI8A 1SI9A 2MHEA 1XJWB 3L95X 2F8EX 3GG1A 4M5LA 4QWCA 1HBOA 3QJPA 1CS4A 4DV7F 3VR1A 1QTMA 4YEAA 3IR5B 3BSCA 4MIWA 4FKXA 4UZCA 4ECUA 4OI4A 1OSDA 2LQ9A 2DHHA 2FPHX 5KFIA 3M2VA 3RGIA 4QR0A 2E1MC 3LP0B 4C0BA 4G1PA 3NWRA 5DJBA 1QLNA 4X2BA 3CCTA 2CPZA 2VFVA 2ZOMA 1RADB 3HCXA 2W24A 3IRWP 4LR9A 1X7VA 1LKZA 4QW9A 3GFXA 3BQ0A 1HBNA 2DNLA 4J9KA 5HSPA 2KVIA 1N36J 1R6YA 1XNQF 1HD0A 4DSKA 1R89A 2ZUGA 3HVTA 4EU0A 2IRYA 2VHGA 1RWPB 5L8RC 1RAAB 2M70A 1IQTA 2HBQB 3M6UA 2H4WB 2DH9A 4Y34A 3MPDA 2HFVA 4O44B 1OQ6A 3VWSA 5A8KA 4NYPA 4UY8T 5T41A 1U2FA 1RAJA 3QYYA 1X4HA 3S8SA 1VRTA 1OY8A 2I9SA 3D1OA 3OFEA 4OV1A 5CYQA 5THWA 1NMEB 4C48A 5LSLA 4USKA 4DG1A 2GHVC 4MKAA 5KFSA 3I32A 3MPYA 4CYUB 4ZIVA 3S7RA 2OPPA 2DO4A 3QATA 2RKIB 1PC4A 2DGQA 2RVJA 3QFHA 2FD2A 4OYOA 4OX7A 4W98A 4UOGA 4B3RF 3NS7B 3V2UC 3SSRA 5RUBA 2DNZA 2EXUA 5G0RA 3GJQB 2EFPA 2ZFHA 3PM9A 4OLPA 1H7WA 2NLWA 2HVDA 1S6OA 4UOHA 2K8GA 3B8HA 1IM4A 4ZHRA 1C2PA 4KYZA 5D4NA 3K8WA 2K5JA 1FO1A 1X0PA 2F9JA 2GQQA 2RKIA 3DOLB 5CD4H 1VQ9S 1JLAA 3PJWA 2CNNB 4AYBD 2DT9A 1NK9A 2KT2A 3N6LA 4G1QA 3CNQP 1NSPA 3GP9A 4C8KA 1VQ4S 1TQLA 2OEKA 2DGWA 2VBWA 1YJTA 4WTYA 3Q8PB 2ZVIA 4CH7A 3MURP 1RHKB 3HFZB 2WSCC 3J81U 3GONA 1Q53A 1SUQB 2DJWA 2PIIA 1UFKA 1TKTA 4HT5A 1ULRA 3MM9B 5KG3A 2QC3A 1K0TA 2ZH9A 4UUXA 1RCXB 3KK1B 3GTYX 1B0VA 4WKYA 4ZCIA 1Q95G 4RW4B 2PI5A 2PA8D 2F4FA 4LSLA 3FBFA 2RSQA 2HVIA 3T5LA 1T94A 2MQ8A 1SJ4P 2CQBA 1KBRA 3LWLA 1LXJA 4F0MA 4QQBA 1RE1B 2COLA 3MFIA 1K73T 4DSJA 2HLUA 4OYPA 2P9GA 1Y4ZB 1REVB 2MY7A 1NJWA 2ASLA 2FJWA 2J0QD 1F1BB 2WBMA 3DOMA 5ETMA 5HBMA 2QA4S 2K1OA 3JTOA 2CRLA 1AT1B 1FKOA 2IM2A 4C3MA 3M9MB 3CCMS 4X62F 4NLXA 1KQKA 3O2IA 1VHFA 5GAEU 1MYLA 1FCAA 3JAMU 4DPOA 4RO0A 2XEXA 2CDRB 2IVFB 2PMZD 2O5DA 3JTNA 5DGBA 5F8MA 1RAIB 1U0HB 3JQMA 4MFBA 1FD2A 3KYLA 3CDAA 2UUAJ 3ZC4A 3R5DA 2CKWA 1RI7A 4PZVA 1CJVB 4Q8FA 1I51B 1UL3A 1SL2A 1UA1A 2X3DA 2CJ9A 4KH1B 1FRJA 1S1VA 1YJVA 1HNIA 5KFYA 4A8XA 1ZM2A 4YB1P 4RUCA 2C2EA 3OTEA 4LRAA 5HVHA 5GADU 1JX4A 2E5IA 3LP0A 3K5MA 2R8GA 4H4MB 4MMOA 3DOKB 1DRZA 4A8KA 5BYSA 1EJ7L 1JNRB 4ECYA 2QE5A 3ELHA 4OZ5A 2P6TA 1TL7B 3I87A 1S48A 3PVXA 2B43A 1KTQA 2B0GA 3T1HJ 3BBBA 4ZS6A 3D68A 1TKXA 3SZ2A 1HNZF 2B9EA 2BM1A 2AYBA 4JI6F 3UCZP 1IXKA 1RT2B 2V8VA 1IJFB 1QUPA 2WCXA 2UUTA 5CHCB 3TNVA 3THPA 3G6XA 2RS2A 1SIZA 2JFDA 3BO2A 2HZAA 2J0SD 3D3CJ 1LWEA 1RT1B 2Z4PA 2MHNA 2CQ1A 1Q79A 3BDEA 3L7OA 2A1BA 4ZVTB 1BQXA 1NM2A 1RZMA 1GMVA 2GHPA 3DLKB 3M6WA 2JEJA 3B4DA 2HHXA 1U1OA 1T02A 2BOAA 2ZDPA 3A8IA 5KFMA 1FNMA 2QIFA 2K6LA 4KO0A 3BBFA 2R7TA 2UP1A 3BSOA 5K8OA 2XS5A 4LRVA 4ECVA 2VPZB 5D3GA 4ZLNA 4TU8A 1QY7A 2LQBA 4I6WA 5J2PB 1T9VA 1YG0A 2J7KA 3UR3C 1J5OB 4F3QA 3HHNB 2B4OA 2DXFA 5I42A 3BGOP 3BDPA 5HATA 2L48A 2Q6BA 2UVVA 3NOCA 3PR4A 2MZQA 2HGMA 2DCUB 3BKFA 4U96A 2ZKUA 2QFIA 3G82B 2R4FA 3MMJA 1SJ1A 4MKYA 4JYAJ 4OJHA 5ETOA 5GMKa 2W7PA 3VAGA 2DXEA 5C25A 4J37A 2E1CA 1PBUA 2IYGA 3TX0A 4KTQA 2CZ9A 2BUNA 2AYGA 4R25A 3W63A 1L3UA 2V0NA 2HPUA 2WW8A 4EZ9A 2ATCB 1FD8A 3D66A 4JOUA 4N8NA 1QVFR 5H1SV 4B9NA 4OZ2A 3R2CJ 4I2PB 4KR0B 1D1UA 3G5OA 4GVBA 2C2ZB 3AA8A 1BUXA 4K8RA 2DEIA 2UV8A 1UWBB 4O44A 2YH1A 4LFBF 3ETOA 4C98A 1APSA 1MNTA 2VASA 4CO2A 5EX3A 2NR0A 3KUHA 2VA2A 3H5XA 1WC6A 3OTCA 3MAAA 4EBDA 4LRCA 3EZ5A 2QMWA 3GB0A 1CQMA 3M32B 1YJNS 1YBAA 4CQ1A 1SJRA 1FVSA 1UEUA 4J9LA 3QPIA 3N5BA 1FERA 3CCLS 3RRKA 2QL7B 3ILOA 2LDIA 4BS2A 1ELOA 2OP5A 3HK2A 4EBEA 1DTTB 2MKCA 1KVJA 4ED0A 1TL3B 2CNLB 2HNYB 3EZOA 3NG8A 4IH7A 5C42A 3CJ3A 2GW8A 4OQJA 1TZ0A 3LALA 2R8HA 1YHQS 3QSIA 1OPZA 4O4GA 3GFZA 3LANA 3OW2R 3KLIA 2RB7A 2V63A 2ASYA 4BCAA 1SH2A 4NLVA 1H98A 3DOMB 2ZH7A 4YB6A 5HQMA 4M5NA 1NSQA 4Z37A 1LFWA 3CE8A 4TVAB 5DLFA 4B02A 1BY9A 1KLMB 2XMMA 3GWCA 3UDCA 4F2SA 3G2XA 5IM0A 2AWZA 3HFKA 4R0JA 1FJ7A 4KGXB 2X1BA 3FQKA 3CC2S 2YNHB 2VQEJ 5D0RA 4PG5A 3KJFB 4Z2XA 2OLWA 3J7Z5 1BD6A 3OT9A 2W1BA 2RQ4A 1RA6A 1BE4A 3C16B 3W64A 4ED8A 1QAIA 2CQ3A 2X7IA 1S57A 2YNIA 3MM6A 4RNMA 3PZPA 2DIUA 1X31C 2XI2A 3N0VA 1JK9B 1H2TZ 3O44A 5HQLA 3I4PA 1JLEB 4TKTA 3GV7B 2C2RA 1X9WA 2PN6A 1TR0A 1U25A 3R27A 1S0MA 1GMWA 1D8ZA 1B28A 4IRCA 4ID5A 4HH1A 5LSOA 3O3LA 5GAHI 3HP6A 2M2BA 1TFYA 1JNZB 1RTHB 3PYEA 3RW7A 1YWXA 3BKTA 4X4QA 2CFXA 4WK1A 1YZ7A 1LW0B 4HHUA 3VF0B 3W2VA 2EPIA 3RYLA 2VIHA 1VBZA 2FJXA 1CJTA 2KHCA 2KN4A 4IG3B 4ZDNA 3QJJA 1UA0A 5E2QA 3DHWC 3M30A 1VJQA 2V2VA 2H65B 4LSZB 5DGAA 5HP1B 2VPWB 2HBRB 4CZCA 2BJ7A 4WYLA 1ZM4A 3AJ1A 3MHYA 4C8NA 3IXQA 4DR4J 3NGSA 1DURA 1N5QA 3H4DA 3MFHA 1WKJA 3I96A 4U67Q 4DV5J 3ENQA 2F9DA 4H4MA 4NLRA 5K9FA 2N7CA 2NCKL 1YRXA 3FCWA 2RQKA 1VISA 3M30B 3KK2A 2HQFA 4B3TJ 1HBUA 3NCPA 3E51A 4PWWA 4C0HA 1R8PA 4Y2AA 3BGRA 5HQ8A 3C2PA 3Q8UA 2E5JA 2L41A 4PEOA 1WNEA 1GFWB 2EVZA 3C6UA 3TVKA 3VZHA 4WFNQ 4ITSA 4ID5B 1MN7A 2J9CA 1HR0F 1IWAA 1WHWA 5GMDA 4DV5F 1NU4A 3UPFA 5L38A 2ZJRQ 1LWEB 1FRLA 1NCLA 4DV0J 2RDIA 2WOMA 3QAUA 3H90A 2L9NA 1LWCB 3DRPA 2DHAA 3AAWB 3TUJC 2Y1IA 2NS1B 4CCHA 3HVAA 3IS9A 1U7LA 3M7VA 5BJRA 4Y28C 3I9ZA 5J1EB 3TJAA 1G2EA 2E5HA 5K8MA 3HF5A 3DRRB 5BYRA 2DR8A 3PJ9A 1DY3A 4IQMA 2VKRA 3A3NB 2JHEA 3NEKA 1N0UA 2LP4A 1VDHA 2BBEA 1SVDA 3UR0A 2HS4A 4PXDA 3NNEA 1QUVA 2DNHA 1RACB 3UDEA 3TJ8A 5LJ5Y 3CCVS 4FS1A 4FBUA 1DTQA 1S59A 2R7RA 1RTJB 3IM9A 4KHMA 4QYZK 2QLJB 3FCVA 4YN3B 4A46A 2YWKA 4IDKA 1VC6A 2HHWA 2GJIA 1RLDA 1EP4B 3D9BA 2C3YA 3EM1A 3N79A 4F2RA 1U1NA 2I0XA 2RF2B 3M2UB 4M5GA 2XMVA 2DRBA 3ZZUA 2K7KA 3W2WB 4BLGA 2ZITA 5U47A 3KDOA 1KWMA 3NBPA 4WZMA 1AFJA 4AL5A 4RW8A 4OHVA 2YQ3A 1JLAB 2B9YA 2CPHA 2DNNA 1E6YB 3OTOJ 4M5DA 2V2KA 1U02A 4KH0B 1VJWA 4QOTA 4DUYF 3MMAB 4TY9A 3NNAA 4DL3A 3TZXA 5KFDA 4EYHB 2NXEA 2O01C 1M5HA 5J2MA 2ZZMA 1ICEB 4ZP8A 2GIQA 2BJ1A 2QFJA 3CMES 3GLJA 1HI0P 1S1WA 3MR6A 2CIMA 2QMUB 3PHTA 4DL2A 1XMQJ 4JI4J 4FXDA 4ZPCA 4L72B 2OD4A 5KFGA 1R8AA 5J1NA 3H5UA 2R7WA 1ACMB 2V4JB 1EARA 2AT1B 2MZRA 3NRBA 3IFEA 4L75A 1QAJA 3CF5Q 1ZA2B 1KFSA 1BHNA 5J2QA 2G2OA 4GKKJ 3TZZA 1YRTA 2OPQB 3QGHA 3TUIC 3D1QA 2CPFA 1S1WB 2XNQA 4GO7X 1YTYA 2XO7A 3NCQA 4HEA9 4BWMA 1WI6A 2W4PA 3NAIA 2V8DA 3OHBA 4DN9A 2WVDA 3VAFA 2MQNA 2M88A 1RT5A 4KRWA 4X4UA 2XNRA 2AX0A 3GZ7A 1OQ3A 2GAGC 2J9DE 1DQAA 1TAUA 2CJQA 4JI3F 4WF9Q 2K9IA 2BVZA 3MEEA 5C5JA 3QQCD 3GCWP 2CVEA 3L7PA 3K5PA 3PRDA 3BJYA 2Z8QA 4NEZA 3R9LA 1PKUA 4NLQA 1S7IA 4K4TA 1RSCA 2OFHX 5J2NB 1T9TA 5SZTA 1HNXJ 3PRBA 4KC5A 4LF6J 2WRMA 4OZNA 4NMLA 4KHPJ 3T1YJ 1UWAA 2W4DA 4J9SA 3QGIA 4IO1A 4DUZF 2V9KA 3CTRA 1QVGR 2ZBQA 4GVLA 2DNYA 4ERDA 2MPUA 1O51A 1RKJA 2DNGA 1PJ6A 3VGUA 1RAFB 1FTCA 1HNVB 1NNDA 2CYYA 2FC9A 1YRUA 3CDUA 3D28A 2B4UA 2LXFA 2QL5B 3LAMA 3MWBA 3I0RB 4DN0A 1S9GA 2HIQA 5L9NA 5JVGQ 4DLGA 3PX6A 1D9DA 4YDXA 1YLXA 4U7UD 1RT5B 1DQ8A 2CPXA 2MSSA 3UN3A 2XMAA 3FRZA 2KOEA 3W65A 2N3OA 1GTEA 4IR1A 4ETZA 4OZ3A 2YX4A 2FGOA 4FPRA 4DPTA 2PFFB 1X4EA 5H9FK 2YQ1A 2ZHAA 4TY8B 4CO4A 5HROB 4QYZJ 4MJWA 1HQEB 5KFXA 5A76A 2FZGB 4NLUA 2XYGB 2JDJA 3IRXB 4PPZA 1QSSA 5IQQA 4C8LA 3MM5A 3CXCR 9ATCB 1SBRA 3I5BA 1TKXB 1OS5A 1U09A 4ZPBA 3MMBB 4X4TA 1VQOS 2JEIA 2E7VA 4P73A 1BMQB 2ZH8A 4H4OB 5F8NA 1FRKA 3D6HB 3R5JB 1X8DA 1X5SA 2BZ2A 2IJRA 1HYSA 3OPKA 4NMXA 4HI1A 3OUYB 3GIIA 3M1VA 4V1Ak 3HT3A 3PY8A 2XMJA 1U48A 1O6XA 2RQMA 2OSRA 4X4RA 1J5EJ 1SJQA 3ET6B 2HK2A 4FKYA 5B08A 4X4VA 2J8SA 4LR7A 2AIRB 3PX4A 1RQ0A 4IFYA 2VBYA 1TFWA 2UVWA 5KFOA 1MG7A 4JI6J 1AZSB 3E8OA 5E7OB 1N5YA 3GIRA 1O8BA 2BANA 3M8QA 4C6AA 1U0HA 4MFBB 3T1HF 1TL4A 2ZC4A 5CA5A 3WQPA 3RRGA 3W66A 3SQGB 1T8EA 2H1YA 1TAQA 2DHSA 5GAGU 1ROFA 3HHLA 2H5JB 2HQ3A 2RILA 3ITHA 5ETQA 5HMXA 1IKYB 1NK7A 1HR0J 2DHXA 2OPRB 1RHQB 3H2VE 4OZ0A 4WIQA 3UW1A 3SSQA 1QSYA 4ANCA 4LRDA 4ZMMA 3LP1B 1CPZA 2XSJB 9RUBA 4CT8A 2XMTA 3M6VA 3EPGA 2VDHA 3AOCA 2F1FA 1JWWA 2YNFB 2Y8WA 1JIHA 3JQJA 1RYRA 1REVA 4LQ3A 4I64A 2K7JA 2E7XA 2VBXA 1K1SA 1PAEX 4ZVUB 2JC1A 2PC6A 1BGXT 3UFCX 3S6EA 1FRMA 2LDYA 2ILYA 3LO3A 4D3GA 1WHVA 1LW2A 4RR5A 3DGPB 1VFJA 3VGVA 3UN5A 2G0JA 4C8ZA 3IC1A 5K8NA 4DPXA 5CZXA 3BEGB 5I3QA 2E29A 4ED1A 1NK8A 2MQLA 3I56S 3KMSA 5T14A 2C2KB 4Y0FA 2UUCJ 4RWWA 4ZIWA 3BM7A 4YHHJ 2FJAB 3M9NB 4KSEB 4LREA 1GEHA 2Y0BB 1UJ6A 1PYTA 4L73A 4RW7A 1KEKA 1M90T 3PW7A 4H4OA 2CPDA 3BGLA 2L08A 3SXLA 4O3SA 1ZYQA 4EO8A 2UZAA 3WBZA 5HP1A 4Y2IA 3M1VB 3QJLA 3W5YA 4P2FA 4J9QA 3TANA 5EWFA 1YGYA 2VQEF 5B0GA 2OTJS 4EWTA 5KFQA 3UCUP 2HMIB 2F40A 2XWXA 1XWLA 4CLUA 4LRBA 1FWPA 3MEEB 4OMFG 4OYIA 1K44A 1GK8A 1QD1A 1VYAA 1W2IA 3I0SB 2QSWA 2JRSA 1MROA 1PYOB 3EJMA 4RJVA 3RBZA 2GPEA 1MWZA 4DCPB 5LSRA 5DG8A 3F73A 4K5SA 3M8YA 1XQIA 2ZHBA 1B4SA 4I1TA 4LF8F 4F25A 2MDAA 5KG7A 4JP8A 5E3PA 3SV4A 1Q5YA 5HLFB 3AQOA 2DPIA 3HMJG 2JLGA 1RBAA 2MLYA 3RAXA 3SCKE 2B3TB 4Q45A 3DDIA 2OPQA 3QGPA 4ZPWR 3BR8A 4C8YA 5CABA 4F4KA 1NB2A 2FHJA 2QGFB 4OYXA 4AT1B 4P52A 3IGNA 3FK4A 1CBKA 1WUUA 2YWWA 4GO5X 1UJ4A 3SCJE 4TQSA 4K4XA 2IDEA 2D9OA 3CJSA 2XS2A 1KHWA 2EFGA 4B3RJ 1JXLA 3FEYB 4ZA1A 3LWMA 4P72A 5KG1A 2LEPA 1RAGB 4EMDA 5AE3A 1TU0B 3H7HB 2GC8A 2CQCA 1HFEL 1WG5A 1S1UB 2B5JA 5D0HA 1AXQA 1BDVA 3BV8A 4USIA 5KFLA 1NJYA 1VQ6S 4DMZA 2ZVSA 3GFYA 1B70B 1SV5B 2YPYA 3EX7B 1K0VA 1RWWB 3TAMA 3BF4A 5I3UB 1HI8A 3D6MB 2A18A 2MKKA 4AAIA 3BQ2A 1WF2A 2KDOA 3MOZA 5A8RA 1N5YB 2HFOA 3THVA 4K50A 3DLBA 1XNQJ 1N36F 3TA0A 5LJ3Y 3KJNB 1ZAVA 2H54B 2AEJA 4BWJA 2XWYA 4L74A 4Y6IA 4I4BA 3UD3P 5IXUA 3QAEA 4RNHA 3QNWB 2DYAA 2KKHA 2FJVA 4E98A 1UMJA 3JYTB 2ZD1B 4CM2A 2GA7A 5DDQC 2R3VA 3OHAA 1YBUA 1FNOA 1CJUA 3K8VA 1HQUB 2FHMA 1M5SA 2OEJA 2PO4A 3OFHA 4WP8A 2NPFA 2HAIA 2E5GA 5KFJA 2W9AA 4DV7J 1IQZA 4ZPAA 1WHXA 1X4BA 4EGLA 1YSJA 5KFKA 3CJ8A 2QYCA 1VRUB 2HKEA 2ZKTA 2XZTB 4CDIA 4OI3A 2QTWA 2UXDJ 4F3OA 4QYRA 2JEGA 3IO1A 4EUVA 1H2VZ 1I5OB 2RRBA 3CC7S 5KTQA 4DSLA 1CEZA 1LQ9A 4CLKA 1Q0NA 1UAWA 