2WVBA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
130
Chain Sequence
b'DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTAIAMDEHNSLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 36
structure length 130
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvbA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvbA02
4FXEA 2CA9A 2CADA 1MYLA 1EA4A 2WVDA 2H1OE 1NLAA 2K5JA 1IRQA 3VEAA 1U9PA 3FMTA 2BNWA 2WVEA 3BKUA 3GXQA 2JXHA 3QSIA 1P94A 2PC6A 1PARA 2WVCA 2JXGA 2WVBA 1Q5YA 2AY0A 1B01A 3FT7A 4D8JA 3LGHA 2NZCA 4ME7E 2BNZA 1ARQA 2K29A 3QOQA 2KELA 2BA3A 4HV0A 3BKTA 2HZAA 2K6LA 2BJ9A 2CAXA 3OD2A 2F1FA 2RBFA 1BDVA 1BAZA 2BSQE 2K9IA 1BDTA 1QTGA 2JXIA 2BJ1A 1X93A 2CAJA 2CPGA 3BKFA 2BJ7A 1MNTA 1MYKA 3VEBA 1ARRA 2WVFA 2Y3YA 3PHTA 2HZVA 3H87C 3VW4A 2K1OA 2BJ3A 2FGCA 1B28A 1Q5VA 2GPEA 2BJ8A
chains in the Genus database with same CATH superfamily
2NS1B 3SFUA 1K1SA 3UQSA 3BPDA 4CDIA 3QT5A 3AODA 4HL9A 4ID8A 1R27B 2R8GA 2FJDB 1V3ZA 2GFFA 1PARA 4USVA 2AZ1A 2CPZA 1RA6A 5F8LA 3CCES 3HHEA 3HHLB 3DYAA 2AJ1A 3VALA 1FEHA 1T95A 4ZPVR 1Y9OA 4MK8A 3R1LA 1Y5IB 3KLHA 5KFIA 1SC3B 3JTOA 3D54A 4MYUA 4A8XA 2IC3A 4FBTA 3Q8YA 3FBFA 4G3IA 4ECWA 2R8HA 2QLXA 4ZJQA 2HNZA 4QWDA 3V5RA 4F0HA 1WUUA 3D3BJ 3UDVA 1SI9A 1D1UA 4V19X 1IKVB 4I6AA 4PXDA 3QZ7A 3MCOA 1C0UB 2D74B 5JJBA 2J6TA 1CC7A 1GXTA 4IH6A 2W4DA 3MCMA 3IAM9 3RGIA 5K8MA 4Q2MA 4WCEQ 4DR6J 5A2QU 5A8KA 2UXBJ 5A8RA 4IQXA 2MQMA 3EGWB 3M32A 1T05A 1KRPA 4O3SA 1N36J 4PPDA 2UU9J 4N56A 4AXJA 2I6WA 2BQUA 4TXSA 3ZZZA 1YLXA 1VQYA 3M9NB 2VJUA 2ASYA 1UW4A 4PXCA 2ACMA 2FJWA 2MMYA 4NCGB 2J9DE 1Q82T 3CWJA 4AUKA 4C8MA 2VQFJ 1EP4B 3W9IA 1IQZA 2J7WA 3B82A 1P6TA 8RUCA 1WG4A 2NREA 2XYPB 4B9UA 4DUYJ 3H4BA 3EGNA 4PG4A 1RWUA 5AT1B 4DR5J 4U7CA 2QJ3A 3VVTA 4UZBA 3C3LA 1HARA 1WHXA 3MOJB 2HQFA 1U1NA 4IFVA 3PCOB 3KHGA 1SH0A 4EBDA 5DRKA 4Q5VA 2WVDA 2FLOA 1KONA 2W2OP 2YKPA 2QFIA 4EMDA 3N5FA 