4F7VA 5B09A 3SIPB 2ZH3A 1RCOB 1NZ8A 2HNDB 4O4GB 4M63A 1D09B 4DPYA 1AA1B 3HSZA 5ETSA 1C0UA 2CPIA 4JI2F 1ZAXA 1P1LA 4RLEA 4USWA 2AF6A 1T0TV 1L3KA 1WG4A 3JTPA 1D0EA 4KJIA 4ZVPB 4QU6A 3PXGa 4X65J 1WDTA 5ETNA 1P9YA 2HFSA 2BYCA 4HTJA 4W90B 2CQDA 3TZYA 2BQRA 4B9UA 1XNRJ 4DV4F 3ZZOA 4KKOA 4DPWA 3K5NA 4OJ3A 1N5VA 3KHGA 2QA4G 5DZ7A 4CI0B 2I2YA 1FWKA 1H2UX 4O4RA 2EFOA 2LXIA 2H5EA 1DAXA 3M2VB 4I69A 4DR2J 1XMOJ 3L9ZA 1Q82T 1HNZJ 4A8OA 4DL0C 4PWDB 3U1NA 4ZCMA 3KLFA 3IWXA 2WTFA 1Y3KA 2CJAA 1K8AT 1KTVA 3PKMA 2XSJA 3BKUA 3EDRB 1EB0A 1UFLA 3GSIA 3IWLA 2Y3YA 3CSKA 2WSFC 2KG0A 1EHWA 3MAAB 1Q16B 3I6PA 4ZVSB 2ZHOA 3DI6A 4LFAF 4ED2A 4LFCF 1KKHA 3C6UB 3HDSA 4ED4A 2KH9A 3VVUA 3JSMA 3J7YU 1QTNB 3QSYB 3LUYA 4LSLB 3FZBA 3R7NB 1IKVB 3AJDA 5CYMA 1FA0A 3RRHA 3PO5A 2JXGA 4B3SJ 2ABYA 2NQPA 1SJ3P 3K2YA 4DS5A 2CUYA 3POTA 1NDCA 4ECQA 5LM7E 4JV2A 4R8UB 3W3SA 4DR7J 4I56A 3HO1A 3QIPB 2CA9A 5EWEA 4JI5F 4XDCA 1TUVA 4X66J 3PW2A 2P8IA 3I5AA 4Q44A 3DLEA 2J6SA 2IBKA 4D8JA 1JQGA 2OMLA 5KFTA 1AW0A 4NLSA 3UQSA 4R5PB 2NXNA 2ZBCA 3CDWA 3DDKA 2GIFA 4XIUA 2DK2A 2HWIA 3PW5A 3J7A1 2PA3A 2MKJA 2GFFA 4HVZA 4G6VB 3R8YA 4OL8A 4WYWA 3HPOA 2VC0A 1J5OA 4NRUA 1XR6A 3NMRA 2CQ0A 2VL1A 1U4BA 4FF2A 2YKMA 4HKQA 5IS2A 3ICLA 4PABA 1KONA 4NYOA 5FLXY 3DLGA 1F5AA 4I6AA 1HBMA 4R5PA 2OIHA 2G4BA 4N47A 1C0UB 3CEDA 4IFYB 4W4MA 3LPEA 1IKVA 4LVNP 1CULA 4YB7A 1UPPA 3P49B 4GRSA 2L3MA 5DDPC 3Q2TC 2ERRA 1GX5A 2JXHA 1P27B 2BJ8A 1RAOA 3H2LA 4R8UA 4F04B 2AGPA 1YJ9S 2CNOB 1IBMJ 4DQPA 3R5CA 5BYQA 2XSFA 2DNRA 3CCZA 1MROB 1CQNA 1FXLA 4B3SF 1WOOA 3AD7C 1KD1T 4CNZA 1X9MA 1AUSL 3MM6B 5JXSA 4RW9B 1HNVA 1HMVA 1PJ5A 1Q7LB 2D9PA 2V50A 1P8GA 3GYGA 3N01A 4L76A 3RJMB 4LFAJ 2H48B 3V6DB 1NK4A 3OJUA 4LFCJ 1C1CB 4RX6A 4DV3F 2W7OA 2HEKA 2GV1A 5D0EA 1N8RT 2HVHA 2D3O1 7FDRA 4F8RA 4WU2A 5L39A 5A8WB 5C7PA 4HHJA 5IV3A 3D67A 3LP2B 2A6MA 2IYIA 3SCLE 4HR2A 1SL0A 1ZH5A 4A4JA 1VQYA 5HO4A 1XMOF 2UXCF 2UXBJ 1HLWA 2ZWPA 1AFIA 3DGVA 3R97A 4ECZA 2E44A 1N33F 2C42A 2MLZA 4OYAA 1UVKA 3FEZA 2W2OP 3H5SA 1F2HA 1WEZA 1FJGF 4ZCLA 1TL5A 5B0CA 1RU1A 3HVRA 3T5HA 4KQZA 2OTLS 5IOLA 2MQMA 5ETTA 3NWGA 2LMIA 1M1KT 2RH3A 3OSNA 5I3UA 2BW7A 1FF2A 2BJ3A 3IG1A 1RYSA 2EFNA 2QRRA 5KFPA 1G4CA 4KT0C 4P2SA 1U1RA 1H0HB 3MUMP 4QIEA 1HPZA 2NSCA 1NZAA 4ZP7A 2W9BB 3JXOA 2JC0A 3DYAB 3A13A 1EQ0A 1SKUB 2G2ZA 2B51A 5ETPA 4ILLA 4RUBA 4WKRA 3ISND 1FRIA 2MYFA 1FRHA 4KO0B 2OFGX 4ILMA 1RWKB 3W60A 3VGSA 2QO3A 2X1GA 5D4LA 4PYAA 1TKZB 3T6JA 3CCWA 4I67A 2GS8A 1HHSA 4CLPA 2Y1RI 3QRRA 2YNFA 5I4MA 3PIPQ 4ICLB 1YVFA 3FNNA 5CYMB 2B6AB 2X1FA 2RMLA 2GHWA 2WW4A 1WTBA 3HHKA 1HW9A 4CNYA 2V8HA 3FT7A 3G6ES 1N34F 3NL0A 4PQAA 3S1TA 1WOSA 3T3FA 2VFUA 5T7LA 4DLEA 3V81B 1I94J 1CVJA 5L46A 5CZVA 1A0OB 3C6TB 3H2UB 5ETKA 3RB6A 1VK8A 2J76E 2AD9A 2B6AA 1M0SA 3DOLA 5AXKA 2AZ3A 4EZ6A 4CM0A 1NRKA 2YX7A 1RKIA 3BYPA 3EXYA 4WP9A 5IT9Y 5LL6d 3OL7A 1JKHB 2M8HA 3H25A 4FS2A 4G1QB 3J7AN 1VHIA 4X64F 3PNIA 2VFSA 2HHPA 5E3AA 4ED3A 3G71S 4B3MJ 4J9MA 2HHTA 2DY1A 2N4DA 4U7UK 1NO8A 5I42B 1U6ZA 2PSZA 3PEJA 1U1KA 3DDNA 5IWAJ 1DJ0A 1WF1A 4J5OA 5DO2A 4LBHA 4ZN1A 5BR8F 2DR5A 1TUWA 1AUDA 2CJXB 3TRGA 1TV6A 4CTAB 1S6PB 1ARQA 2XULA 4YR3A 4Q5VA 4URSA 3D2WA 2R2UA 1Q86T 2GGPA 2QN6B 3F0NA 4AD6A 4YR0A 2RBFA 4Q0BA 4C2MA 2FJEB 1ZPWX 3DNCA 1U2CA 1R3NA 3W1YC 3ZZ0A 4RBTA 2Z2LA 4G3IA 2XY6A 1F3FA 3CJ2A 2OELA 4IH6A 1U1MA 4OI6A 1RDRA 3Q86A 4X4NA 2IVMA 4M5MA 3MCSA 4UW2A 2E1AA 2UU9F 2W4CA 4X4SA 3CDEA 4JI8F 4KHPF 5LT5A 1EA4A 3RG6A 2V5HG 1RTIA 2DGXA 2OO4A 4ANEA 2GMJA 2GO9A 2IRXA 2Y1LB 3LOUA 2GJ2A 3FZ2A 3TJ9A 4C7QA 2VQFJ 1L5UA 1A9NB 1VK3A 3NCRA 5D8HB 3AY0A 3OXGA 2N7YA 1OMSA 3VAHA 2YWEA 2ZNZA 1B99A 3GCXP 3IAM9 4LRFA 2ZDOA 3G8SA 1KSPA 1RK8A 3PKYA 2BMBA 2FHOB 1RUSA 1WTFA 3C15B 4Q2MA 1NKCA 2NXCA 3C46A 2FGCA 1KLMA 2J9DA 3MZIA 4MKBA 1RWOB 2DGTA 3T9ZA 3T6BA 3W8PA 4LSNA 1JLCA 2UVRA 3D7SB 1RTHA 2D3UA 1YITS 4ZKAA 1ZM9A 4ZVRB 1NK6A 1F5CA 4RKUC 5K5MA 1UCNA 4LBIA 4NEYA 4ZVOB 1U9PA 1S4EA 1NDPA 2QLXA 3MEKA 3V81A 4UQTA 3PACA 2VDIA 3NS6A 4DCJB 4RNFA 4YHHF 3J7ZT 3VZIA 1U49A 2BOPA 2KM8C 1SKRA 4TN2A 1JLBA 4WPAA 5JJBA 4NXNF 1B7YB 3ADAC 2WZ1A 2KG1A 3R6GB 4RZRA 4K4ZA 1RLCL 2GJFA 2IC3A 2OPSA 2E66A 3W61A 4RU9A 2HVZA 2RE1A 3VAJA 1YBTA 5AT1B 5IV4A 2XC9A 4IG0A 2LLZA 3HHLC 1GX6A 4OJGA 2KFYA 4IYQA 5KFZA 3RR8A 1VQ7S 1R0AB 4NCAA 3JSBA 4PKDB 1BWVA 2MMYA 1N5SA 3QBCA 3CJQA 1K47A 2N4CA 3IBWA 4WXWA 4CO1A 5F8IA 4O3PA 1FNXH 3NNHA 2IY5B 2M4MA 1UVIA 4LFBJ 5B0EA 3OR1A 2QJ3A 2NXJA 4XPCA 4G65A 3UD4P 3MR2A 4RBVA 1FEEA 1C0TA 1V6HA 2GO8A 2GIRA 2IM1A 4RWXA 4A8YA 2FLNA 4ZP9A 3I5CA 2PMHA 1MU2B 3DI6B 4P71A 1SC1B 2DR9A 2CJYB 4I2PA 4DV1J 1VQNS 2Q6CA 1IKYA 2HHUA 1KDNA 4ZPDA 4DSEA 3TAQA 5DQIA 4AE5A 2W8KA 1T7PA 3D6FB 2ADLA 1FXDA 7FD1A 4PUOA 4V19J 4QCLA 4OZLA 1F3VA 1VIOA 2HIYA 2IRUA 2ZC3A 2V6AA 3HVTB 3KDNA 1SH3A 4BHQA 2BM0A 1VQ8S 4JV5F 1IR1A 2U2FA 1S4FA 1V3ZA 3PX0A 4ECXA 2G0IA 4QPTA 2IMOA 4DR1J 4MIBA 1H74A 1J2VA 2JLEA 3T5KA 2AV5A 1MNEA 2HQIA 2HMIA 3MMBA 1S1TB 1J5EF 1VBYA 3TARA 3HSJA 1Q5VA 3HSGA 4NX9A 3UNYA 1CLFA 3M2RA 4DXLA 4O0NA 2FVQA 4A8MP 5KFEA 4DFPA 2IJNA 1VQPS 2EKNA 4KKOB 2JVOA 1UWBA 4TQRA 5DG9A 2HQCA 3N9UC 2GVDA 4NXMF 1UZDA 3NLCA 2AJ4A 6FDRA 2GAHC 2MKSA 2PFDA 2ROPA 2VFTA 3MPVA 3SFUA 3QT5A 3K5LA 3IA0A 3NXZA 4OJ1A 1JJHA 3SFGA 1RT3B 4PXBA 2JZ5A 3WIVA 3T1AA 1RT4A 1TMMA 4WE1A 1GNKA 2DCLA 3AHPA 3PG9A 3SSSA 2AKWB 4M1KA 1IRQA 2AP6A 3V4IB 3OSPA 1M5PC 3OL9A 5HL7Q 3UO0A 2G0CA 4DHVA 1OYDA 2DY9A 4HV0A 4ED7A 1NPRA 2AEMA 3MTJA 2DHGA 4FVCA 2MKIA 4B9VA 1HMVB 2MY8A 3TUPA 2QYGA 4DZ6A 2Q79A 4UZBA 2C1EB 1WELA 2K29A 4A8SA 1LWXA 3NOGA 4X84A 4DUTA 1MWYA 4GVBB 2CQGA 2ROEA 2E5LJ 4CLTA 3D0HE 1NUEA 3BN4A 3E2EA 3SMZA 5F8GA 3RW6A 3Q83A 3P6YC 1NSKL 1PBAA 1WC1A 3W62A 5A2QU 4HDGA 1HWLA 2CQ2A 4O3OA 3QT7A 3K5OA 3AA9A 3DRSA 3NGKA 5KOXA 5KFCA 4NCBA 1CJVA 4LF6F 1VCTA 5DG7A 4DS4A 4PYDA 5IT4A 1X0FA 2P2CB 3K7RA 4DFKA 3J80U 3KLGA 4F0KA 2VD3A 2DR6A 3QFWA 2YNGA 1JLGB 3I55S 1H6KX 5CAAA 2HS3A 2ATLA 4QWBA 3ENAA 4JI3J 1U8WA 3DM2A 2G1HA 1Q8BA 2MZJA 4DR3F 1WOPA 2EG1A 3RTVA 1IBLJ 4Q7AA 5A6WA 2SXLA 3W8GA 4DR5J 4F36A 3MEGB 3VCDA 2HBZB 1VBXA 3PCOB 1FDNA 2YKQA 1R0AA 1PAUB 2YNIB 3BREA 1KQFB 3D0IE 2ZH5A 4DFMA 1B3TA 2UXDF 2R7OA 5EDWA 1VLOA 3RZAA 4ZHRB 1XIQA 2O66A 3C3LA 4FBTA 3QT8A 4K4UA 2K06A 2DBBA 3GJSB 3LF0A 4C0OC 4QIVA 3E01A 3WDOA 3FSXA 1N32F 3U1MA 1NLKL 2BQ3A 4QU7A 4URQU 5D0GA 3FMWA 1S0OA 4K59A 4PAAA 4DL7A 2B4VA 3J80Y 1NK0A 1G1XA 3DLJA 4JI4F 1IUJA 4YR2A 2YKOA 3JSMB 3VAMA 2BNZA 1VRQC 4DL6A 2CG4A 1DQ9A 3LA0A 4FXEA 1CG2A 3PFEA 1KVIA 1HA1A 1IVZA 1RWVB 2LYVA 2KXNB 4X4OA 4N7TA 1M1GA 4DUYJ 1BDTA 3MPUB 2MQPA 4L3NA 2XMKA 4TXSA 3OTOF 3PW4A 3RB0A 5HLFA 4KGVB 1WC0A 4OZJA 4DI6A 2Z30B 1QAYA 1W2BR 4Y2MA 2QMXA 4O3NA 1VI7A 2HNZA 3HKWA 5F3ZA 4USHA 3N4WA 5H9EK 2E9RX 3D3BJ 1F2GA 1HBNB 3KLEB 1UKUA 1FK9B 2WONA 4P2MA 3UVJA 4CRJA 1V3RA 1P6TA 2M52A 3UI3A 8ATCB 1C4CA 2XCPA 3KOAA 1M1HA 1F60B 4NL5A 2KU7A 1N48A 4NYZA 1R27B 4G1IA 3F44A 4JI7F 2QSFA 2VFRA 3MM7A 4YY3F 2EC0A 2ALYB 3ZZZA 1NHUA 2WBRA 1CJKA 1RA7A 4Y3CA 1CS4B 1SQEA 3FJ2A 3HVWA 2VG5B 3VVTA 3NAHA 1UETA 2A2DA 4CYUA 2B9XA 4E2FB 3AD8C 3OD2A 4L6V3 2FVRA 1V3SA 2KXFA 2MJNA 3UWTA 3KJVB 1ZZNA 2E1PA 4LIWA 1SXLA 5F0UA 1NKEA 2XMUA 2V8GA 3QWPA 2YWHA 1UJ5A 4NASA 3A12A 3TX8A 2NREA 2B56A 2QLFB 4O23A 5M2PA 2FZKB 4DV0F 1IBCB 3PJXA 5F0WA 1BQMB 1GT8A 4N76A 2FLOA 4M5KA 3W5XA 1PO6A 3M2RB 4WP3A 2XHCA 4OHXA 3U1LA 2BJDA 2FJBB 4MK9A 4EK2A 2KJVA 2LFVA 2RRNA 3CT9A 5ITHA 3HLUA 3UCGA 4HYKA 4IOAQ 2RUGA 1H7XA 3CO0P 5GAGI 4N41A 1YDLA 3L4BC 2LU1A 2YX1A 2QX0A 3R5BA 4LF1A 1Y0HA 1ZA1B 2HFUA 3E3XA 3VQSA 2P6SA 1XC9A 2HYIB 2AJ0A 3AD9C 4KIAA 4DR5F 3VALA 4LF9J 2GQCA 2HHHF 3OVSA 1TKDA 4EBCA 2HWHA 1BQNA 1JLFA 1LXNA 2R42A 2Y8YA 3KLHB 1EKSA 4F0HA 4ECRA 4CH0S 1N0VC 2LEAA 1FT8A 5M2RA 3IGVA 3VAIA 3KK1A 5KFBA 3W9JA 2IPOB 1FRXA 2EFQA 4Y2CA 5KT4A 2ZH4A 5F3TA 2CQ4A 1HIYA 1RWXB 3H20A 3NY0A 1A7GE 1Y9OA 2KO1A 3M8SA 2YY3A 2BJEA 1XEZA 4C3LA 3CCJS 2PGCA 3ZTSA 4I68A 5IC4B 4AUKA 3HXMA 1L3TA 1C4AA 2CDQA 3W2WA 2Z2MA 1GXTA 4OFZA 3BBCA 5DM6Q 5DETA 2AYEA 1PYSB 3AH6A 2DPJA 3UNGC 3Q2SC 2PI4A 1WSVA 3FSYA 2LQ5A 4NWBA 2ASJA 1IBKJ 4FF3A 3M8WA 5KFFA 4H4KC 3FMTA 3J7YI 5F41A 4FNHA 5J2MB 4F4XA 2J0XA 1B0TA 4JV0A 1RHMB 1S5ZA 1TTHB 3HZEA 4CIOA 1XMBA 2AYMA 3MMAA 3R6LB 2EI5A 2FHKA 3M8PA 3MUTP 2GVZB 4K2XA 3O1LA 2HZCA 1BXNA 3BS9A 3A8EA 4FXVA 1YJRA 2Y9HA 4N77A 5KT5A 3MEGA 2R9LA 1WKKA 1TMJA 1YJWS 3QT6A 4DR6J 3FBBA 4USJC 4USMA 3BGRB 1Y10A 2I8EA 4LJMA 4TY8A 1G3OA 1ZZFA 4KV8B 5HROA 3JS9A 2BE2B 3LGMA 2VPXB 4NA2A 4D3HA 5LMNJ 3GXQA 4ZJLA 2ZBPA 2V67A 5C2GA 2EBEA 2YKMB 1R8BA 5L1KA 5AE2A 3MEDB 2CAJA 2CPGA 3F56A 3LP2A 3DRSB 2ZH1A 3KHLA 4DL5A 1WWHA 4DX5A 3CULA 3C8YA 2BW2A 1Y5IB 3CD0A 3B82A 3VAKA 1KR4A 3ZXWA 5K20B 4LF7F 3QRQA 4B3OA 2MKHA 4KGKA 3FDSA 3BSNA 1KFDA 1OSCA 3HKZD 3TWZA 1NH7A 3W2VB 1G6BA 1RT6B 1FJCA 3SV3A 3KHRA 1I1GA 2RU3A 3R5GA 2IM3A 5CCLA 4OX8A 1IN0A 1WORA 3AOAA 3GIMA 4DV1F 1NKBA 1URRA 5CXTA 2V94A 3H59A 2OPRA 3EVWA 4PG8A 4RW6B 2VPYB 2QG9B 4TU9A 3GPAA 3W9HA 5KFHA 4UTGA 1X4GA 4NCGB 1CJUB 2BE2A 5LOQA 1F0XA 4RUAA 3P3DA 1F9HA 1FX4A 4XTTA 2UVUA 2XG8A 4LF4F 1RT4B 5KG2A 4X4PA 5FJ4A 2D3ZA 2DNMA 2EBGA 3O8WA 4K7QA 4P7VA 5D4OA 1UPMB 5A8RB 1XBWA 2ILZA 4ZPTR 3EZUA 4CLYA 2MXYA 4ELUA 1V5IB 3PRVA 2I38A 3ET6A 4EEYA 2W9CA 4MJKA 3D4JA 4V19X 4AQYF 3CCES 5IM0B 3D6TB 5F9LA 2J0WA 1CC8A 5A6PA 2MGZB 2KZMA 4JYAF 4DCOB 3L3CA 3OVAA 1RJJA 4CWBA 5M2UA 4U6PA 2W8LA 4ECTA 1SV5A 3TO8A 4NXNJ 4OHYA 1KP6A 3SQGA 2KJWA 3OL8A 5K14B 3DFEA 1N56A 4XPEA 4IRKA 2CPEA 2MGZA 2Z2ZA 3N6MA 2MLXA 5KFUA 1JLEA 4KV8A 1SL1A 4RNOA 2Y0SD 2F63A 4PG6A 2OJ3A 2OPPB 5ETVA 1ZAWA 5DZ6A 2KXHA 4J90A 1SKSA 3KLGB 3KJVA 1DTQB 4LBPA 3ILJA 2KFNA 3CJ0A 2CG8A 4LF5J 3OLAA 4IKAA 1Y7PA 2GVDB 2RS8A 3Q22A 2IA6A 3CCRS 1UVMA 3GV8B 4N56A 1LOUA 2AGQA 3IWNC 3IBFB 3AOBA 3VTIA 1PJ7A 3BQ1A 2YTCA 4XO0A 4DF8A 1S99A 4Z7YA 2JFKA 2W7AA 4NLGA 1N88A 2BKPA 3FFIB 4E8UA 2D1CA 1XERA 4LR8A 5B0AA 2WAQD 2W25A 4PPDA 3IN5A 2JWNA 4JI8J 2BA3A 1ZPVA 3DMJB 4HACB 4TLQA 4CLSA 4NE9C 2RUSA 3H87C 1WD6A 2H3EB 1LV5A 2C28A 2MTLA 2FY8A 3CIZA 5ETRA 3V6KA 3BPSP 1H72C 3MM9A 4ELVA 2CXEA 4OYWA 1HWIA 3A1YG 4ETXA 1RTIB 3P45B 4ECWA 1SC6A 3PFOA 1U1LA 4PQUA 4RUHA 1J27A 1LEOA 2ZE2B 2YBVA 2B9WA 3EGWB 2D41A 4ZVEA 2RDJA 3GR1A 5EX0A 5CYJA 4F50A 3N6NA 3PYDA 2B8QA 3GG0A 1TUGB 2GMLA 2HSEB 2HURA 4ED6A 2W2NP 4ANDA 1FKOB 4PG4A 2MB0B 3LH2S 4NLDA 2ZZNA 2H5IB 4FYYB 3GQCA 2DNPA 3M8PB 1FJEB 2ZE2A 4B3MF 3PYFA 1FKPB 5MAOA 4X64J 1RP5A 1HL6A 5G0RB 2ZBIA 3OXLA 1FI4A 3R7BB 1JKHA 4ENOA 3ZZRA 2MZ1A 2XYPB 4J9PA 3TQEA 1NJXA 3DLLQ 4QWAA 5A0YB 1ITPA 3BYRA 1V5VA 3CJ5A 8RUCA 1BAZA 1ZBTA 3SDEA 4AXIA 2VODA 3WX8A 1UEKA 4RW7B 2YKNA 3TQ1A 3FCHA 2FLLA 4W92B 3GILA 2ZEJA 4FN5A 3DM2B 3ZTPA 1FVQA 1MU2A 1N52B 1XN9A 1LW0A 2JOQA 3B54A 2M9KA 3UDLA 1IKXB 2C3OA 4K0KF 2GCFA 4WFAQ 2JBVA 2DH7A 2MEWA 2O1PA 4EO6A 4ICLA 4DQIA 4H54A 1Q78A 4IOCQ 3ZFVA 2UUBF 3TW0A 3POTB 1WEXA 3WZ0A 1S77D 1YI2S 2XLIA 3J81j 3CGIA 4I7FA 3RB4A 2CNKB 3I0SA 1RHRB 1Z1ZA 4EYIB 4HTIA 2Y1JA 3PO4A 1JLCB 1JJ2R 3HFVA 1FESA 2YVSA 1S12A 2N3LA 2XGQA 5HJXA 2HRUA 4ZVGA 1VC5A 2N82B 5GAHU 2ADCA 4KGMA 5LMUF 2YWFA 5AXLA 2XHWA 5B0BA 2QEXS 2B8PA 3BZQA 4ZJOA 4U9RA 2EK1A 1JLBB 4B17A 4QBUA 1SQFA 4PXEA 3CD5A 1NJZA 4LMZA 4FYDA 2EEYA 1FX2A 1S1UA 4Z7CA 2R2TA 5GVQA 1T3OA 2DO0A 2NYHA 2GNKA 2RAQA 4USTA 1R43A 3TYTA 2WOMB 3ILLA 3Q8YA 1C1BA 2HS0A 3P4UB 4WBFA 5DRKA 3ZNUA 2W9CB 1N33J 3MR5A 2C3MA 1EETB 2PDAA 3MMCB 3MOJB 3KG0A 3PV8A 1JLGA 4RW8B 3T41A 3Q0AA 1REGX 1KC8T 2FY1A 2UXBF 2UXCJ 3QMQA 1VRTB 4DX7A 2J9EA 4IRDA 3QOQA 1RAEB 2C3PA 4E0DA 1C1BB 1TELA 3US5A 5HMZA 2LEBA 4NOHA 4DV3J 2AQ4A 3ULHA 1X4AA 1RTJA 3GR0A 1UVNA 5DDRC 2HQGA 3EVOA 4B9SA 2EG2A 1NB7A 4WZQA 1FHTA 4A8QA 1CC7A 2BJ9A 1TK8A 2C2NA 2VU5A 3DMJA 1HQUA 4HACA 4HL9A 2XB2D 4K2JA 2BABA 4URGA 4DSFA 3SEOA 4WFXA 1T9UA 2ZD1A 2NZCA 4MK7A 5E33A 3DLHA 1KRPA 1U47A 4N8OA 2R8IA 1Q7YT 3EWGA 2FVSA 3VHQA 5KOWA 2UUBJ 1MLAA 1XTZA 2FDNA 4K4SA 3HM9A 1WJ9A 1PARA 4CO3A 2XY7A 1U2RA 3QLHA 5DLGA 1T9XA 1U24A 1UW4A 2WHOA 3ZTQA 2BDPA 1TVRA 4C8MA 4H4KA 4P10A 5CD4A 4GKJF 3ISZA 3L7UA 1SC3B 3TAPA 1Y11A 3BN7A 2UUWA 4YQWA 4DEZA 5FLXU 1N5TA 1E6VB 3T19A 3CUNA 1T9YA 3NGUA 2RD5C 1JLFB 1RISA 1TL3A 2HNYA 1R7IA 5C42B 3J81Y 2FC8A 2E9ZA 2F4VJ 4M5JA 1YX2A 4LF2A 1X4CA 3HD2A 2G13A 2JX2A 4IG3A 3FBEA 3GFHA 4LVOP 1D9AA 4U8VA 2CVIA 1MW7A 4X66F 1HNWF 1YZ6A 2LCWA 2ZWOA 3NGDA 4MKVA 4C4WA 1I6JA 1TL1B 2B5JB 4YP3A 1FFWB 2VA3A 4DR7F 1NHVA 5H9EJ 2CJKA 3GE9A 4ZN3A 4KAIA 2K3KA 4BBYA 2W2QP 5KG0A 4ECSA 1KVKA 1H38A 3JAMY 1TK5A 1UTAA 4QW8A 3HHDA 4Y2KA 3A8KA 5L9XA 3B78A 4KFBA 8AT1B 2R2RA 4C3KA 4DZDA 3KKFA 3A8JA 3A4TA 5EN1A 1IKWA 2VZ9A 3NGRA 4J7CA 4TYBA 3MD3A 3NKYA 4DQSA 3CVKA 4RBUA 4I6YA 4ZOSA 3UE2A 3I31A 4GC7A 1WSRA 1JXVA 2MZTA 2XGPA 4DR2F 1O0PA 1JLQA 2CWKA 2KI2A 1WF0A 2KRRA 2Q3PA 3CCSS 1K1QA 1WI8A 1OY6A 2Z0GA 2Z57B 1RABB 1XNRF 5HMYA 1NH8A 1NSAA 3AODA 2R7XA 2H4YB 3C14B 2XY5A 2KKEA 2WVFA 2W01A 2KT3A 3AT1B 2G9OA 2DNKA 3D1HA 1VIXA 3MEDA 4LF5F 1GMUA 2FQQB 1PILA 2J7UA 1NK5A 1AYEA 4KB7A 4TLRA 2U1AA 3P8BB 3RU0A 4WIIA 3R7SB 3SQOP 4F4WA 1B0PA 3EYZA 3HJFA 2DRDA 5ETLA 1HHQA 3OTBA 3S01A 3RB3A 1WG1A 4FVMA 4KFBB 2OMOA 2W2MP 4J9OA 1YQHA 3HJVA 3PEHA 2K1RB 1OHNA 2NYIA 1NPPA 3DLKA 4KPCA 1Q1KA 4USVA 3GU0A 3MAHA 3M2UA 1U6BA 2F4VF 1B7FA 1KN6A 3K89A 2CWXA 2KVQE 3KFWX 3OV7A 1RAHB 1RBLA 3P5TL 2KYXA 3BO4A 3DLGB 1ZTWA 3TEGA 1EKRA 1FDDA 1S1XA 3IR7B 4NRTA 1EZZB 1RT2A 5ADZA 3Q8QB 2AJ1A 3GIKA 4OX9J 1Z2ZA 1S0VA 4K4WA 3M9OB 2VG5A 4ZP6A 4YDDB 4AQYJ 4AXJA 2J5AA 1NLAA 1UP1A 2HWTA 2LA4A 2PT0A 3C14A 5DS7A 1URNA 4GKJJ 1DFDA 3P5BP 2BKNA 3LGHA 1X5TA 1LNQA 1H73A 4NI2A 1VLYA 1C1CA 2AY0A 1MMNA 2IC3B 2OPSB 2OUGA 1CJTB 2ZZTA 3AJ2A 3FC9A 3GJRB 5IC6B 4F26A 4ZLJA 1K9MT 4LF4J 2XQCA 4RW9A 4HH0A 4A8WA 4WWSA 1HNIB 2RIJA 3EDQB 3KJQB 3EICA 3X3UA 1F9EB 1FK9A 1GXLA 2WONB 2IIHA 2QZ8A 3H98A 3UVJB 3KLVA 2JSXA 2R7VA 2LECA 2D69A 4DV2J 1WHYA 4ZLPA 5T7LB 2R7SA 4HDHA 2M7SA 1RXOB 2GQ2A 2CADA 1F6TA 1QM9A 3DN9A 3AXMA 3UN2A 4CP5A 4DV6F 4IOBA 4JI1F 4ID8A 2PE8A 1EETA 3QGGA 4NZ6A 2KTQA 2YNGB 1C0TB 3JB9k 1PIEA 1BQNB 1Q8LA 2HFNA 3CB4A 1HHTP 2JNJA 1S7HA 1UEVA 1G7CB 1T03B 3VEAA 5E0OA 4TNOA 3KWMA 4IFVB 3V6JA 1S9FA 3DKDA 5G4DA 1RWUA 4A48A 2DGVA 3OQ2A 3DLEB 1LWFB 5KFWA 4QIGA 4LT6A 2RHQB 3I4HX 4QWEA 2HG4A 1FWLA 1SH0A 1IR2A 5F9NA 2XCAA 2EW9A 2X3GA 5AE1A 3GV5B 5CYQB 5D3GB 3MPWA 2DIVA 1S49A 2FIUA 3C19A 3DRPB 2ZJQQ 2BR0A 1JB0C 2CJBA 2CPYA 1UVLA 2XS7A 1HKAA 1CSJA 1S9EA 4A47A 4BDPA 2ASDA 4U7CA 1LWFA 4OI0A 3BGUA 2K3IA 3ZO7A 1VGYA 3W9IA 1OIAA 5LMUJ 2DGUA 3AB4B 2K1RA 1F9FA 3V5RA 4BC7A 3RBDA 3KLIB 3RBXA 2XTJP 1I3OB 1B01A 1RT7B 5IT9U 2H1OE 3G6YA 4CLLA 2H51B 4XDDA 5FDLB 1SIWB 1YK9A 3LAKA 4M8LA 3ETMA 4WFZA 1Q4RA 1WC4A 1R8CA 2IAJB 3OFFA 4I2QA 1S97A 3NP5A 3C15A 2XMWA 2VOPA 2RF2A 4FYVB 5KAKA 3THTA 2YH0A 5AXNA 1OO0B 2OI2A 1S1VB 2QV6A 3NS5A 2D3OR 1IBKF 4K0KJ 3H0PA 4PCQA 4WU3A 4B08A 5EHHA 3OFGA 1D3WA 3LQVA 5HMWA 3GMGA 5B7WA 2KFZA 2IAJA 1UVJA 5DM7Q 2VUGA 1WC5A 1D9FA 5F8JA 3DHXA 1X9SA 1Q81T 2UUCF 2WVBA 2ZH2A 5A8WA 3RAMA 4P74A 1NHKL 4HHHA 3FBCA 3EE3A 2G1DA 3U7JA 4YUDA 2HNDA 4K4YA 2EK6A 5H9FJ 2HLTA 5L1JA 4K4VA 3HSDA 2RDDA 3CJTA 4NA1A 2OD6A 2XZWA 1WEYA 2DVIA 3Q89A 1QTGA 3MMCA 3WC2A 4PG7A 5HBMB 3V4IA 5B0DA 4PXCA 1HWKA 3HULA 2V69A 3FSIA 5AXMA 1TV6B 4CTAA 2BRLA 3I82A 4WTOB 2HHHJ 3LW5C 4QIWD 4LF9F 1OJ4A 3MGJA 3SDEB 3IR6B 4DU8A 4NLTA 2HZVA 4Q2LA 3QZ7A 2ZH6A 1U1QA 2FVPA 3KTQA 3U02A 3VV2B 4ALZA 3Q24A 3N28A 2APOA 3V6HA 2DRAA 1HBMB 1GXUA 2DNQA 1X60A 4RPFA 2V4JA 1DLOB 4Y00A 3PR5B 5K14A 5D6GA 2BQUA 3O6QA 3TR5A 3NGTA 1X4DA 4EI2A 3EGVA 4CLFA 3QO9A 2FJDB 2O3DA 4IQXA 3DU6A 4ZPVR 1Y3JA 3DC2A 4ATNA 5DQGA 3K0JA 1MSWD 2NZ4A 1FDAA 2AJ2A 2ZOFA 3FRYA 1AROP 3GYXB 4GMKA 4DX8H 4U95A 1MN9A 2VICA 1SUQA 2YWGA 1MMLA 4OYBA 4PWUA 4OZ1A 4FYWB 4FDFA 2V2QA 4QR2A 4P9SA 1DHMA 2YQ0A 4Q43A 2Q43A 4UOFA 4UUWA 3MCNA 1WC3A 3BO3A 2FTRA 2ZBRA 3M4XA 4NZ0A 1T05A 1JJCB 4AFFA 4WFYA 2VKZG 1CJKB 3EXCX 3DRRA 3MDFA 3PHEA 1BWEA 2PEBA 3MUVP 5E3CA 3RR7A 3TI0A 4OHWA 4DF4A 1Y00A 3BR9A 2HGLA 3KG1A 2NUHA 4LUBA 3CC4S 3CD6S 3IRXA 5D77A 4OLOA 3JSRA 1X5PA 1B64A 5IQ6A 3TUZC 3KK3B 3C66A 3KLEA 1GAOA 2QLBB 3H8YA 3UD5A 2K2PA 4OYMA 2NPIA 3DYAA 3IS9B 1PG5B 3EVMA 4L3KA 1XR7A 5D4PA 1T03A 1XR5A 2CZVC 3IAS9 1HI1A 2CQPA 3FEXB 5JMNA 1S76D 3K58A 4CT9A 1E6YA 1WDDA 4K5RA 3HHEA 1NJIT 2B7CB 1N6QA 1X93A 4MYTA 2H9ZA 1N32J 1D8YA 3G82A 2R7QA 2ZUAA 3BSAA 4ILRA 4J9NA 3KMQA 3U27A 4GC6A 3WIUA 2C2MB 3R2DJ 4DUZJ 5CCMA 3QLHB 3Q8VA 2HW3A 4MK8A 3T1YF 2ZM6J 5E41A 2OH2A 5EUHA 3CJKB 2RRAA 1PSDA 1P94A 2HBYB 1HNXF 1DTTA 3DRYA 5HN0A 3KXDA 2KYZA 3H40A 5KG4A 1HYSB 1IBLF 3CDBA 1S0NA 3CJRA 4OYZA 3MXHP 3HZGA 5HVGA 4C11B 5FDLA 4IO9Q 2R8JA 4C97A 2V4QA 4LF7J 3GSDA 2FZCB 2IDLA 4QIFA 2C22A 1A6LA 2J6UA 4KPYA 3R1HA 3R3TA 6AT1B 1NBEB 1OPIA 1L3VA 4FNIA 2OGUA 2R8KA 3B6BA 1ZOTA 3IM8A 2DISA 1S72S 1N6QB 2Z2YB 4TYAA 2L9DA 4UQGA 3QRPA 4XAKA 3KUEA 1SKWA 2VOOA 4P7TA 2PMWA 1SJFA 4GKKF 4JB8B 2J6TA 1S6UA 3G4SS 1M5VC 4UY85 2KB2A 4FF4A 4O3QA 3CJ4A 3BH7B 2RQCA 4JI5J 5C2CA 5LMNF 2WB1D 3TEHB 3Q23A 2DITA 4WXOA 1XMQF 4RU2A 2OEMA 2KL8A 4M5IA 4Y65A 3WC0A 5MLCV 3DOKA 3BPDA 5J2PA 1DLOA 1GTHA 4DBQA 2AN7A 1HW8A 1FE0A 2A2CA 2EWHA 2OAUA 2CZ4A 1FEHA 4MYUA 2RHSB 5AJ3F 1RGVA 1MYKA 5F8LA 2BE7D 3LGNA
chains in the Genus database with same CATH topology
1X93A 3GXQA 2BNWA 2WVBA 2BNZA 3BKFA 4HV0A 2HZAA 3BKTA 2BA3A 4FXEA 1PARA 1BDVA 2JXGA 2CAJA 2WVFA 3H87C 3QOQA 2CPGA 2GPEA 1B01A 1Q5VA 4ME7E 2H1OE 3FMTA 1U9PA 1NLAA 2K5JA 3OD2A 1BDTA 3PHTA 1EA4A 3VEAA 2CA9A 2K29A 1BAZA 3LGHA 1P94A 2BJ7A 1QTGA 2JXHA 2WVDA 2BJ8A 2K6LA 2WVEA 1Q5YA 2F1FA 2AY0A 4D8JA 1ARRA 2K1OA 2BJ9A 3QSIA 2K9IA 2WVCA 2JXIA 2CAXA 3VEBA 1MNTA 2PC6A 1ARQA 3FT7A 1MYLA 2BJ1A 2HZVA 2BSQE 3VW4A 2NZCA 2BJ3A 3BKUA 1MYKA 2Y3YA 2RBFA 1B28A 1IRQA 2KELA 2CADA 2FGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X93 A;  3GXQ A;  2BNW A;  2WVB A;  2BNZ A;  3BKF A;  4HV0 A;  2HZA A;  3BKT A;  2BA3 A;  4FXE A;  1PAR A;  1BDV A;  2JXG A;  2CAJ A;  2WVF A;  3H87 C;  3QOQ A;  2CPG A;  2GPE A;  1B01 A;  1Q5V A;  4ME7 E;  2H1O E;  3FMT A;  1U9P A;  1NLA A;  2K5J A;  3OD2 A;  1BDT A;  3PHT A;  1EA4 A;  3VEA A;  2CA9 A;  2K29 A;  1BAZ A;  3LGH A;  1P94 A;  2BJ7 A;  1QTG A;  2JXH A;  2WVD A;  2BJ8 A;  2K6L A;  2WVE A;  1Q5Y A;  2F1F A;  2AY0 A;  4D8J A;  1ARR A;  2K1O A;  2BJ9 A;  3QSI A;  2K9I A;  2WVC A;  2JXI A;  2CAX A;  3VEB A;  1MNT A;  2PC6 A;  1ARQ A;  3FT7 A;  1MYL A;  2BJ1 A;  2HZV A;  2BSQ E;  3VW4 A;  2NZC A;  2BJ3 A;  3BKU A;  1MYK A;  2Y3Y A;  2RBF A;  1B28 A;  1IRQ A;  2KEL A;  2CAD A;  2FGC A; 
#chains in the Genus database with same CATH topology