1QVFR 4JI5J 3DHXA 1RP5A 2AYEA 2X51A 1GXUA 3G8TA 3FBCA 3PDNA 2KO1A 2EG1A 1NJYA 1UEUA 2GIQA 2IM0A 2J7KA 4EO6A 1S0NA 3NNHA 5A8WA 2HURA 3MMBB 2VICA 4NXMF 4FF4A 3V6JA 5B0EA 5G0RA 3P8BB 5D8HB 2FHKA 1S9EA 2DGXA 1FTRA 2YKQA 3AOBA 4H4OB 5HBMA 3BR9A 2A6MA 4RUAA 2MTLA 4B9LA 4ICLB 3MM5B 2CQCA 1QE1B 2QSWA 3NS6A 2E1AA 4JI4J 5M2RA 2RDDA 1YITS 2PI4A 3OLBA 1SKWA 2DNNA 4UUXA 1RBOB 2EFNA 1C2PA 2FDNA 2E7WA 3UD4P 4RUHA 2Z30B 1NBEB 1ZAXA 3DU5A 1JQGA 2QMUB 3DFEA 5KFGA 3R7SB 4ZPTR 2DT9A 5ETSA 4YUDA 1FKOA 5DG9A 3NL0A 3NAIA 3ISNC 1NPPA 1TUWA 1FFWB 3GYNA 1V3SA 3NBPB 3AD8C 2P9CA 3GFXA 4R25A 2UXDJ 5KG2A 2BA3A 3MM8B 4OLPA 3ZZTA 4PPZA 3W2WA 1SBRA 1HYSA 4NWBA 4M5HA 4OYBA 4EZ9A 2ZDOA 3WIUA 3I0RA 1ICEB 2U2FA 1C4CA 2VDHA 2VPWB 4HDHA 4NZ0A 4YDXA 3KDNA 4ELVA 3SSQA 4EBCA 4D3GA 2KKEA 1C1BB 5HN0A 3I6PA 1WSRA 1HMVA 2CQ2A 1RT1A 2HEKA 1UJ6A 4ZVOB 3D3CJ 4QR0A 5D4LA 3N6NA 3UN2A 1ZBTA 3BB5A 1X4EA 3HVWA 1H6KX 2RHQB 3LP2A 2WZ1A 3PYEA 1BY9A 3KOAA 1X5SA 1KHWA 3SDEA 2FLPA 3MPVA 4C8NA 5L9NA 5KFYA 3P3DA 2FVRA 2MHNA 1KQSR 4Q8FA 3QIDA 2HK3A 1S6OA 2H1YA 1RISA 1SC4B 2B9XA 1YJ7A 4A47A 3HCXA 4CO4A 3BGLA 1X93A 2A1BA 1HD0A 1J5EF 2WW8A 1RT6A 1DLOB 4ECRA 1FNXH 2AU0A 1FRHA 3R5AA 1CG2A 1IKYA 1XC9A 1T9UA 3HVTA 1OIAA 3F41A 4X64J 1S49A 5A2QY 3UO0A 1HI8A 3PRBA 3C6UA 2HHSA 5HMYA 3SCKE 2V2QA 5E41A 2Q6BA 3C16B 5J2MB 4KPYA 3DLEA 3J80U 4ILLA 5KG7A 1H2VZ 1WOOA 5J2NB 1S6QB 4WKYA 2ZH4A 2E1PA 3RB4A 2L9DA 1NJWA 2CNNB 4M5MA 1LWFA 1R0AB 3CIMA 5KG5A 4KKOB 1RK8A 1HQUA 4OZ1A 1RGVA 1NRKA 1Q5YA 4R0JA 1FDDA 4PEOA 3CJ3A 5ETVA 4QW8A 4URQU 1RT7A 1HBNA 1Y7PA 1REVA 1TK5A 1TL1B 4KQZA 4LFAF 2MYFA 3FC9A 4OZ3A 3PW2A 1XR5A 4YN3B 3WBZA 2L3MA 1UVIA 1Q16B 2KDOA 2VB6A 1JLBB 1DQAA 4DR7J 5AXLA 3FGVA 4AXIA 5EWGA 3ZZRA 1S1UB 3N4WA 3FQKA 2F63A 3OUYB 3GJSB 1YJ9S 2W24A 4XPEA 2DISA 3AOCA 4LF8F 4JI2F 4NZ7A 1IBCB 4DQQA 2CQ4A 2CUYA 3DOMB 4YR0A 2HVDA 1OYDA 5ADZA 2YPZA 2DITA 5KFJA 3CJKA 2CPJA 1NAQA 3QRRA 