 2KZZ A;  4FXW A;  1JMT A;  2ACY A;  3NNC A;  1UW9 A;  4RW4 A;  4I7F B;  5AJ3 J;  4B9M A;  3R5A A;  1VQL S;  1RTZ A;  2BXJ A;  3CWJ A;  4PRF A;  1VS3 A;  2VB6 A;  1RT1 A;  1QJH A;  4ZVQ B;  2ZJP Q;  2CPJ A;  2M0G B;  2NXU A;  3ENV A;  2XYH B;  4MIA A;  4WK3 A;  2DB1 A;  4BC9 A;  1VR6 A;  4KE5 A;  1PGZ A;  4NXM J;  3K59 A;  1NDL A;  1T3N A;  4ZJQ A;  2A10 A;  2QL9 B;  4JBC A;  1IJE B;  2HAF A;  2V4R A;  4B3O B;  4NLO A;  2P9E A;  2HRY A;  5A8K B;  3IP0 A;  4MAK A;  4P6Q A;  1FTR A;  4J9R A;  2DEJ A;  1QSL A;  3ONQ A;  2VJU A;  3I9V 9;  1RT6 A;  2LVW A;  1GQE A;  1IKX A;  2DGS A;  2XBP A;  1M5K C;  2AHO B;  5F8H A;  4YFU A;  2EC2 A;  4DR1 F;  3EUN A;  3ILI A;  2F65 A;  3QZ8 A;  2KT5 A;  2VG6 A;  3F41 A;  4JV5 J;  2ALZ A;  2UV8 G;  3X1L B;  5FII A;  4YOE A;  5GAE I;  1HQE A;  2C2O B;  4HLB A;  2HHV A;  2AW0 A;  2AJF E;  1SB6 A;  3FFI A;  1PC5 A;  4F4Y A;  1DZ5 A;  3MR7 A;  4PWD A;  3MAQ A;  3OLB A;  3PW0 A;  4ME7 E;  5KT7 A;  3MR3 A;  1Q8I A;  1X4F A;  3ZZT A;  3AB2 B;  1QE1 A;  3A3O B;  2IFX A;  2YKA A;  5LXY A;  2XM3 A;  1IR0 A;  2X51 A;  3HI9 A;  3GJT B;  2ZM6 F;  1VQS A;  1EX8 A;  1IKW B;  5D15 A;  2FVC A;  4FPI A;  1E6V A;  7AT1 B;  2MQQ A;  5EWG A;  1FKA F;  4B3T F;  4PQU B;  2AMC B;  1RT3 A;  1OWX A;  2WSE C;  3D0G E;  3T9N A;  5GAD I;  3KK2 B;  3MM8 B;  3NO7 A;  2QA2 A;  2OHD A;  4P2X A;  3QO9 B;  2MZS A;  2IMW P;  1NEE A;  4DR4 F;  1PCA A;  1NXI A;  1S9G B;  3KK3 A;  2DR7 A;  3Q8S B;  2KEL A;  1R31 A;  2HGN A;  3G8Q A;  2BV3 A;  3H42 A;  3KLH A;  4F4Z A;  1WAC A;  5HAO A;  4FYX B;  3M32 A;  1NAQ A;  2VG6 B;  2JVR A;  1Z4U A;  2GX8 A;  2JLF A;  1EIY B;  1EQM A;  1L3S A;  2ADB A;  4RL1 A;  1KHV A;  2V68 A;  3FVY A;  2A6O A;  1U1P A;  3DXS X;  1U45 A;  4PUO B;  3ZNJ 1;  4KY3 A;  2YKP A;  2JL9 A;  3ZZP A;  1VQM S;  5E5N A;  4DG1 B;  2BRK A;  4YY3 J;  4O3R A;  1T05 B;  1LK5 A;  4DL4 A;  3H4B A;  4JI7 J;  1ZS6 A;  1QDU B;  2AZ1 A;  2A2B A;  3MTK A;  2LQJ A;  1M5O C;  3M05 A;  5L1L A;  2IA0 A;  3KUG A;  2MST A;  4M5D B;  4QJV A;  3RBE A;  4IUF A;  4F4A A;  3PTW A;  4NCG A;  1JXE A;  2AEF A;  5K8P A;  3OTD A;  4IFV A;  4DWI A;  2XLJ A;  1HWU A;  3CO9 A;  3A3P B;  4QR1 A;  3K17 A;  5C24 A;  4OHZ A;  4DX6 A;  2BEF A;  5KT2 A;  4U8Y A;  3PIO Q;  4DDF A;  2BNW A;  1NDK A;  2GMH A;  1TL1 A;  2F5G A;  1OY9 A;  1MMD A;  1RU2 A;  1FFG B;  4IDK B;  4UOC A;  1HWJ A;  3DGP A;  4XK8 C;  4C11 A;  1U26 A;  2D74 B;  2IVY A;  2VON A;  3W7B A;  3L09 A;  1P9Q C;  1AZS A;  1S6P A;  2RU9 A;  1RHJ B;  1LFP A;  2VQF F;  3MCM A;  3FGV A;  5J2Q B;  5L1I A;  3O5T B;  2X1A A;  2IHR 1;  1OG7 A;  2YNH A;  4UF4 A;  2F7V A;  2VV5 A;  1W26 A;  3FQL A;  2M3D A;  3BGF A;  1SCJ B;  1ZM3 A;  2UU9 J;  1RWN B;  2XI3 A;  4IH5 A;  3LP1 A;  3IMQ J;  1SIW A;  3CJK A;  2HK3 A;  3D5M A;  4NPO A;  2B4P A;  3MD1 A;  2JH3 A;  2LKZ A;  1S6Q B;  4ZCK A;  3K57 A;  3T5J A;  3ISN C;  1RTD A;  2QT7 A;  2J7W A;  4YS2 A;  3G96 A;  3OBI A;  2I6W A;  2ACM A;  5IFM A;  5J1P A;  1F5B A;  5KG5 A;  3MM8 A;  2FYX A;  2JJ4 D;  3TZW A;  2J8A A;  3ZTR A;  1KS2 A;  4YME A;  5BR8 J;  4DR3 J;  3OXF A;  1TVR B;  3P96 A;  5B0F A;  1LK7 A;  3G6V A;  2O67 A;  3MF5 A;  4HI2 A;  4ZIT A;  4DSI A;  5HVF A;  4JI0 J;  1R8H A;  3MCO A;  1S6Q A;  2PEH A;  3M8Z A;  3PDN A;  2ROG A;  5D78 A;  3TP2 A;  4DJB A;  2POK A;  3OR2 A;  5LXR A;  4MT1 A;  2KM8 B;  3SCI E;  3VGT A;  1S10 A;  1T95 A;  1SC4 B;  2DGO A;  1RB0 A;  3WX4 A;  4ZLL A;  2NUU G;  1S1T A;  2HQD A;  2A3J A;  4J9V A;  3I0R A;  3RAQ A;  1R0C B;  4FP9 A;  4RNN A;  2WVC A;  2AJQ A;  1V9O A;  4CO5 A;  3PYG A;  1VQ5 S;  3KNA A;  2F3J A;  1KNZ A;  4CLW A;  3G9C A;  2VBZ A;  4CLZ A;  3CPW R;  1I94 F;  2E5L F;  3ZZY A;  2VG7 B;  2CQH A;  4USU A;  2DXD A;  2WB4 A;  3ZTO A;  5DQH A;  3V6D A;  1N34 J;  4PR6 A;  2V9W A;  4A8F A;  2BE9 B;  4ES1 A;  4DQR A;  2BX6 A;  2BA9 A;  4KGZ B;  1FFS B;  1R0B G;  4NLW A;  4QWD A;  1HQ2 A;  2DTJ A;  1HBO B;  1RT7 A;  3CMA S;  4Q0B B;  5C25 B;  2HNZ B;  5C24 B;  1U0S A;  5A2Q Y;  3CIM A;  1BC6 A;  6FD1 A;  3MEC B;  1VOM A;  1TKT B;  4OV6 A;  4DR6 F;  3KHH A;  4NA3 A;  4ZK7 M;  3NMA A;  3FUY A;  2OSQ A;  5HI7 A;  4M5H A;  1GMW D;  2GVZ A;  3TAM B;  2JEF A;  4I0W A;  2LA6 A;  2WK4 A;  4FF1 A;  4DU7 A;  5I3P A;  1Q8K A;  4J91 A;  3TA2 A;  3OR1 B;  1W7W A;  3OUY A;  1QE1 B;  1HAR A;  2HVE A;  3CW2 C;  1TP7 A;  4UT4 A;  2VH7 A;  2IJF A;  2BSQ E;  2HHQ A;  4WCE Q;  4NLP A;  2I5J B;  3EMT A;  3V4M A;  3R1L A;  1YJ7 A;  4KBI A;  4S0M A;  1IM6 A;  2AU0 A;  2W2P P;  1VQK S;  3GIJ A;  5KT3 A;  3JYT A;  4ZVH A;  2FHJ D;  4ES2 A;  2A0F B;  4ER8 A;  1RHU B;  2V2Z A;  1MWQ A;  1FXR A;  1FJG J;  2HFZ A;  2I5J A;  4ELT A;  4IR9 A;  4O0I A;  2R2S A;  1KOO A;  4HT7 A;  5E3R A;  2EKY A;  3FMB A;  2F8H A;  3NBP B;  3C16 A;  3Q8R B;  3CMQ A;  5GME A;  2R7U A;  4B9T A;  2E9T A;  1P1T A;  2FLP A;  1DBD A;  2AGO A;  3W5Z A;  4CO0 A;  5KFV A;  3TA1 A;  4WFB Q;  2IM0 A;  1RWM B;  5KFR A;  4NZ7 A;  3KLF B;  1FDB A;  3DCA A;  3MM7 B;  3GYN A;  3RUB L;  4RW6 A;  4DV6 J;  4JI1 J;  2Q66 A;  3EPI A;  1HD1 A;  2MJU A;  1Y5N B;  1TKZ A;  1IWG A;  2DD8 S;  4DV2 F;  1SPB P;  3AFG A;  4FZV A;  3EGZ A;  1XK8 A;  1W25 A;  4KHR A;  2M8D B;  3UDV A;  2F8M A;  3BH6 B;  3LJP A;  3IG1 B;  1AB8 A;  1U8S A;  1Y5L B;  2KHD A;  1DAR A;  2M5Y A;  2RNE A;  2VG7 A;  2C3U A;  3B4M A;  2VF3 A;  3CCQ S;  3QWU A;  2UUA F;  1UFW A;  1IBM F;  4NI2 B;  4AL7 A;  2W9B A;  1LWC A;  2FB0 A;  2RJZ A;  4J9U E;  1BQM A;  2DNO A;  4NLY A;  3WHI A;  2C2D A;  3HHL D;  3M6X A;  2H3A A;  2HRT A;  2VJV A;  5BXI A;  1WKL A;  5J1E A;  1ARR A;  3AXK A;  4F02 A;  3CD7 A;  3DXB A;  5KFN A;  4X62 J;  4OX9 F;  2CAX A;  2XLK A;  4DOZ A;  3VW4 A;  5HK4 A;  1GH8 A;  2P9C A;  1LW2 B;  3KG4 A;  5SUH A;  2IBO A;  1S9E B;  2Z56 B;  3KNG A;  4YB5 A;  2NSB A;  4JUZ A;  5DDO C;  4C8O A;  2BAC A;  3AQP A;  3SBM A;  1JJ4 A;  4LIR A;  1QAX A;  2VC1 A;  3M8R A;  4JV1 A;  1Q16 A;  2XZD B;  4B9L A;  1BLU A;  3EGN A;  5E3Q A;  2YXL A;  1RBO B;  2CQI A;  2L9W A;  3DRX A;  5CQG A;  4F3M A;  4WJB A;  1RTD B;  4R0E A;  4TU7 A;  2RT3 A;  4M94 A;  3JQK A;  2LXU A;  3JSY A;  3TOQ A;  4CH1 A;  2PD1 A;  2I1R A;  3E01 B;  2V34 A;  4JI0 F;  1EAY C;  1H3D A;  4OIX A;  1VC0 A;  4I2Q B;  4Q8E A;  5KG6 A;  3D54 A;  1N4L A;  4DPU A;  3G8T A;  3BB5 A;  4LQ9 A;  4N5S A;  1U6F A;  3N5F A;  3OVB A;  4QPX A;  5JVH Q;  2JXI A;  1CUL B;  1KQS R;  4MH8 A;  4F67 A;  2D7S A;  3HD1 A;  3MEC A;  1N54 B;  5J2N A;  1JLQ B;  5HAN A;  1KOH A;  1KQG B;  5FD1 A;  1EP4 A;  1ZTT A;  1KLN A;  4DFJ A;  3QID A;  1VBK A;  2HHS A;  4EFA C;  2BKO A;  3G86 A;  3C6T A;  4ZVF A;  2QA1 A;  2GGP B;  1O5J A;  1X5O A;  2E7W A;  3MI7 X;  2KRB A;  1R6V A;  2YKN B;  1FE4 A;  3HX9 A;  3TVZ A;  3FKB A;  5IZH A;  5CH7 B;  1YKW A;  1Z2L A;  3HT0 A;  3TVY A;  4ED5 A;  5KFA A;  2AX1 A;  1UZH A;  2WVE A;  4P75 A;  5EGY A;  5KT6 A;  5IT0 A;  4DV4 J;  1HNW J;  1YJU A;  1S79 A;  3OJS A;  4MTP A;  2LQ8 A;  3SYZ A;  1OYE A;  3G87 A;  4LF8 J;  2MKY A;  2FUG 9;  2LU2 A;  2DKO B;  2YPZ A;  3QIP A;  3LTO A;  1VRU A;  4OI2 A;  4QZV B;  3VEB A;  2QLW A;  4X65 F;  4AL6 A;  5IWA F;  1ZET A;  3OR2 B;  3VQT A;  1YIJ S;  4OX6 A;  4DQQ A;  1FKP A;  4M95 A;  5A0Y A;  3ENW A;  4OI1 A;  2Z58 B;  2G2Y A;  4JI2 J;  5HJY A;  2V8P A;  2Q2K A;  1SQG A;  2ZNY A;  3DU5 A;  4C9D A;  4IG0 B;  1NPK A;  1VMB A;  2Q1L A;  2DH8 A;  2MQO A;  2ZOG A;  2BAN B;  3M8Q B;  3MM5 B;  4ES3 A;  2GZO A;  3IR7 A;  1S1X B;  5JUM A;  3CCU S;  1HPZ B;  1T11 A;  2P5V A;  2XO6 A;  3IBC B;  3H5Y A;  3OL6 A;  2OKQ A;  3HHL B;  3ITH B;  1TK0 A;  1T9W A;  1TL7 A;  3LPY A;  2E1R A;  4LSN B;  4WE1 B;  1HBU B;  2B7B B;  2EFV A;  3SI8 A;  1SI9 A;  2MHE A;  1XJW B;  3L95 X;  2F8E X;  3GG1 A;  4M5L A;  4QWC A;  1HBO A;  3QJP A;  1CS4 A;  4DV7 F;  3VR1 A;  1QTM A;  4YEA A;  3IR5 B;  3BSC A;  4MIW A;  4FKX A;  4UZC A;  4ECU A;  4OI4 A;  1OSD A;  2LQ9 A;  2DHH A;  2FPH X;  5KFI A;  3M2V A;  3RGI A;  4QR0 A;  2E1M C;  3LP0 B;  4C0B A;  4G1P A;  3NWR A;  5DJB A;  1QLN A;  4X2B A;  3CCT A;  2CPZ A;  2VFV A;  2ZOM A;  1RAD B;  3HCX A;  2W24 A;  3IRW P;  4LR9 A;  1X7V A;  1LKZ A;  4QW9 A;  3GFX A;  3BQ0 A;  1HBN A;  2DNL A;  4J9K A;  5HSP A;  2KVI A;  1N36 J;  1R6Y A;  1XNQ F;  1HD0 A;  4DSK A;  1R89 A;  2ZUG A;  3HVT A;  4EU0 A;  2IRY A;  2VHG A;  1RWP B;  5L8R C;  1RAA B;  2M70 A;  1IQT A;  2HBQ B;  3M6U A;  2H4W B;  2DH9 A;  4Y34 A;  3MPD A;  2HFV A;  4O44 B;  1OQ6 A;  3VWS A;  5A8K A;  4NYP A;  4UY8 T;  5T41 A;  1U2F A;  1RAJ A;  3QYY A;  1X4H A;  3S8S A;  1VRT A;  1OY8 A;  2I9S A;  3D1O A;  3OFE A;  4OV1 A;  5CYQ A;  5THW A;  1NME B;  4C48 A;  5LSL A;  4USK A;  4DG1 A;  2GHV C;  4MKA A;  5KFS A;  3I32 A;  3MPY A;  4CYU B;  4ZIV A;  3S7R A;  2OPP A;  2DO4 A;  3QAT A;  2RKI B;  1PC4 A;  2DGQ A;  2RVJ A;  3QFH A;  2FD2 A;  4OYO A;  4OX7 A;  4W98 A;  4UOG A;  4B3R F;  3NS7 B;  3V2U C;  3SSR A;  5RUB A;  2DNZ A;  2EXU A;  5G0R A;  3GJQ B;  2EFP A;  2ZFH A;  3PM9 A;  4OLP A;  1H7W A;  2NLW A;  2HVD A;  1S6O A;  4UOH A;  2K8G A;  3B8H A;  1IM4 A;  4ZHR A;  1C2P A;  4KYZ A;  5D4N A;  3K8W A;  2K5J A;  1FO1 A;  1X0P A;  2F9J A;  2GQQ A;  2RKI A;  3DOL B;  5CD4 H;  1VQ9 S;  1JLA A;  3PJW A;  2CNN B;  4AYB D;  2DT9 A;  1NK9 A;  2KT2 A;  3N6L A;  4G1Q A;  3CNQ P;  1NSP A;  3GP9 A;  4C8K A;  1VQ4 S;  1TQL A;  2OEK A;  2DGW A;  2VBW A;  1YJT A;  4WTY A;  3Q8P B;  2ZVI A;  4CH7 A;  3MUR P;  1RHK B;  3HFZ B;  2WSC C;  3J81 U;  3GON A;  1Q53 A;  1SUQ B;  2DJW A;  2PII A;  1UFK A;  1TKT A;  4HT5 A;  1ULR A;  3MM9 B;  5KG3 A;  2QC3 A;  1K0T A;  2ZH9 A;  4UUX A;  1RCX B;  3KK1 B;  3GTY X;  1B0V A;  4WKY A;  4ZCI A;  1Q95 G;  4RW4 B;  2PI5 A;  2PA8 D;  2F4F A;  4LSL A;  3FBF A;  2RSQ A;  2HVI A;  3T5L A;  1T94 A;  2MQ8 A;  1SJ4 P;  2CQB A;  1KBR A;  3LWL A;  1LXJ A;  4F0M A;  4QQB A;  1RE1 B;  2COL A;  3MFI A;  1K73 T;  4DSJ A;  2HLU A;  4OYP A;  2P9G A;  1Y4Z B;  1REV B;  2MY7 A;  1NJW A;  2ASL A;  2FJW A;  2J0Q D;  1F1B B;  2WBM A;  3DOM A;  5ETM A;  5HBM A;  2QA4 S;  2K1O A;  3JTO A;  2CRL A;  1AT1 B;  1FKO A;  2IM2 A;  4C3M A;  3M9M B;  3CCM S;  4X62 F;  4NLX A;  1KQK A;  3O2I A;  1VHF A;  5GAE U;  1MYL A;  1FCA A;  3JAM U;  4DPO A;  4RO0 A;  2XEX A;  2CDR B;  2IVF B;  2PMZ D;  2O5D A;  3JTN A;  5DGB A;  5F8M A;  1RAI B;  1U0H B;  3JQM A;  4MFB A;  1FD2 A;  3KYL A;  3CDA A;  2UUA J;  3ZC4 A;  3R5D A;  2CKW A;  1RI7 A;  4PZV A;  1CJV B;  4Q8F A;  1I51 B;  1UL3 A;  1SL2 A;  1UA1 A;  2X3D A;  2CJ9 A;  4KH1 B;  1FRJ A;  1S1V A;  1YJV A;  1HNI A;  5KFY A;  4A8X A;  1ZM2 A;  4YB1 P;  4RUC A;  2C2E A;  3OTE A;  4LRA A;  5HVH A;  5GAD U;  1JX4 A;  2E5I A;  3LP0 A;  3K5M A;  2R8G A;  4H4M B;  4MMO A;  3DOK B;  1DRZ A;  4A8K A;  5BYS A;  1EJ7 L;  1JNR B;  4ECY A;  2QE5 A;  3ELH A;  4OZ5 A;  2P6T A;  1TL7 B;  3I87 A;  1S48 A;  3PVX A;  2B43 A;  1KTQ A;  2B0G A;  3T1H J;  3BBB A;  4ZS6 A;  3D68 A;  1TKX A;  3SZ2 A;  1HNZ F;  2B9E A;  2BM1 A;  2AYB A;  4JI6 F;  3UCZ P;  1IXK A;  1RT2 B;  2V8V A;  1IJF B;  1QUP A;  2WCX A;  2UUT A;  5CHC B;  3TNV A;  3THP A;  3G6X A;  2RS2 A;  1SIZ A;  2JFD A;  3BO2 A;  2HZA A;  2J0S D;  3D3C J;  1LWE A;  1RT1 B;  2Z4P A;  2MHN A;  2CQ1 A;  1Q79 A;  3BDE A;  3L7O A;  2A1B A;  4ZVT B;  1BQX A;  1NM2 A;  1RZM A;  1GMV A;  2GHP A;  3DLK B;  3M6W A;  2JEJ A;  3B4D A;  2HHX A;  1U1O A;  1T02 A;  2BOA A;  2ZDP A;  3A8I A;  5KFM A;  1FNM A;  2QIF A;  2K6L A;  4KO0 A;  3BBF A;  2R7T A;  2UP1 A;  3BSO A;  5K8O A;  2XS5 A;  4LRV A;  4ECV A;  2VPZ B;  5D3G A;  4ZLN A;  4TU8 A;  1QY7 A;  2LQB A;  4I6W A;  5J2P B;  1T9V A;  1YG0 A;  2J7K A;  3UR3 C;  1J5O B;  4F3Q A;  3HHN B;  2B4O A;  2DXF A;  5I42 A;  3BGO P;  3BDP A;  5HAT A;  2L48 A;  2Q6B A;  2UVV A;  3NOC A;  3PR4 A;  2MZQ A;  2HGM A;  2DCU B;  3BKF A;  4U96 A;  2ZKU A;  2QFI A;  3G82 B;  2R4F A;  3MMJ A;  1SJ1 A;  4MKY A;  4JYA J;  4OJH A;  5ETO A;  5GMK a;  2W7P A;  3VAG A;  2DXE A;  5C25 A;  4J37 A;  2E1C A;  1PBU A;  2IYG A;  3TX0 A;  4KTQ A;  2CZ9 A;  2BUN A;  2AYG A;  4R25 A;  3W63 A;  1L3U A;  2V0N A;  2HPU A;  2WW8 A;  4EZ9 A;  2ATC B;  1FD8 A;  3D66 A;  4JOU A;  4N8N A;  1QVF R;  5H1S V;  4B9N A;  4OZ2 A;  3R2C J;  4I2P B;  4KR0 B;  1D1U A;  3G5O A;  4GVB A;  2C2Z B;  3AA8 A;  1BUX A;  4K8R A;  2DEI A;  2UV8 A;  1UWB B;  4O44 A;  2YH1 A;  4LFB F;  3ETO A;  4C98 A;  1APS A;  1MNT A;  2VAS A;  4CO2 A;  5EX3 A;  2NR0 A;  3KUH A;  2VA2 A;  3H5X A;  1WC6 A;  3OTC A;  3MAA A;  4EBD A;  4LRC A;  3EZ5 A;  2QMW A;  3GB0 A;  1CQM A;  3M32 B;  1YJN S;  1YBA A;  4CQ1 A;  1SJR A;  1FVS A;  1UEU A;  4J9L A;  3QPI A;  3N5B A;  1FER A;  3CCL S;  3RRK A;  2QL7 B;  3ILO A;  2LDI A;  4BS2 A;  1ELO A;  2OP5 A;  3HK2 A;  4EBE A;  1DTT B;  2MKC A;  1KVJ A;  4ED0 A;  1TL3 B;  2CNL B;  2HNY B;  3EZO A;  3NG8 A;  4IH7 A;  5C42 A;  3CJ3 A;  2GW8 A;  4OQJ A;  1TZ0 A;  3LAL A;  2R8H A;  1YHQ S;  3QSI A;  1OPZ A;  4O4G A;  3GFZ A;  3LAN A;  3OW2 R;  3KLI A;  2RB7 A;  2V63 A;  2ASY A;  4BCA A;  1SH2 A;  4NLV A;  1H98 A;  3DOM B;  2ZH7 A;  4YB6 A;  5HQM A;  4M5N A;  1NSQ A;  4Z37 A;  1LFW A;  3CE8 A;  4TVA B;  5DLF A;  4B02 A;  1BY9 A;  1KLM B;  2XMM A;  3GWC A;  3UDC A;  4F2S A;  3G2X A;  5IM0 A;  2AWZ A;  3HFK A;  4R0J A;  1FJ7 A;  4KGX B;  2X1B A;  3FQK A;  3CC2 S;  2YNH B;  2VQE J;  5D0R A;  4PG5 A;  3KJF B;  4Z2X A;  2OLW A;  3J7Z 5;  1BD6 A;  3OT9 A;  2W1B A;  2RQ4 A;  1RA6 A;  1BE4 A;  3C16 B;  3W64 A;  4ED8 A;  1QAI A;  2CQ3 A;  2X7I A;  1S57 A;  2YNI A;  3MM6 A;  4RNM A;  3PZP A;  2DIU A;  1X31 C;  2XI2 A;  3N0V A;  1JK9 B;  1H2T Z;  3O44 A;  5HQL A;  3I4P A;  1JLE B;  4TKT A;  3GV7 B;  2C2R A;  1X9W A;  2PN6 A;  1TR0 A;  1U25 A;  3R27 A;  1S0M A;  1GMW A;  1D8Z A;  1B28 A;  4IRC A;  4ID5 A;  4HH1 A;  5LSO A;  3O3L A;  5GAH I;  3HP6 A;  2M2B A;  1TFY A;  1JNZ B;  1RTH B;  3PYE A;  3RW7 A;  1YWX A;  3BKT A;  4X4Q A;  2CFX A;  4WK1 A;  1YZ7 A;  1LW0 B;  4HHU A;  3VF0 B;  3W2V A;  2EPI A;  3RYL A;  2VIH A;  1VBZ A;  2FJX A;  1CJT A;  2KHC A;  2KN4 A;  4IG3 B;  4ZDN A;  3QJJ A;  1UA0 A;  5E2Q A;  3DHW C;  3M30 A;  1VJQ A;  2V2V A;  2H65 B;  4LSZ B;  5DGA A;  5HP1 B;  2VPW B;  2HBR B;  4CZC A;  2BJ7 A;  4WYL A;  1ZM4 A;  3AJ1 A;  3MHY A;  4C8N A;  3IXQ A;  4DR4 J;  3NGS A;  1DUR A;  1N5Q A;  3H4D A;  3MFH A;  1WKJ A;  3I96 A;  4U67 Q;  4DV5 J;  3ENQ A;  2F9D A;  4H4M A;  4NLR A;  5K9F A;  2N7C A;  2NCK L;  1YRX A;  3FCW A;  2RQK A;  1VIS A;  3M30 B;  3KK2 A;  2HQF A;  4B3T J;  1HBU A;  3NCP A;  3E51 A;  4PWW A;  4C0H A;  1R8P A;  4Y2A A;  3BGR A;  5HQ8 A;  3C2P A;  3Q8U A;  2E5J A;  2L41 A;  4PEO A;  1WNE A;  1GFW B;  2EVZ A;  3C6U A;  3TVK A;  3VZH A;  4WFN Q;  4ITS A;  4ID5 B;  1MN7 A;  2J9C A;  1HR0 F;  1IWA A;  1WHW A;  5GMD A;  4DV5 F;  1NU4 A;  3UPF A;  5L38 A;  2ZJR Q;  1LWE B;  1FRL A;  1NCL A;  4DV0 J;  2RDI A;  2WOM A;  3QAU A;  3H90 A;  2L9N A;  1LWC B;  3DRP A;  2DHA A;  3AAW B;  3TUJ C;  2Y1I A;  2NS1 B;  4CCH A;  3HVA A;  3IS9 A;  1U7L A;  3M7V A;  5BJR A;  4Y28 C;  3I9Z A;  5J1E B;  3TJA A;  1G2E A;  2E5H A;  5K8M A;  3HF5 A;  3DRR B;  5BYR A;  2DR8 A;  3PJ9 A;  1DY3 A;  4IQM A;  2VKR A;  3A3N B;  2JHE A;  3NEK A;  1N0U A;  2LP4 A;  1VDH A;  2BBE A;  1SVD A;  3UR0 A;  2HS4 A;  4PXD A;  3NNE A;  1QUV A;  2DNH A;  1RAC B;  3UDE A;  3TJ8 A;  5LJ5 Y;  3CCV S;  4FS1 A;  4FBU A;  1DTQ A;  1S59 A;  2R7R A;  1RTJ B;  3IM9 A;  4KHM A;  4QYZ K;  2QLJ B;  3FCV A;  4YN3 B;  4A46 A;  2YWK A;  4IDK A;  1VC6 A;  2HHW A;  2GJI A;  1RLD A;  1EP4 B;  3D9B A;  2C3Y A;  3EM1 A;  3N79 A;  4F2R A;  1U1N A;  2I0X A;  2RF2 B;  3M2U B;  4M5G A;  2XMV A;  2DRB A;  3ZZU A;  2K7K A;  3W2W B;  4BLG A;  2ZIT A;  5U47 A;  3KDO A;  1KWM A;  3NBP A;  4WZM A;  1AFJ A;  4AL5 A;  4RW8 A;  4OHV A;  2YQ3 A;  1JLA B;  2B9Y A;  2CPH A;  2DNN A;  1E6Y B;  3OTO J;  4M5D A;  2V2K A;  1U02 A;  4KH0 B;  1VJW A;  4QOT A;  4DUY F;  3MMA B;  4TY9 A;  3NNA A;  4DL3 A;  3TZX A;  5KFD A;  4EYH B;  2NXE A;  2O01 C;  1M5H A;  5J2M A;  2ZZM A;  1ICE B;  4ZP8 A;  2GIQ A;  2BJ1 A;  2QFJ A;  3CME S;  3GLJ A;  1HI0 P;  1S1W A;  3MR6 A;  2CIM A;  2QMU B;  3PHT A;  4DL2 A;  1XMQ J;  4JI4 J;  4FXD A;  4ZPC A;  4L72 B;  2OD4 A;  5KFG A;  1R8A A;  5J1N A;  3H5U A;  2R7W A;  1ACM B;  2V4J B;  1EAR A;  2AT1 B;  2MZR A;  3NRB A;  3IFE A;  4L75 A;  1QAJ A;  3CF5 Q;  1ZA2 B;  1KFS A;  1BHN A;  5J2Q A;  2G2O A;  4GKK J;  3TZZ A;  1YRT A;  2OPQ B;  3QGH A;  3TUI C;  3D1Q A;  2CPF A;  1S1W B;  2XNQ A;  4GO7 X;  1YTY A;  2XO7 A;  3NCQ A;  4HEA 9;  4BWM A;  1WI6 A;  2W4P A;  3NAI A;  2V8D A;  3OHB A;  4DN9 A;  2WVD A;  3VAF A;  2MQN A;  2M88 A;  1RT5 A;  4KRW A;  4X4U A;  2XNR A;  2AX0 A;  3GZ7 A;  1OQ3 A;  2GAG C;  2J9D E;  1DQA A;  1TAU A;  2CJQ A;  4JI3 F;  4WF9 Q;  2K9I A;  2BVZ A;  3MEE A;  5C5J A;  3QQC D;  3GCW P;  2CVE A;  3L7P A;  3K5P A;  3PRD A;  3BJY A;  2Z8Q A;  4NEZ A;  3R9L A;  1PKU A;  4NLQ A;  1S7I A;  4K4T A;  1RSC A;  2OFH X;  5J2N B;  1T9T A;  5SZT A;  1HNX J;  3PRB A;  4KC5 A;  4LF6 J;  2WRM A;  4OZN A;  4NML A;  4KHP J;  3T1Y J;  1UWA A;  2W4D A;  4J9S A;  3QGI A;  4IO1 A;  4DUZ F;  2V9K A;  3CTR A;  1QVG R;  2ZBQ A;  4GVL A;  2DNY A;  4ERD A;  2MPU A;  1O51 A;  1RKJ A;  2DNG A;  1PJ6 A;  3VGU A;  1RAF B;  1FTC A;  1HNV B;  1NND A;  2CYY A;  2FC9 A;  1YRU A;  3CDU A;  3D28 A;  2B4U A;  2LXF A;  2QL5 B;  3LAM A;  3MWB A;  3I0R B;  4DN0 A;  1S9G A;  2HIQ A;  5L9N A;  5JVG Q;  4DLG A;  3PX6 A;  1D9D A;  4YDX A;  1YLX A;  4U7U D;  1RT5 B;  1DQ8 A;  2CPX A;  2MSS A;  3UN3 A;  2XMA A;  3FRZ A;  2KOE A;  3W65 A;  2N3O A;  1GTE A;  4IR1 A;  4ETZ A;  4OZ3 A;  2YX4 A;  2FGO A;  4FPR A;  4DPT A;  2PFF B;  1X4E A;  5H9F K;  2YQ1 A;  2ZHA A;  4TY8 B;  4CO4 A;  5HRO B;  4QYZ J;  4MJW A;  1HQE B;  5KFX A;  5A76 A;  2FZG B;  4NLU A;  2XYG B;  2JDJ A;  3IRX B;  4PPZ A;  1QSS A;  5IQQ A;  4C8L A;  3MM5 A;  3CXC R;  9ATC B;  1SBR A;  3I5B A;  1TKX B;  1OS5 A;  1U09 A;  4ZPB A;  3MMB B;  4X4T A;  1VQO S;  2JEI A;  2E7V A;  4P73 A;  1BMQ B;  2ZH8 A;  4H4O B;  5F8N A;  1FRK A;  3D6H B;  3R5J B;  1X8D A;  1X5S A;  2BZ2 A;  2IJR A;  1HYS A;  3OPK A;  4NMX A;  4HI1 A;  3OUY B;  3GII A;  3M1V A;  4V1A k;  3HT3 A;  3PY8 A;  2XMJ A;  1U48 A;  1O6X A;  2RQM A;  2OSR A;  4X4R A;  1J5E J;  1SJQ A;  3ET6 B;  2HK2 A;  4FKY A;  5B08 A;  4X4V A;  2J8S A;  4LR7 A;  2AIR B;  3PX4 A;  1RQ0 A;  4IFY A;  2VBY A;  1TFW A;  2UVW A;  5KFO A;  1MG7 A;  4JI6 J;  1AZS B;  3E8O A;  5E7O B;  1N5Y A;  3GIR A;  1O8B A;  2BAN A;  3M8Q A;  4C6A A;  1U0H A;  4MFB B;  3T1H F;  1TL4 A;  2ZC4 A;  5CA5 A;  3WQP A;  3RRG A;  3W66 A;  3SQG B;  1T8E A;  2H1Y A;  1TAQ A;  2DHS A;  5GAG U;  1ROF A;  3HHL A;  2H5J B;  2HQ3 A;  2RIL A;  3ITH A;  5ETQ A;  5HMX A;  1IKY B;  1NK7 A;  1HR0 J;  2DHX A;  2OPR B;  1RHQ B;  3H2V E;  4OZ0 A;  4WIQ A;  3UW1 A;  3SSQ A;  1QSY A;  4ANC A;  4LRD A;  4ZMM A;  3LP1 B;  1CPZ A;  2XSJ B;  9RUB A;  4CT8 A;  2XMT A;  3M6V A;  3EPG A;  2VDH A;  3AOC A;  2F1F A;  1JWW A;  2YNF B;  2Y8W A;  1JIH A;  3JQJ A;  1RYR A;  1REV A;  4LQ3 A;  4I64 A;  2K7J A;  2E7X A;  2VBX A;  1K1S A;  1PAE X;  4ZVU B;  2JC1 A;  2PC6 A;  1BGX T;  3UFC X;  3S6E A;  1FRM A;  2LDY A;  2ILY A;  3LO3 A;  4D3G A;  1WHV A;  1LW2 A;  4RR5 A;  3DGP B;  1VFJ A;  3VGV A;  3UN5 A;  2G0J A;  4C8Z A;  3IC1 A;  5K8N A;  4DPX A;  5CZX A;  3BEG B;  5I3Q A;  2E29 A;  4ED1 A;  1NK8 A;  2MQL A;  3I56 S;  3KMS A;  5T14 A;  2C2K B;  4Y0F A;  2UUC J;  4RWW A;  4ZIW A;  3BM7 A;  4YHH J;  2FJA B;  3M9N B;  4KSE B;  4LRE A;  1GEH A;  2Y0B B;  1UJ6 A;  1PYT A;  4L73 A;  4RW7 A;  1KEK A;  1M90 T;  3PW7 A;  4H4O A;  2CPD A;  3BGL