3GTYX 4ANCA 1Q78A 3LOUA 3MWBA 2YKNB 1HNXJ 3Q2TC 2DNMA 3D67A 2F4FA 3IRWP 2H48B 4QWCA 4JB8B 4J9SA 1WKLA 3CDWA 2D3UA 2JSXA 2I0XA 2ZKTA 2QGFB 1DQ9A 2D69A 3NG8A 1HKAA 3KTQA 2JEJA 1N5YA 1RA7A 1Q4RA 3FFIB 1NDPA 3LUYA 3OV7A 1R6YA 1IWAA 1QM9A 2DGQA 4AL5A 4WFXA 4X65J 4NLRA 1RKJA 5LXYA 4A48A 3VAHA 4F3OA 2W9CA 4OV1A 4TY8A 1U6BA 4O4GA 2DB1A 4KBIA 5J2PB 2QA4G 3R5BA 2UXCF 1RBLA 1HNVB 5IFMA 3BF4A 2Q2KA 3MTKA 1V3RA 1D3WA 1CS4B 2OH2A 5IC6B 2ATLA 2VFTA 1KQGB 3KKFA 4DUTA 1DARA 2KXHA 1U1MA 4WP8A 3HVRA 2ASJA 2DNOA 2YWKA 1TK0A 2PD1A 1SJFA 2J76E 2Y0SD 2RAQA 4Z7YA 2LVWA 1HL6A 2E7VA 2GMJA 2QA1A 3R2DJ 1UWAA 2F5GA 1DZ5A 1B70B 4TLRA 3PZPA 4DV0F 2WOMA 2BANA 2E9RX 5I3UA 3Q22A 2P9EA 2W1BA 3QO9A 3LP0A 3U1NA 3C14B 3Q8RB 3M9OB 1Z1ZA 4P52A 1BXNA 3WZ0A 3QGPA 2IA6A 1B99A 2DYAA 3OSNA 4RW4B 2GVZB 2DR6A 4ZMMA 1R0BG 1X5TA 2HQIA 2BA9A 3TAPA 4C8YA 1VC0A 1TTHB 1D09B 1X31C 5CYMA 5F0UA 4DFKA 2MKKA 4LUBA 3D66A 2W9BB 3R5JB 4IH7A 2IIHA 1M1HA 4WTYA 2HZCA 1X4HA 3IN5A 2AIRB 3FKBA 1NDLA 4AT1B 1K8AT 1B01A 4ANEA 4C8ZA 5E3RA 4RNOA 2FVPA 4DG1B 2CQ0A 1RHMB 4L3KA 1YGYA 3V6HA 3OXLA 3PG9A 4BDPA 4NEYA 5SUHA 4GVBB 1FJ7A 4NLPA 4DV3J 3WX4A 2DXDA 2M7SA 3UW1A 1Q86T 2HHVA 4ZS6A 1EETB 1RT5B 3J80Y 2JBVA 1XR6A 2AJFE 3BYPA 4OI4A 1M5VC 1N5TA 3G6ES 1Y0HA 2MDAA 3P6YC 4IDKA 1DFDA 2DNLA 1WC0A 3LANA 2K1OA 2C2NA 1TKZB 1KFDA 5K14B 3K59A 5KFTA 4OZJA 3CVKA 2I8EA 1RAEB 2CADA 1BQNA 1EA4A 3GJQB 3CCUS 3WC0A 1HPZB 3CJQA 3VAMA 2VUGA 2EXUA 1Q81T 2AJ2A 1MG7A 3RJMB 4NLQA 1FX4A 3JSMB 3F73A 3KYLA 1TL7A 2AY0A 3ILIA 1JKHA 1GTHA 4ZIWA 1Q95G 2MKJA 2QZ8A 4CO5A 2UXBF 3AJDA 5KFFA 1C1CA 1XNRJ 1Y5NB 4X4PA 2BJ9A 3AB2B 2B4OA 2Y8WA 4IG0B 3OTDA 1WSVA 2DEJA 1NSAA 2UU9F 1SJQA 3PR5B 2K1RB 1VQPS 2EPIA 4LRAA 3MPDA 4ZCIA 3AJ2A 4ZIVA 4PKDB 3KHLA 3UD5A 1UVNA 4U95A 5D4NA 4JI0J 4XPCA 2VASA 1NK9A 1AUSL 1S79A 2AYGA 2DD8S 4RW8B 3I96A 3I5CA 3IMQJ 3R7NB 1PSDA 2RT3A 2PMHA 4A8OA 4DR5F 3HMJG 4KH1B 3DC2A 2QLFB 1HR0F 