A;  2L08 A;  3SXL A;  4O3S A;  1ZYQ A;  4EO8 A;  2UZA A;  3WBZ A;  5HP1 A;  4Y2I A;  3M1V B;  3QJL A;  3W5Y A;  4P2F A;  4J9Q A;  3TAN A;  5EWF A;  1YGY A;  2VQE F;  5B0G A;  2OTJ S;  4EWT A;  5KFQ A;  3UCU P;  2HMI B;  2F40 A;  2XWX A;  1XWL A;  4CLU A;  4LRB A;  1FWP A;  3MEE B;  4OMF G;  4OYI A;  1K44 A;  1GK8 A;  1QD1 A;  1VYA A;  1W2I A;  3I0S B;  2QSW A;  2JRS A;  1MRO A;  1PYO B;  3EJM A;  4RJV A;  3RBZ A;  2GPE A;  1MWZ A;  4DCP B;  5LSR A;  5DG8 A;  3F73 A;  4K5S A;  3M8Y A;  1XQI A;  2ZHB A;  1B4S A;  4I1T A;  4LF8 F;  4F25 A;  2MDA A;  5KG7 A;  4JP8 A;  5E3P A;  3SV4 A;  1Q5Y A;  5HLF B;  3AQO A;  2DPI A;  3HMJ G;  2JLG A;  1RBA A;  2MLY A;  3RAX A;  3SCK E;  2B3T B;  4Q45 A;  3DDI A;  2OPQ A;  3QGP A;  4ZPW R;  3BR8 A;  4C8Y A;  5CAB A;  4F4K A;  1NB2 A;  2FHJ A;  2QGF B;  4OYX A;  4AT1 B;  4P52 A;  3IGN A;  3FK4 A;  1CBK A;  1WUU A;  2YWW A;  4GO5 X;  1UJ4 A;  3SCJ E;  4TQS A;  4K4X A;  2IDE A;  2D9O A;  3CJS A;  2XS2 A;  1KHW A;  2EFG A;  4B3R J;  1JXL A;  3FEY B;  4ZA1 A;  3LWM A;  4P72 A;  5KG1 A;  2LEP A;  1RAG B;  4EMD A;  5AE3 A;  1TU0 B;  3H7H B;  2GC8 A;  2CQC A;  1HFE L;  1WG5 A;  1S1U B;  2B5J A;  5D0H A;  1AXQ A;  1BDV A;  3BV8 A;  4USI A;  5KFL A;  1NJY A;  1VQ6 S;  4DMZ A;  2ZVS A;  3GFY A;  1B70 B;  1SV5 B;  2YPY A;  3EX7 B;  1K0V A;  1RWW B;  3TAM A;  3BF4 A;  5I3U B;  1HI8 A;  3D6M B;  2A18 A;  2MKK A;  4AAI A;  3BQ2 A;  1WF2 A;  2KDO A;  3MOZ A;  5A8R A;  1N5Y B;  2HFO A;  3THV A;  4K50 A;  3DLB A;  1XNQ J;  1N36 F;  3TA0 A;  5LJ3 Y;  3KJN B;  1ZAV A;  2H54 B;  2AEJ A;  4BWJ A;  2XWY A;  4L74 A;  4Y6I A;  4I4B A;  3UD3 P;  5IXU A;  3QAE A;  4RNH A;  3QNW B;  2DYA A;  2KKH A;  2FJV A;  4E98 A;  1UMJ A;  3JYT B;  2ZD1 B;  4CM2 A;  2GA7 A;  5DDQ C;  2R3V A;  3OHA A;  1YBU A;  1FNO A;  1CJU A;  3K8V A;  1HQU B;  2FHM A;  1M5S A;  2OEJ A;  2PO4 A;  3OFH A;  4WP8 A;  2NPF A;  2HAI A;  2E5G A;  5KFJ A;  2W9A A;  4DV7 J;  1IQZ A;  4ZPA A;  1WHX A;  1X4B A;  4EGL A;  1YSJ A;  5KFK A;  3CJ8 A;  2QYC A;  1VRU B;  2HKE A;  2ZKT A;  2XZT B;  4CDI A;  4OI3 A;  2QTW A;  2UXD J;  4F3O A;  4QYR A;  2JEG A;  3IO1 A;  4EUV A;  1H2V Z;  1I5O B;  2RRB A;  3CC7 S;  5KTQ A;  4DSL A;  1CEZ A;  1LQ9 A;  4CLK A;  1Q0N A;  1UAW A;  4F7V A;  5B09 A;  3SIP B;  2ZH3 A;  1RCO B;  1NZ8 A;  2HND B;  4O4G B;  4M63 A;  1D09 B;  4DPY A;  1AA1 B;  3HSZ A;  5ETS A;  1C0U A;  2CPI A;  4JI2 F;  1ZAX A;  1P1L A;  4RLE A;  4USW A;  2AF6 A;  1T0T V;  1L3K A;  1WG4 A;  3JTP A;  1D0E A;  4KJI A;  4ZVP B;  4QU6 A;  3PXG a;  4X65 J;  1WDT A;  5ETN A;  1P9Y A;  2HFS A;  2BYC A;  4HTJ A;  4W90 B;  2CQD A;  3TZY A;  2BQR A;  4B9U A;  1XNR J;  4DV4 F;  3ZZO A;  4KKO A;  4DPW A;  3K5N A;  4OJ3 A;  1N5V A;  3KHG A;  2QA4 G;  5DZ7 A;  4CI0 B;  2I2Y A;  1FWK A;  1H2U X;  4O4R A;  2EFO A;  2LXI A;  2H5E A;  1DAX A;  3M2V B;  4I69 A;  4DR2 J;  1XMO J;  3L9Z A;  1Q82 T;  1HNZ J;  4A8O A;  4DL0 C;  4PWD B;  3U1N A;  4ZCM A;  3KLF A;  3IWX A;  2WTF A;  1Y3K A;  2CJA A;  1K8A T;  1KTV A;  3PKM A;  2XSJ A;  3BKU A;  3EDR B;  1EB0 A;  1UFL A;  3GSI A;  3IWL A;  2Y3Y A;  3CSK A;  2WSF C;  2KG0 A;  1EHW A;  3MAA B;  1Q16 B;  3I6P A;  4ZVS B;  2ZHO A;  3DI6 A;  4LFA F;  4ED2 A;  4LFC F;  1KKH A;  3C6U B;  3HDS A;  4ED4 A;  2KH9 A;  3VVU A;  3JSM A;  3J7Y U;  1QTN B;  3QSY B;  3LUY A;  4LSL B;  3FZB A;  3R7N B;  1IKV B;  3AJD A;  5CYM A;  1FA0 A;  3RRH A;  3PO5 A;  2JXG A;  4B3S J;  2ABY A;  2NQP A;  1SJ3 P;  3K2Y A;  4DS5 A;  2CUY A;  3POT A;  1NDC A;  4ECQ A;  5LM7 E;  4JV2 A;  4R8U B;  3W3S A;  4DR7 J;  4I56 A;  3HO1 A;  3QIP B;  2CA9 A;  5EWE A;  4JI5 F;  4XDC A;  1TUV A;  4X66 J;  3PW2 A;  2P8I A;  3I5A A;  4Q44 A;  3DLE A;  2J6S A;  2IBK A;  4D8J A;  1JQG A;  2OML A;  5KFT A;  1AW0 A;  4NLS A;  3UQS A;  4R5P B;  2NXN A;  2ZBC A;  3CDW A;  3DDK A;  2GIF A;  4XIU A;  2DK2 A;  2HWI A;  3PW5 A;  3J7A 1;  2PA3 A;  2MKJ A;  2GFF A;  4HVZ A;  4G6V B;  3R8Y A;  4OL8 A;  4WYW A;  3HPO A;  2VC0 A;  1J5O A;  4NRU A;  1XR6 A;  3NMR A;  2CQ0 A;  2VL1 A;  1U4B A;  4FF2 A;  2YKM A;  4HKQ A;  5IS2 A;  3ICL A;  4PAB A;  1KON A;  4NYO A;  5FLX Y;  3DLG A;  1F5A A;  4I6A A;  1HBM A;  4R5P A;  2OIH A;  2G4B A;  4N47 A;  1C0U B;  3CED A;  4IFY B;  4W4M A;  3LPE A;  1IKV A;  4LVN P;  1CUL A;  4YB7 A;  1UPP A;  3P49 B;  4GRS A;  2L3M A;  5DDP C;  3Q2T C;  2ERR A;  1GX5 A;  2JXH A;  1P27 B;  2BJ8 A;  1RAO A;  3H2L A;  4R8U A;  4F04 B;  2AGP A;  1YJ9 S;  2CNO B;  1IBM J;  4DQP A;  3R5C A;  5BYQ A;  2XSF A;  2DNR A;  3CCZ A;  1MRO B;  1CQN A;  1FXL A;  4B3S F;  1WOO A;  3AD7 C;  1KD1 T;  4CNZ A;  1X9M A;  1AUS L;  3MM6 B;  5JXS A;  4RW9 B;  1HNV A;  1HMV A;  1PJ5 A;  1Q7L B;  2D9P A;  2V50 A;  1P8G A;  3GYG A;  3N01 A;  4L76 A;  3RJM B;  4LFA J;  2H48 B;  3V6D B;  1NK4 A;  3OJU A;  4LFC J;  1C1C B;  4RX6 A;  4DV3 F;  2W7O A;  2HEK A;  2GV1 A;  5D0E A;  1N8R T;  2HVH A;  2D3O 1;  7FDR A;  4F8R A;  4WU2 A;  5L39 A;  5A8W B;  5C7P A;  4HHJ A;  5IV3 A;  3D67 A;  3LP2 B;  2A6M A;  2IYI A;  3SCL E;  4HR2 A;  1SL0 A;  1ZH5 A;  4A4J A;  1VQY A;  5HO4 A;  1XMO F;  2UXC F;  2UXB J;  1HLW A;  2ZWP A;  1AFI A;  3DGV A;  3R97 A;  4ECZ A;  2E44 A;  1N33 F;  2C42 A;  2MLZ A;  4OYA A;  1UVK A;  3FEZ A;  2W2O P;  3H5S A;  1F2H A;  1WEZ A;  1FJG F;  4ZCL A;  1TL5 A;  5B0C A;  1RU1 A;  3HVR A;  3T5H A;  4KQZ A;  2OTL S;  5IOL A;  2MQM A;  5ETT A;  3NWG A;  2LMI A;  1M1K T;  2RH3 A;  3OSN A;  5I3U A;  2BW7 A;  1FF2 A;  2BJ3 A;  3IG1 A;  1RYS A;  2EFN A;  2QRR A;  5KFP A;  1G4C A;  4KT0 C;  4P2S A;  1U1R A;  1H0H B;  3MUM P;  4QIE A;  1HPZ A;  2NSC A;  1NZA A;  4ZP7 A;  2W9B B;  3JXO A;  2JC0 A;  3DYA B;  3A13 A;  1EQ0 A;  1SKU B;  2G2Z A;  2B51 A;  5ETP A;  4ILL A;  4RUB A;  4WKR A;  3ISN D;  1FRI A;  2MYF A;  1FRH A;  4KO0 B;  2OFG X;  4ILM A;  1RWK B;  3W60 A;  3VGS A;  2QO3 A;  2X1G A;  5D4L A;  4PYA A;  1TKZ B;  3T6J A;  3CCW A;  4I67 A;  2GS8 A;  1HHS A;  4CLP A;  2Y1R I;  3QRR A;  2YNF A;  5I4M A;  3PIP Q;  4ICL B;  1YVF A;  3FNN A;  5CYM B;  2B6A B;  2X1F A;  2RML A;  2GHW A;  2WW4 A;  1WTB A;  3HHK A;  1HW9 A;  4CNY A;  2V8H A;  3FT7 A;  3G6E S;  1N34 F;  3NL0 A;  4PQA A;  3S1T A;  1WOS A;  3T3F A;  2VFU A;  5T7L A;  4DLE A;  3V81 B;  1I94 J;  1CVJ A;  5L46 A;  5CZV A;  1A0O B;  3C6T B;  3H2U B;  5ETK A;  3RB6 A;  1VK8 A;  2J76 E;  2AD9 A;  2B6A A;  1M0S A;  3DOL A;  5AXK A;  2AZ3 A;  4EZ6 A;  4CM0 A;  1NRK A;  2YX7 A;  1RKI A;  3BYP A;  3EXY A;  4WP9 A;  5IT9 Y;  5LL6 d;  3OL7 A;  1JKH B;  2M8H A;  3H25 A;  4FS2 A;  4G1Q B;  3J7A N;  1VHI A;  4X64 F;  3PNI A;  2VFS A;  2HHP A;  5E3A A;  4ED3 A;  3G71 S;  4B3M J;  4J9M A;  2HHT A;  2DY1 A;  2N4D A;  4U7U K;  1NO8 A;  5I42 B;  1U6Z A;  2PSZ A;  3PEJ A;  1U1K A;  3DDN A;  5IWA J;  1DJ0 A;  1WF1 A;  4J5O A;  5DO2 A;  4LBH A;  4ZN1 A;  5BR8 F;  2DR5 A;  1TUW A;  1AUD A;  2CJX B;  3TRG A;  1TV6 A;  4CTA B;  1S6P B;  1ARQ A;  2XUL A;  4YR3 A;  4Q5V A;  4URS A;  3D2W A;  2R2U A;  1Q86 T;  2GGP A;  2QN6 B;  3F0N A;  4AD6 A;  4YR0 A;  2RBF A;  4Q0B A;  4C2M A;  2FJE B;  1ZPW X;  3DNC A;  1U2C A;  1R3N A;  3W1Y C;  3ZZ0 A;  4RBT A;  2Z2L A;  4G3I A;  2XY6 A;  1F3F A;  3CJ2 A;  2OEL A;  4IH6 A;  1U1M A;  4OI6 A;  1RDR A;  3Q86 A;  4X4N A;  2IVM A;  4M5M A;  3MCS A;  4UW2 A;  2E1A A;  2UU9 F;  2W4C A;  4X4S A;  3CDE A;  4JI8 F;  4KHP F;  5LT5 A;  1EA4 A;  3RG6 A;  2V5H G;  1RTI A;  2DGX A;  2OO4 A;  4ANE A;  2GMJ A;  2GO9 A;  2IRX A;  2Y1L B;  3LOU A;  2GJ2 A;  3FZ2 A;  3TJ9 A;  4C7Q A;  2VQF J;  1L5U A;  1A9N B;  1VK3 A;  3NCR A;  5D8H B;  3AY0 A;  3OXG A;  2N7Y A;  1OMS A;  3VAH A;  2YWE A;  2ZNZ A;  1B99 A;  3GCX P;  3IAM 9;  4LRF A;  2ZDO A;  3G8S A;  1KSP A;  1RK8 A;  3PKY A;  2BMB A;  2FHO B;  1RUS A;  1WTF A;  3C15 B;  4Q2M A;  1NKC A;  2NXC A;  3C46 A;  2FGC A;  1KLM A;  2J9D A;  3MZI A;  4MKB A;  1RWO B;  2DGT A;  3T9Z A;  3T6B A;  3W8P A;  4LSN A;  1JLC A;  2UVR A;  3D7S B;  1RTH A;  2D3U A;  1YIT S;  4ZKA A;  1ZM9 A;  4ZVR B;  1NK6 A;  1F5C A;  4RKU C;  5K5M A;  1UCN A;  4LBI A;  4NEY A;  4ZVO B;  1U9P A;  1S4E A;  1NDP A;  2QLX A;  3MEK A;  3V81 A;  4UQT A;  3PAC A;  2VDI A;  3NS6 A;  4DCJ B;  4RNF A;  4YHH F;  3J7Z T;  3VZI A;  1U49 A;  2BOP A;  2KM8 C;  1SKR A;  4TN2 A;  1JLB A;  4WPA A;  5JJB A;  4NXN F;  1B7Y B;  3ADA C;  2WZ1 A;  2KG1 A;  3R6G B;  4RZR A;  4K4Z A;  1RLC L;  2GJF A;  2IC3 A;  2OPS A;  2E66 A;  3W61 A;  4RU9 A;  2HVZ A;  2RE1 A;  3VAJ A;  1YBT A;  5AT1 B;  5IV4 A;  2XC9 A;  4IG0 A;  2LLZ A;  3HHL C;  1GX6 A;  4OJG A;  2KFY A;  4IYQ A;  5KFZ A;  3RR8 A;  1VQ7 S;  1R0A B;  4NCA A;  3JSB A;  4PKD B;  1BWV A;  2MMY A;  1N5S A;  3QBC A;  3CJQ A;  1K47 A;  2N4C A;  3IBW A;  4WXW A;  4CO1 A;  5F8I A;  4O3P A;  1FNX H;  3NNH A;  2IY5 B;  2M4M A;  1UVI A;  4LFB J;  5B0E A;  3OR1 A;  2QJ3 A;  2NXJ A;  4XPC A;  4G65 A;  3UD4 P;  3MR2 A;  4RBV A;  1FEE A;  1C0T A;  1V6H A;  2GO8 A;  2GIR A;  2IM1 A;  4RWX A;  4A8Y A;  2FLN A;  4ZP9 A;  3I5C A;  2PMH A;  1MU2 B;  3DI6 B;  4P71 A;  1SC1 B;  2DR9 A;  2CJY B;  4I2P A;  4DV1 J;  1VQN S;  2Q6C A;  1IKY A;  2HHU A;  1KDN A;  4ZPD A;  4DSE A;  3TAQ A;  5DQI A;  4AE5 A;  2W8K A;  1T7P A;  3D6F B;  2ADL A;  1FXD A;  7FD1 A;  4PUO A;  4V19 J;  4QCL A;  4OZL A;  1F3V A;  1VIO A;  2HIY A;  2IRU A;  2ZC3 A;  2V6A A;  3HVT B;  3KDN A;  1SH3 A;  4BHQ A;  2BM0 A;  1VQ8 S;  4JV5 F;  1IR1 A;  2U2F A;  1S4F A;  1V3Z A;  3PX0 A;  4ECX A;  2G0I A;  4QPT A;  2IMO A;  4DR1 