3UE2A 1I1GA 2IBKA 5HANA 2ZOFA 2JHEA 2BEFA 2V8GA 4QW9A 4A8MP 3TRGA 3W62A 3GXQA 1NPRA 4ZVFA 3MCNA 4F4KA 1EX8A 3M8WA 2R8IA 5H9FK 3S01A 4IRCA 3DRXA 3M1VA 4X4RA 2MY8A 3MHYA 3V81B 2DHSA 2XZTB 2RUGA 1RTZA 4NRTA 2DO4A 2MZSA 3WHIA 3I4HX 3CD7A 2KXFA 3RYLA 1U09A 5CH7B 4DV4J 5KOXA 3W2VA 1UFWA 4B02A 4B17A 3ZNJ1 2P5VA 1TFYA 3G6XA 2KZZA 2R7WA 4J9UE 1ZETA 1KLMA 4C8OA 1R8CA 3ICLA 2FGOA 1Q8BA 3BQ1A 2H4WB 1YTYA 5B0CA 4F02A 1D8YA 2B4UA 3HZEA 1Y00A 3H7HB 4M94A 2EVZA 1HBOA 3W61A 2VA3A 3KUEA 2RQMA 3DLKA 3PX0A 4CZCA 2MQLA 1FTCA 2LU1A 4B3SJ 3NNAA 4B3TJ 2LA6A 3RZAA 1XR7A 2GVDB 3CCZA 2HBQB 1GX6A 1RWWB 1S6UA 2R2RA 3IM8A 1YJRA 3K2YA 3PACA 3VAFA 4NEZA 3HHLA 3HFKA 4MIAA 4BWJA 2JEFA 4PWDA 5AXMA 1X8DA 1V9OA 3H5SA 4PG6A 1RAOA 1FRMA 1G2EA 2V67A 9ATCB 1QD1A 2ZVSA 2WAQD 2UXDF 4F4YA 2KXNB 4OYWA 1QVGR 1IBLJ 1FRJA 4RW6B 3MD1A 4NA1A 2OSRA 4RW9B 2HWIA 5E5NA 3VF0B 3HO1A 3DLJA 1IR0A 4QYRA 2ZC3A 1KN6A 3OHBA 4ED1A 2KJWA 5KFHA 3W5XA 3H90A 3DMJB 1JJHA 2MZTA 1I94F 1WWHA 2GCFA 1IKVA 3GB0A 4FN5A 2GO9A 4XAKA 1SL2A 2OJ3A 4FVCA 1C0UA 1G4CA 1APSA 3GG1A 3CJTA 4DFJA 4ID5B 3VEAA 4KJIA 2LXFA 1DAXA 1U49A 3I9V9 4Y0FA 2KVIA 1HNZJ 3PYGA 2CVIA 2LEBA 1S9GB 4C8LA 1VBYA 1WC4A 2VH7A 4FXWA 5DZ6A 1CJVB 2D9OA 5T7LB 4F8RA 2NPIA 1JJ2R 2HFUA 3WIVA 4GO7X 7FD1A 3O2IA 2CG4A 3BGOP 1RADB 4OYAA 1BUXA 2EI5A 2F8HA 3MMCA 1CBKA 3AA9A 5AXKA 2ZBQA 1FKAF 1UWBA 1WACA 2P9GA 4UF4A 1BWEA 2DIVA 3D2WA 1RHQB 1OSDA 2BX6A 5HO4A 4DPOA 5LSLA 1DHMA 3FJ2A 3M6WA 2F8EX 4ZVQB 4AL7A 1AZSB 3X3UA 1TL3B 3MGJA 3I56S 4HACB 1RU2A 4O3RA 3EGVA 3M8RA 4QQBA 4X64F 1RUSA 1W7WA 4PR6A 3BR8A 1RHRB 2B8PA 3G86A 3IC1A 1DTTB 1H72C 1WHWA 3MM9A 1BWVA 3OTOJ 1RHJB 3P45B 3AT1B 4P2XA 4OL8A 4YY3J 1KD1T 3G5OA 2IRXA 4DX5A 2YKOA 2BBEA 3PW5A 3NCPA 4NMXA 2CPXA 3MMBA 4PWWA 2XEXA 3ETOA 1S7HA 1G3OA 4QYZJ 1IKXB 4MAKA 2DNQA 2OMLA 4K2XA 4H4OA 3KLEB 4DJBA 4ZVRB 5C7PA 3RB3A 2MY7A 4GC6A 4ICLA 3MAQA 5GADI 2XCAA 3N79A 3MM5A 1R8PA 1QE1A 2RUSA 3GIKA 4QWAA 5DZ7A 2BKOA 3L7UA 3W5YA 2EEYA 4G65A 1X5PA 4Q44A 4ED0A 2ADCA 1PYTA 1G1XA 2VIHA 2MXYA 4O0IA 2H5IB 2OI2A 3IR7B 2LQ9A 1F3VA 1X0PA 4DR7F 4N5SA 2RMLA 2KTQA 3BSNA 3S1TA 4RWWA 3M2RB 2AX1A 5DM6Q 3R2CJ 3IGVA 4ITSA 4L74A 2DIUA 1MLAA 3RRHA 1N34J 1B7YB 2FQQB 2A10A 3K89A 4DV5J 5DLFA 3BQ0A 2NYHA 1MWYA 3MTJA 3NBPA 3E3XA 1HQ2A 5DDOC 3AXMA 5HVFA 1HNXF 5EN1A 1VQNS 3LAMA 3MM8A 1SJ4P 3KNGA 4LF6J 1FWPA 4UZCA 2LXUA 4I56A 2BE9B 4WP9A 2CJQA 5DDQC 3SZ2A 4S0MA 5J1EB 1SV5B 3JSYA 1HWKA 4QIGA 1SCJB 4MKAA 4DN0A 3KLFB 1UKUA 2GPEA 1BLUA 3OVSA 2Y1JA 1BE4A 4HVZA 1RAAB 2R8KA 3I55S 5AXNA 4LF5F 1C1BA 3QNWB 1H0HB 4B08A 2V68A 3W65A 3FMTA 1M1KT 4RU9A 2LEAA 4P72A 4KR0B 3IGNA 1P9YA 3LP1B 3DGPB 2YNIB 2E9ZA 4KGXB 2V69A 4RPFA 4RW7B 3FT7A 5ETOA 2BUNA 3HJVA 1XNQF 4FKXA 3B8HA 3R27A 3RR8A 4V19J 1Q79A 4CCHA 3JSBA 2XGPA 1RACB 4CO1A 1WEYA 4PUOB 4W90B 4O3PA 3NMRA 2YWEA 4M5KA 4OI3A 2OSQA 1CQMA 2XHCA 4ECZA 4IUFA 1DLOA 1RWMB 2QYGA 3SV4A 2F4VJ 3Q24A 2G2OA 3IP0A 3VAKA 4RZRA 1S6PA 3O44A 1AUDA 4RNFA 5KFQA 1RDRA 3RW6A 2YXLA 1BC6A 3MFHA 4J91A 2OGUA 2CNKB 4ZJLA 5J2MA 3C16A 5CD4A 1ZA1B 3CJSA 3H4DA 2PFDA 5JVHQ 3IWXA 2HW3A 5J2NA 2AGPA 2B6AB 2PC6A 4KO0B 1R0AA 4KKOA 4H4MB 3ZO7A 1GXLA 2KB2A 3NCRA 5HQMA 2B0GA 2KG0A 5KFUA 5HROB 2RB7A 5K8OA 5EDWA 3W63A 1H2UX 5AE1A 5AE2A 5IV4A 4Y6IA 4F25A 1YWXA 1VDHA 2NPFA 2HQCA 1A7GE 1KKHA 3D1QA 2OLWA 1MN9A 1TL1A 1U1KA 2F65A 3D0HE 4OJ3A 4ZLPA 2CQIA 3CCMS 5L8RC 4DV3F 2HFNA 1Q16A 1JLBA 2XMVA 1VR6A 2W9AA 1HNWJ 3BV8A 2I38A 2X1BA 3VHQA 1U6FA 3MI7X 1S1UA 1RT2B 4DR3J 1K73T 2OAUA 4DCOB 2BOPA 1UFLA 3W5ZA 2H65B 1VQLS 4ZP6A 3D6HB 2F7VA 3DOMA 3TI0A 1H38A 2PGCA 4FF1A 1N5VA 4HDGA 1NJZA 1T9VA 5L46A 4Y65A 2MLYA 2VBYA 1PJ5A 2YKNA 2YVSA 3H5XA 4P2SA 4X4OA 2XS7A 3UR0A 2F40A 4OIXA 2IVYA 5DGBA 4F26A 2GNKA 5KFLA 4ZN3A 4NE9C 5IQQA 3M30B 2HWTA 4H4KC 4M5IA 2ZBRA 4DL0C 1FE0A 5MAOA 4EK2A 3DNCA 1NZ8A 3PIOQ 2M52A 2M9KA 4XO0A 1BDVA 4C6AA 