J;  4MIB A;  1H74 A;  1J2V A;  2JLE A;  3T5K A;  2AV5 A;  1MNE A;  2HQI A;  2HMI A;  3MMB A;  1S1T B;  1J5E F;  1VBY A;  3TAR A;  3HSJ A;  1Q5V A;  3HSG A;  4NX9 A;  3UNY A;  1CLF A;  3M2R A;  4DXL A;  4O0N A;  2FVQ A;  4A8M P;  5KFE A;  4DFP A;  2IJN A;  1VQP S;  2EKN A;  4KKO B;  2JVO A;  1UWB A;  4TQR A;  5DG9 A;  2HQC A;  3N9U C;  2GVD A;  4NXM F;  1UZD A;  3NLC A;  2AJ4 A;  6FDR A;  2GAH C;  2MKS A;  2PFD A;  2ROP A;  2VFT A;  3MPV A;  3SFU A;  3QT5 A;  3K5L A;  3IA0 A;  3NXZ A;  4OJ1 A;  1JJH A;  3SFG A;  1RT3 B;  4PXB A;  2JZ5 A;  3WIV A;  3T1A A;  1RT4 A;  1TMM A;  4WE1 A;  1GNK A;  2DCL A;  3AHP A;  3PG9 A;  3SSS A;  2AKW B;  4M1K A;  1IRQ A;  2AP6 A;  3V4I B;  3OSP A;  1M5P C;  3OL9 A;  5HL7 Q;  3UO0 A;  2G0C A;  4DHV A;  1OYD A;  2DY9 A;  4HV0 A;  4ED7 A;  1NPR A;  2AEM A;  3MTJ A;  2DHG A;  4FVC A;  2MKI A;  4B9V A;  1HMV B;  2MY8 A;  3TUP A;  2QYG A;  4DZ6 A;  2Q79 A;  4UZB A;  2C1E B;  1WEL A;  2K29 A;  4A8S A;  1LWX A;  3NOG A;  4X84 A;  4DUT A;  1MWY A;  4GVB B;  2CQG A;  2ROE A;  2E5L J;  4CLT A;  3D0H E;  1NUE A;  3BN4 A;  3E2E A;  3SMZ A;  5F8G A;  3RW6 A;  3Q83 A;  3P6Y C;  1NSK L;  1PBA A;  1WC1 A;  3W62 A;  5A2Q U;  4HDG A;  1HWL A;  2CQ2 A;  4O3O A;  3QT7 A;  3K5O A;  3AA9 A;  3DRS A;  3NGK A;  5KOX A;  5KFC A;  4NCB A;  1CJV A;  4LF6 F;  1VCT A;  5DG7 A;  4DS4 A;  4PYD A;  5IT4 A;  1X0F A;  2P2C B;  3K7R A;  4DFK A;  3J80 U;  3KLG A;  4F0K A;  2VD3 A;  2DR6 A;  3QFW A;  2YNG A;  1JLG B;  3I55 S;  1H6K X;  5CAA A;  2HS3 A;  2ATL A;  4QWB A;  3ENA A;  4JI3 J;  1U8W A;  3DM2 A;  2G1H A;  1Q8B A;  2MZJ A;  4DR3 F;  1WOP A;  2EG1 A;  3RTV A;  1IBL J;  4Q7A A;  5A6W A;  2SXL A;  3W8G A;  4DR5 J;  4F36 A;  3MEG B;  3VCD A;  2HBZ B;  1VBX A;  3PCO B;  1FDN A;  2YKQ A;  1R0A A;  1PAU B;  2YNI B;  3BRE A;  1KQF B;  3D0I E;  2ZH5 A;  4DFM A;  1B3T A;  2UXD F;  2R7O A;  5EDW A;  1VLO A;  3RZA A;  4ZHR B;  1XIQ A;  2O66 A;  3C3L A;  4FBT A;  3QT8 A;  4K4U A;  2K06 A;  2DBB A;  3GJS B;  3LF0 A;  4C0O C;  4QIV A;  3E01 A;  3WDO A;  3FSX A;  1N32 F;  3U1M A;  1NLK L;  2BQ3 A;  4QU7 A;  4URQ U;  5D0G A;  3FMW A;  1S0O A;  4K59 A;  4PAA A;  4DL7 A;  2B4V A;  3J80 Y;  1NK0 A;  1G1X A;  3DLJ A;  4JI4 F;  1IUJ A;  4YR2 A;  2YKO A;  3JSM B;  3VAM A;  2BNZ A;  1VRQ C;  4DL6 A;  2CG4 A;  1DQ9 A;  3LA0 A;  4FXE A;  1CG2 A;  3PFE A;  1KVI A;  1HA1 A;  1IVZ A;  1RWV B;  2LYV A;  2KXN B;  4X4O A;  4N7T A;  1M1G A;  4DUY J;  1BDT A;  3MPU B;  2MQP A;  4L3N A;  2XMK A;  4TXS A;  3OTO F;  3PW4 A;  3RB0 A;  5HLF A;  4KGV B;  1WC0 A;  4OZJ A;  4DI6 A;  2Z30 B;  1QAY A;  1W2B R;  4Y2M A;  2QMX A;  4O3N A;  1VI7 A;  2HNZ A;  3HKW A;  5F3Z A;  4USH A;  3N4W A;  5H9E K;  2E9R X;  3D3B J;  1F2G A;  1HBN B;  3KLE B;  1UKU A;  1FK9 B;  2WON A;  4P2M A;  3UVJ A;  4CRJ A;  1V3R A;  1P6T A;  2M52 A;  3UI3 A;  8ATC B;  1C4C A;  2XCP A;  3KOA A;  1M1H A;  1F60 B;  4NL5 A;  2KU7 A;  1N48 A;  4NYZ A;  1R27 B;  4G1I A;  3F44 A;  4JI7 F;  2QSF A;  2VFR A;  3MM7 A;  4YY3 F;  2EC0 A;  2ALY B;  3ZZZ A;  1NHU A;  2WBR A;  1CJK A;  1RA7 A;  4Y3C A;  1CS4 B;  1SQE A;  3FJ2 A;  3HVW A;  2VG5 B;  3VVT A;  3NAH A;  1UET A;  2A2D A;  4CYU A;  2B9X A;  4E2F B;  3AD8 C;  3OD2 A;  4L6V 3;  2FVR A;  1V3S A;  2KXF A;  2MJN A;  3UWT A;  3KJV B;  1ZZN A;  2E1P A;  4LIW A;  1SXL A;  5F0U A;  1NKE A;  2XMU A;  2V8G A;  3QWP A;  2YWH A;  1UJ5 A;  4NAS A;  3A12 A;  3TX8 A;  2NRE A;  2B56 A;  2QLF B;  4O23 A;  5M2P A;  2FZK B;  4DV0 F;  1IBC B;  3PJX A;  5F0W A;  1BQM B;  1GT8 A;  4N76 A;  2FLO A;  4M5K A;  3W5X A;  1PO6 A;  3M2R B;  4WP3 A;  2XHC A;  4OHX A;  3U1L A;  2BJD A;  2FJB B;  4MK9 A;  4EK2 A;  2KJV A;  2LFV A;  2RRN A;  3CT9 A;  5ITH A;  3HLU A;  3UCG A;  4HYK A;  4IOA Q;  2RUG A;  1H7X A;  3CO0 P;  5GAG I;  4N41 A;  1YDL A;  3L4B C;  2LU1 A;  2YX1 A;  2QX0 A;  3R5B A;  4LF1 A;  1Y0H A;  1ZA1 B;  2HFU A;  3E3X A;  3VQS A;  2P6S A;  1XC9 A;  2HYI B;  2AJ0 A;  3AD9 C;  4KIA A;  4DR5 F;  3VAL A;  4LF9 J;  2GQC A;  2HHH F;  3OVS A;  1TKD A;  4EBC A;  2HWH A;  1BQN A;  1JLF A;  1LXN A;  2R42 A;  2Y8Y A;  3KLH B;  1EKS A;  4F0H A;  4ECR A;  4CH0 S;  1N0V C;  2LEA A;  1FT8 A;  5M2R A;  3IGV A;  3VAI A;  3KK1 A;  5KFB A;  3W9J A;  2IPO B;  1FRX A;  2EFQ A;  4Y2C A;  5KT4 A;  2ZH4 A;  5F3T A;  2CQ4 A;  1HIY A;  1RWX B;  3H20 A;  3NY0 A;  1A7G E;  1Y9O A;  2KO1 A;  3M8S A;  2YY3 A;  2BJE A;  1XEZ A;  4C3L A;  3CCJ S;  2PGC A;  3ZTS A;  4I68 A;  5IC4 B;  4AUK A;  3HXM A;  1L3T A;  1C4A A;  2CDQ A;  3W2W A;  2Z2M A;  1GXT A;  4OFZ A;  3BBC A;  5DM6 Q;  5DET A;  2AYE A;  1PYS B;  3AH6 A;  2DPJ A;  3UNG C;  3Q2S C;  2PI4 A;  1WSV A;  3FSY A;  2LQ5 A;  4NWB A;  2ASJ A;  1IBK J;  4FF3 A;  3M8W A;  5KFF A;  4H4K C;  3FMT A;  3J7Y I;  5F41 A;  4FNH A;  5J2M B;  4F4X A;  2J0X A;  1B0T A;  4JV0 A;  1RHM B;  1S5Z A;  1TTH B;  3HZE A;  4CIO A;  1XMB A;  2AYM A;  3MMA A;  3R6L B;  2EI5 A;  2FHK A;  3M8P A;  3MUT P;  2GVZ B;  4K2X A;  3O1L A;  2HZC A;  1BXN A;  3BS9 A;  3A8E A;  4FXV A;  1YJR A;  2Y9H A;  4N77 A;  5KT5 A;  3MEG A;  2R9L A;  1WKK A;  1TMJ A;  1YJW S;  3QT6 A;  4DR6 J;  3FBB A;  4USJ C;  4USM A;  3BGR B;  1Y10 A;  2I8E A;  4LJM A;  4TY8 A;  1G3O A;  1ZZF A;  4KV8 B;  5HRO A;  3JS9 A;  2BE2 B;  3LGM A;  2VPX B;  4NA2 A;  4D3H A;  5LMN J;  3GXQ A;  4ZJL A;  2ZBP A;  2V67 A;  5C2G A;  2EBE A;  2YKM B;  1R8B A;  5L1K A;  5AE2 A;  3MED B;  2CAJ A;  2CPG A;  3F56 A;  3LP2 A;  3DRS B;  2ZH1 A;  3KHL A;  4DL5 A;  1WWH A;  4DX5 A;  3CUL A;  3C8Y A;  2BW2 A;  1Y5I B;  3CD0 A;  3B82 A;  3VAK A;  1KR4 A;  3ZXW A;  5K20 B;  4LF7 F;  3QRQ A;  4B3O A;  2MKH A;  4KGK A;  3FDS A;  3BSN A;  1KFD A;  1OSC A;  3HKZ D;  3TWZ A;  1NH7 A;  3W2V B;  1G6B A;  1RT6 B;  1FJC A;  3SV3 A;  3KHR A;  1I1G A;  2RU3 A;  3R5G A;  2IM3 A;  5CCL A;  4OX8 A;  1IN0 A;  1WOR A;  3AOA A;  3GIM A;  4DV1 F;  1NKB A;  1URR A;  5CXT A;  2V94 A;  3H59 A;  2OPR A;  3EVW A;  4PG8 A;  4RW6 B;  2VPY B;  2QG9 B;  4TU9 A;  3GPA A;  3W9H A;  5KFH A;  4UTG A;  1X4G A;  4NCG B;  1CJU B;  2BE2 A;  5LOQ A;  1F0X A;  4RUA A;  3P3D A;  1F9H A;  1FX4 A;  4XTT A;  2UVU A;  2XG8 A;  4LF4 F;  1RT4 B;  5KG2 A;  4X4P A;  5FJ4 A;  2D3Z A;  2DNM A;  2EBG A;  3O8W A;  4K7Q A;  4P7V A;  5D4O A;  1UPM B;  5A8R B;  1XBW A;  2ILZ A;  4ZPT R;  3EZU A;  4CLY A;  2MXY A;  4ELU A;  1V5I B;  3PRV A;  2I38 A;  3ET6 A;  4EEY A;  2W9C A;  4MJK A;  3D4J A;  4V19 X;  4AQY F;  3CCE S;  5IM0 B;  3D6T B;  5F9L A;  2J0W A;  1CC8 A;  5A6P A;  2MGZ B;  2KZM A;  4JYA F;  4DCO B;  3L3C A;  3OVA A;  1RJJ A;  4CWB A;  5M2U A;  4U6P A;  2W8L A;  4ECT A;  1SV5 A;  3TO8 A;  4NXN J;  4OHY A;  1KP6 A;  3SQG A;  2KJW A;  3OL8 A;  5K14 B;  3DFE A;  1N56 A;  4XPE A;  4IRK A;  2CPE A;  2MGZ A;  2Z2Z A;  3N6M A;  2MLX A;  5KFU A;  1JLE A;  4KV8 A;  1SL1 A;  4RNO A;  2Y0S D;  2F63 A;  4PG6 A;  2OJ3 A;  2OPP B;  5ETV A;  1ZAW A;  5DZ6 A;  2KXH A;  4J90 A;  1SKS A;  3KLG B;  3KJV A;  1DTQ B;  4LBP A;  3ILJ A;  2KFN A;  3CJ0 A;  2CG8 A;  4LF5 J;  3OLA A;  4IKA A;  1Y7P A;  2GVD B;  2RS8 A;  3Q22 A;  2IA6 A;  3CCR S;  1UVM A;  3GV8 B;  4N56 A;  1LOU A;  2AGQ A;  3IWN C;  3IBF B;  3AOB A;  3VTI A;  1PJ7 A;  3BQ1 A;  2YTC A;  4XO0 A;  4DF8 A;  1S99 A;  4Z7Y A;  2JFK A;  2W7A A;  4NLG A;  1N88 A;  2BKP A;  3FFI B;  4E8U A;  2D1C A;  1XER A;  4LR8 A;  5B0A A;  2WAQ D;  2W25 A;  4PPD A;  3IN5 A;  2JWN A;  4JI8 J;  2BA3 A;  1ZPV A;  3DMJ B;  4HAC B;  4TLQ A;  4CLS A;  4NE9 C;  2RUS A;  3H87 C;  1WD6 A;  2H3E B;  1LV5 A;  2C28 A;  2MTL A;  2FY8 A;  3CIZ A;  5ETR A;  3V6K A;  3BPS P;  1H72 C;  3MM9 A;  4ELV A;  2CXE A;  4OYW A;  1HWI A;  3A1Y G;  4ETX A;  1RTI B;  3P45 B;  4ECW A;  1SC6 A;  3PFO A;  1U1L A;  4PQU A;  4RUH A;  1J27 A;  1LEO A;  2ZE2 B;  2YBV A;  2B9W A;  3EGW B;  2D41 A;  4ZVE A;  2RDJ A;  3GR1 A;  5EX0 A;  5CYJ A;  4F50 A;  3N6N A;  3PYD A;  2B8Q A;  3GG0 A;  1TUG B;  2GML A;  2HSE B;  2HUR A;  4ED6 A;  2W2N P;  4AND A;  1FKO B;  4PG4 A;  2MB0 B;  3LH2 S;  4NLD A;  2ZZN A;  2H5I B;  4FYY B;  3GQC A;  2DNP A;  3M8P B;  1FJE B;  2ZE2 A;  4B3M F;  3PYF A;  1FKP B;  5MAO A;  4X64 J;  1RP5 A;  1HL6 A;  5G0R B;  2ZBI A;  3OXL A;  1FI4 A;  3R7B B;  1JKH A;  4ENO A;  3ZZR A;  2MZ1 A;  2XYP B;  4J9P A;  3TQE A;  1NJX A;  3DLL Q;  4QWA A;  5A0Y B;  1ITP A;  3BYR A;  1V5V A;  3CJ5 A;  8RUC A;  1BAZ A;  1ZBT A;  3SDE A;  4AXI A;  2VOD A;  3WX8 A;  1UEK A;  4RW7 B;  2YKN A;  3TQ1 A;  3FCH A;  2FLL A;  4W92 B;  3GIL A;  2ZEJ A;  4FN5 A;  3DM2 B;  3ZTP A;  1FVQ A;  1MU2 A;  1N52 B;  1XN9 A;  1LW0 A;  2JOQ A;  3B54 A;  2M9K A;  3UDL A;  1IKX B;  2C3O A;  4K0K F;  2GCF A;  4WFA Q;  2JBV A;  2DH7 A;  2MEW A;  2O1P A;  4EO6 A;  4ICL A;  4DQI A;  4H54 A;  1Q78 A;  4IOC Q;  3ZFV A;  2UUB F;  3TW0 A;  3POT B;  1WEX A;  3WZ0 A;  1S77 D;  1YI2 S;  2XLI A;  3J81 j;  3CGI A;  4I7F A;  3RB4 A;  2CNK B;  3I0S A;  1RHR B;  1Z1Z A;  4EYI B;  4HTI A;  2Y1J A;  3PO4 A;  1JLC B;  1JJ2 R;  3HFV A;  1FES A;  2YVS A;  1S12 A;  2N3L A;  2XGQ A;  5HJX A;  2HRU A;  4ZVG A;  1VC5 A;  2N82 B;  5GAH U;  2ADC A;  4KGM A;  5LMU F;  2YWF A;  5AXL A;  2XHW A;  5B0B A;  2QEX S;  2B8P A;  3BZQ A;  4ZJO A;  4U9R A;  2EK1 A;  1JLB B;  4B17 A;  4QBU A;  1SQF A;  4PXE A;  3CD5 A;  1NJZ A;  4LMZ A;  4FYD A;  2EEY A;  1FX2 A;  1S1U A;  4Z7C A;  2R2T A;  5GVQ A;  1T3O A;  2DO0 A;  2NYH A;  2GNK A;  2RAQ A;  4UST A;  1R43 A;  3TYT A;  2WOM B;  3ILL A;  3Q8Y A;  1C1B A;  2HS0 A;  3P4U B;  4WBF A;  5DRK A;  3ZNU A;  2W9C B;  1N33 J;  3MR5 A;  2C3M A;  1EET B;  2PDA A;  3MMC B;  3MOJ B;  3KG0 A;  3PV8 A;  1JLG A;  4RW8 B;  3T41 A;  3Q0A A;  1REG X;  1KC8 T;  2FY1 A;  2UXB F;  2UXC J;  3QMQ A;  1VRT B;  4DX7 A;  2J9E A;  4IRD A;  3QOQ A;  1RAE B;  2C3P A;  4E0D A;  1C1B B;  1TEL A;  3US5 A;  5HMZ A;  2LEB A;  4NOH A;  4DV3 J;  2AQ4 A;  3ULH A;  1X4A A;  1RTJ A;  3GR0 A;  1UVN A;  5DDR C;  2HQG A;  3EVO A;  4B9S A;  2EG2 A;  1NB7 A;  4WZQ A;  1FHT A;  4A8Q A;  1CC7 A;  2BJ9 A;  1TK8 A;  2C2N A;  2VU5 A;  3DMJ A;  1HQU A;  4HAC A;  4HL9 A;  2XB2 D;  4K2J A;  2BAB A;  4URG A;  4DSF A;  3SEO A;  4WFX A;  1T9U A;  2ZD1 A;  2NZC A;  4MK7 A;  5E33 A;  3DLH A;  1KRP A;  1U47 A;  4N8O A;  2R8I A;  1Q7Y T;  3EWG A;  2FVS A;  3VHQ A;  5KOW A;  2UUB J;  1MLA A;  1XTZ A;  2FDN A;  4K4S A;  3HM9 A;  1WJ9 A;  1PAR A;  4CO3 A;  2XY7 A;  1U2R A;  3QLH A;  5DLG A;  1T9X A;  1U24 A;  1UW4 A;  2WHO A;  3ZTQ A;  2BDP A;  1TVR A;  4C8M A;  4H4K A;  4P10 A;  5CD4 A;  4GKJ F;  3ISZ A;  3L7U A;  1SC3 B;  3TAP A;  1Y11 A;  3BN7 A;  2UUW A;  4YQW A;  4DEZ A;  5FLX U;  1N5T A;  1E6V B;  3T19 A;  3CUN A;  1T9Y A;  3NGU A;  2RD5 C;  1JLF B;  1RIS A;  1TL3 A;  2HNY A;  1R7I A;  5C42 B;  3J81 Y;  2FC8 A;  2E9Z A;  2F4V J;  4M5J A;  1YX2 A;  4LF2 A;  1X4C A;  3HD2 A;  2G13 A;  2JX2 A;  4IG3 A;  3FBE A;  3GFH A;  4LVO P;  1D9A A;  4U8V A;  2CVI A;  1MW7 A;  4X66 F;  1HNW F;  1YZ6 A;  2LCW A;  2ZWO A;  3NGD A;  4MKV A;  4C4W A;  1I6J A;  1TL1 B;  2B5J B;  4YP3 A;  1FFW B;  2VA3 A;  4DR7 F;  1NHV A;  5H9E J;  2CJK A;  3GE9 A;  4ZN3 A;  4KAI A;  2K3K A;  4BBY A;  2W2Q P;  5KG0 A;  4ECS A;  1KVK A;  1H38 A;  3JAM Y;  1TK5 A;  1UTA A;  4QW8 A;  3HHD A;  4Y2K A;  3A8K A;  5L9X A;  3B78 A;  4KFB A;  8AT1 B;  2R2R A;  4C3K A;  4DZD A;  3KKF A;  3A8J A;  3A4T A;  5EN1 A;  1IKW A;  2VZ9 A;  3NGR A;  4J7C A;  4TYB A;  3MD3 A;  3NKY A;  4DQS A;  3CVK A;  4RBU A;  4I6Y A;  4ZOS A;  3UE2 A;  3I31 A;  4GC7 A;  1WSR A;  1JXV A;  2MZT A;  2XGP A;  4DR2 F;  1O0P A;  1JLQ A;  2CWK A;  2KI2 A;  1WF0 A;  2KRR A;  2Q3P A;  3CCS S;  1K1Q A;  1WI8 A;  1OY6 A;  2Z0G A;  2Z57 B;  1RAB B;  1XNR F;  5HMY A;  1NH8 A;  1NSA A;  3AOD A;  2R7X A;  2H4Y B;  3C14 B;  2XY5 A;  2KKE A;  2WVF A;  2W01 A;  2KT3 A;  3AT1 B;  2G9O A;  2DNK A;  3D1H A;  1VIX A;  3MED A;  4LF5 F;  1GMU A;  2FQQ B;  1PIL A;  2J7U A;  1NK5 A;  1AYE A;  4KB7 A;  4TLR A;  2U1A A;  3P8B B;  3RU0 A;  4WII A;  3R7S B;  3SQO P;  4F4W A;  1B0P A;  3EYZ A;  3HJF A;  2DRD A;  5ETL A;  1HHQ A;  3OTB A;  3S01 A;  3RB3 A;  1WG1 A;  4FVM A;  4KFB B;  2OMO A;  2W2M P;  4J9O A;  1YQH A;  3HJV A;  3PEH A;  2K1R B;  1OHN A;  2NYI A;  1NPP A;  3DLK A;  4KPC A;  1Q1K A;  4USV A;  3GU0 A;  3MAH A;  3M2U A;  1U6B A;  2F4V F;  1B7F A;  1KN6 A;  3K89 A;  2CWX A;  2KVQ E;  3KFW X;  3OV7 A;  1RAH B;  1RBL A;  3P5T L;  2KYX A;  3BO4 A;  3DLG B;  1ZTW A;  3TEG A;  1EKR A;  1FDD A;  1S1X A;  3IR7 B;  4NRT A;  1EZZ B;  1RT2 A;  5ADZ A;  3Q8Q B;  2AJ1 A;  3GIK A;  4OX9 J;  1Z2Z A;  1S0V A;  4K4W A;  3M9O B;  2VG5 A;  4ZP6 A;  4YDD B;  4AQY J;  4AXJ A;  2J5A A;  1NLA A;  1UP1 A;  2HWT A;  2LA4 A;  2PT0 A;  3C14 A;  5DS7 A;  1URN A;  4GKJ J;  1DFD A;  3P5B P;  2BKN A;  3LGH A;  1X5T A;  1LNQ A;  1H73 A;  4NI2 A;  1VLY A;  1C1C A;  2AY0 A;  1MMN A;  2IC3 B;  2OPS B;  2OUG A;  1CJT B;  2ZZT A;  3AJ2 A;  3FC9 A;  3GJR B;  5IC6 B;  4F26 A;  4ZLJ A;  1K9M T;  4LF4 J;  2XQC A;  4RW9 A;  4HH0 A;  4A8W A;  4WWS A;  1HNI B;  2RIJ A;  3EDQ B;  3KJQ B;  3EIC A;  3X3U A;  1F9E B;  1FK9 A;  1GXL A;  2WON B;  2IIH A;  2QZ8 A;  3H98 A;  3UVJ B;  3KLV A;  2JSX A;  2R7V A;  2LEC A;  2D69 A;  4DV2 J;  1WHY A;  4ZLP A;  5T7L B;  2R7S A;  4HDH A;  2M7S A;  1RXO B;  2GQ2 A;  2CAD A;  1F6T A;  1QM9 A;  3DN9 A;  3AXM A;  3UN2 A;  4CP5 A;  4DV6 F;  4IOB A;  4JI1 F;  4ID8 A;  2PE8 A;  1EET A;  3QGG A;  4NZ6 A;  2KTQ A;  2YNG B;  1C0T B;  3JB9 k;  1PIE A;  1BQN B;  1Q8L A;  2HFN A;  3CB4 A;  1HHT P;  2JNJ A;  1S7H A;  1UEV A;  1G7C B;  1T03 B;  3VEA A;  5E0O A;  4TNO A;  3KWM A;  4IFV B;  3V6J A;  1S9F A;  3DKD A;  5G4D A;  1RWU A;  4A48 A;  2DGV A;  3OQ2 A;  3DLE B;  1LWF B;  5KFW A;  4QIG A;  4LT6 A;  2RHQ B;  3I4H X;  4QWE A;  2HG4 A;  1FWL A;  1SH0 A;  1IR2 A;  5F9N A;  2XCA A;  2EW9 A;  2X3G A;  5AE1 A;  3GV5 B;  5CYQ B;  5D3G B;  3MPW A;  2DIV A;  1S49 A;  2FIU A;  3C19 A;  3DRP B;  2ZJQ Q;  2BR0 A;  1JB0 C;  2CJB A;  2CPY A;  1UVL A;  2XS7 A;  1HKA A;  1CSJ A;  1S9E A;  4A47 A;  4BDP A;  2ASD A;  4U7C A;  1LWF A;  4OI0 A;  3BGU A;  2K3I A;  3ZO7 A;  1VGY A;  3W9I A;  1OIA A;  5LMU J;  2DGU A;  3AB4 B;  2K1R A;  1F9F A;  3V5R A;  4BC7 A;  3RBD A;  3KLI B;  3RBX A;  2XTJ P;  1I3O B;  1B01 A;  1RT7 B;  5IT9 U;  2H1O E;  3G6Y A;  4CLL A;  2H51 B;  4XDD A;  5FDL B;  1SIW B;  1YK9 A;  3LAK A;  4M8L A;  3ETM A;  4WFZ A;  1Q4R A;  1WC4 A;  1R8C A;  2IAJ B;  3OFF A;  4I2Q A;  1S97 A;  3NP5 A;  3C15 A;  2XMW A;  2VOP A;  2RF2 A;  4FYV B;  5KAK A;  3THT A;  2YH0 A;  5AXN A;  1OO0 B;  2OI2 A;  1S1V B;  2QV6 A;  3NS5 A;  2D3O R;  1IBK F;  4K0K J;  3H0P A;  4PCQ A;  4WU3 A;  4B08 A;  5EHH A;  3OFG A;  1D3W A;  3LQV A;  5HMW A;  3GMG A;  5B7W A;  2KFZ A;  2IAJ A;  1UVJ A;  5DM7 Q;  2VUG A;  1WC5 A;  1D9F A;  5F8J A;  3DHX A;  1X9S A;  1Q81 T;  2UUC F;  2WVB A;  2ZH2 A;  5A8W A;  3RAM A;  4P74 A;  1NHK L;  4HHH A;  3FBC A;  3EE3 A;  2G1D A;  3U7J A;  4YUD A;  2HND A;  4K4Y A;  2EK6 A;  5H9F J;  2HLT A;  5L1J A;  4K4V A;  3HSD A;  2RDD A;  3CJT A;  4NA1 A;  2OD6 A;  2XZW A;  1WEY A;  2DVI A;  3Q89 A;  1QTG A;  3MMC A;  3WC2 A;  4PG7 A;  5HBM B;  3V4I A;  5B0D A;  4PXC A;  1HWK A;  3HUL A;  2V69 A;  3FSI A;  5AXM A;  1TV6 B;  4CTA A;  2BRL A;  3I82 A;  4WTO B;  2HHH J;  3LW5 C;  4QIW D;  4LF9 F;  1OJ4 A;  3MGJ A;  3SDE B;  3IR6 B;  4DU8 A;  4NLT A;  2HZV A;  4Q2L A;  3QZ7 A;  2ZH6 A;  1U1Q A;  2FVP A;  3KTQ A;  3U02 A;  3VV2 B;  4ALZ A;  3Q24 A;  3N28 A;  2APO A;  3V6H A;  2DRA A;  1HBM B;  1GXU A;  2DNQ A;  1X60 A;  4RPF A;  2V4J A;  1DLO B;  4Y00 A;  3PR5 B;  5K14 A;  5D6G A;  2BQU A;  3O6Q A;  3TR5 A;  3NGT A;  1X4D A;  4EI2 A;  3EGV A;  4CLF A;  3QO9 A;  2FJD B;  2O3D A;  4IQX A;  3DU6 A;  4ZPV R;  1Y3J A;  3DC2 A;  4ATN A;  5DQG A;  3K0J A;  1MSW D;  2NZ4 A;  1FDA A;  2AJ2 A;  2ZOF A;  3FRY A;  1ARO P;  3GYX B;  4GMK A;  4DX8 H;  4U95 A;  1MN9 A;  2VIC A;  1SUQ A;  2YWG A;  1MML A;  4OYB A;  4PWU A;  4OZ1 A;  4FYW B;  4FDF A;  2V2Q A;  4QR2 A;  4P9S A;  1DHM A;  2YQ0 A;  4Q43 A;  2Q43 A;  4UOF A;  4UUW A;  3MCN A;  1WC3 A;  3BO3 A;  2FTR A;  2ZBR A;  3M4X A;  4NZ0 A;  1T05 A;  1JJC B;  4AFF A;  4WFY A;  2VKZ G;  1CJK B;  3EXC X;  3DRR A;  3MDF A;  3PHE A;  1BWE A;  2PEB A;  3MUV P;  5E3C A;  3RR7 A;  3TI0 A;  4OHW A;  4DF4 A;  1Y00 A;  3BR9 A;  2HGL A;  3KG1 A;  2NUH A;  4LUB A;  3CC4 S;  3CD6 S;  3IRX A;  5D77 A;  4OLO A;  3JSR A;  1X5P A;  1B64 A;  5IQ6 A;  3TUZ C;  3KK3 B;  3C66 A;  3KLE A;  1GAO A;  2QLB B;  3H8Y A;  3UD5 A;  2K2P A;  4OYM A;  2NPI A;  3DYA A;  3IS9 B;  1PG5 B;  3EVM A;  4L3K A;  1XR7 A;  5D4P A;  1T03 A;  1XR5 A;  2CZV C;  3IAS 9;  1HI1 A;  2CQP A;  3FEX B;  5JMN A;  1S76 D;  3K58 A;  4CT9 A;  1E6Y A;  1WDD A;  4K5R A;  3HHE A;  1NJI T;  2B7C B;  1N6Q A;  1X93 A;  4MYT A;  2H9Z A;  1N32 J;  1D8Y A;  3G82 A;  2R7Q A;  2ZUA A;  3BSA A;  4ILR A;  4J9N A;  3KMQ A;  3U27 A;  4GC6 A;  3WIU A;  2C2M B;  3R2D J;  4DUZ J;  5CCM A;  3QLH B;  3Q8V A;  2HW3 A;  4MK8 A;  3T1Y F;  2ZM6 J;  5E41 A;  2OH2 A;  5EUH A;  3CJK B;  2RRA A;  1PSD A;  1P94 A;  2HBY B;  1HNX F;  1DTT A;  3DRY A;  5HN0 A;  3KXD A;  2KYZ A;  3H40 A;  5KG4 A;  1HYS B;  1IBL F;  3CDB A;  1S0N A;  3CJR A;  4OYZ A;  3MXH P;  3HZG A;  5HVG A;  4C11 B;  5FDL A;  4IO9 Q;  2R8J A;  4C97 A;  2V4Q A;  4LF7 J;  3GSD A;  2FZC B;  2IDL A;  4QIF A;  2C22 A;  1A6L A;  2J6U A;  4KPY A;  3R1H A;  3R3T A;  6AT1 B;  1NBE B;  1OPI A;  1L3V A;  4FNI A;  2OGU A;  2R8K A;  3B6B A;  1ZOT A;  3IM8 A;  2DIS A;  1S72 S;  1N6Q B;  2Z2Y B;  4TYA A;  2L9D A;  4UQG A;  3QRP A;  4XAK A;  3KUE A;  1SKW A;  2VOO A;  4P7T A;  2PMW A;  1SJF A;  4GKK F;  4JB8 B;  2J6T A;  1S6U A;  3G4S S;  1M5V C;  4UY8 5;  2KB2 A;  4FF4 A;  4O3Q A;  3CJ4 A;  3BH7 B;  2RQC A;  4JI5 J;  5C2C A;  5LMN F;  2WB1 D;  3TEH B;  3Q23 A;  2DIT A;  4WXO A;  1XMQ F;  4RU2 A;  2OEM A;  2KL8 A;  4M5I A;  4Y65 A;  3WC0 A;  5MLC V;  3DOK A;  3BPD A;  5J2P A;  1DLO A;  1GTH A;  4DBQ A;  2AN7 A;  1HW8 A;  1FE0 A;  2A2C A;  2EWH A;  2OAU A;  2CZ4 A;  1FEH A;  4MYU A;  2RHS B;  5AJ3 F;  1RGV A;  1MYK A;  5F8L A;  2BE7 D;  3LGN A; 
#chains in the Genus database with same CATH homology
 1X93 A;  3GXQ A;  2BNW A;  2WVB A;  2BNZ A;  3BKF A;  4HV0 A;  2HZA A;  3BKT A;  2BA3 A;  4FXE A;  1PAR A;  1BDV A;  2JXG A;  2CAJ A;  2WVF A;  3H87 C;  3QOQ A;  2CPG A;  2GPE A;  1B01 A;  1Q5V A;  4ME7 E;  2H1O E;  3FMT A;  1U9P A;  1NLA A;  2K5J A;  3OD2 A;  1BDT A;  3PHT A;  1EA4 A;  3VEA A;  2CA9 A;  2K29 A;  1BAZ A;  3LGH A;  1P94 A;  2BJ7 A;  1QTG A;  2JXH A;  2WVD A;  2BJ8 A;  2K6L A;  2WVE A;  1Q5Y A;  2F1F A;  2AY0 A;  4D8J A;  1ARR A;  2K1O A;  2BJ9 A;  3QSI A;  2K9I A;  2WVC A;  2JXI A;  2CAX A;  3VEB A;  1MNT A;  2PC6 A;  1ARQ A;  3FT7 A;  1MYL A;  2BJ1 A;  2HZV A;  2BSQ E;  3VW4 A;  2NZC A;  2BJ3 A;  3BKU A;  1MYK A;  2Y3Y A;  2RBF A;  1B28 A;  1IRQ A;  2KEL A;  2CAD A;  2FGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...