3D1HA 1WF1A 3CT9A 3JTPA 4ES1A 5F8IA 4CH0S 3AQPA 1C4AA 4HH0A 5BXIA 2QA4S 2DXEA 1KOOA 3KDOA 1KDNA 2RU9A 3E01B 2R7RA 2N7YA 5J2PA 3OFFA 1U8SA 4D3HA 1HNVA 2LU2A 3NEKA 4OYOA 2NUHA 4NXNF 1FNMA 5HVHA 4WK1A 4CLTA 1CS4A 2ROPA 3A3PB 4JI0F 1IBKJ 2EFPA 3VZHA 1R8HA 4FYDA 3H40A 4CWBA 2VD3A 4JI6F 3H0PA 4ZN1A 2G0CA 2ZH9A 2P2CB 2IM1A 3HKZD 2JXGA 1AB8A 4LJMA 4FXVA 2EC0A 4DSKA 1KP6A 3UN5A 3HVAA 1NHVA 1JB0C 1S4FA 3GV8B 2KFYA 2DRAA 1X7VA 2CPEA 4QZVB 1Q0NA 1BAZA 2WHOA 5KT6A 3C14A 3W66A 4IFYA 2OEKA 4URGA 4DV4F 2GVZA 1ZAVA 4KIAA 8ATCB 2HQ3A 3NS5A 4KGMA 3ENVA 2W7OA 2ZE2B 5FD1A 1KC8T 3R8YA 2ZWOA 2MSSA 2CDQA 1RYRA 1MROB 3ELHA 5AJ3F 3P96A 1QY7A 4ZCKA 5C5JA 3GWCA 5ETPA 1TMJA 3VGTA 5EWEA 1M5SA 2W9BA 1WI8A 4ZLLA 1V5IB 4UTGA 1VJQA 2X3GA 3PNIA 3GU0A 3KK2B 2WVBA 5EWFA 3QGGA 3IRXB 1H7WA 1ELOA 4DWIA 1HWUA 3C8YA 2ZVIA 2ZH7A 2NUUG 4B3SF 2HNDB 2BNZA 2VC1A 2H3AA 4LQ3A 4DG1A 1PG5B 5DG7A 2J9CA 3DKDA 4LIRA 4AE5A 2AHOB 4DQIA 1VIOA 5D0HA 5HJYA 2VFSA 5GAHU 1YJNS 2LECA 3DRPB 1ZM2A 2RBFA 1PKUA 1NK4A 4GVBA 1Y5LB 3DCAA 2HFSA 2BJ1A 1SC6A 3J7YI 4RJVA 2VBWA 3CJ8A 3B6BA 2VA2A 1RBAA 3HHLD 1EETA 3CD0A 1RT5A 3OW2R 4DFMA 4ZLJA 5FLXU 4HT5A 7FDRA 4RBVA 3FUYA 1YQHA 5H1SV 1IBLF 3GG0A 4WPAA 1GK8A 3OTEA 5IM0B 3IR6B 1U0HB 3MFIA 1TKZA 3E51A 5K14A 5B09A 4JI8F 4NLYA 5ETRA 3AD7C 1G6BA 1UVLA 3PFEA 3MPYA 1IRQA 1GTEA 3FDSA 1HPZA 3BBBA 2KKHA 2XLIA 5KFXA 2QYCA 3GMGA 3IS9B 4ED8A 3MDFA 1E6VB 1O6XA 1LOUA 3JSMA 2IHR1 2R7OA 5CAAA 2KYXA 1F0XA 5GAEU 4L76A 1E6YB 2M8DB 5L1KA 1SKRA 3ILOA 2KN4A 4RBUA 3KJQB 3PR4A 3DN9A 2PN6A 2E29A 2D3ZA 4WZMA 4KT0C 4IG0A 2K1RA 4NOHA 2XB2D 3QYYA 4CLUA 3K5LA 3FMBA 4LVNP 2AGOA 3VEBA 3H8YA 4ZA1A 3BBCA 4J9MA 4ED5A 3CCRS 2AEJA 4JOUA 3PO4A 4FDFA 5KG4A 3W8PA 3ET6B 4A8KA 5J2QB 1X9MA 5KFNA 2UUAF 4AQYF 4J5OA 1JNZB 4NLTA 3MXHP 4M5LA 1WC6A 4PWUA 4RW8A 1VRUB 2VFUA 2K5JA 3OL8A 2VQEF 4PZVA 2CPIA 4NLUA 4ATNA 4F04B 2VL1A 1Q7LB 3MPWA 3X1LB 1VQ5S 1OJ4A 5J1NA 2FD2A 4G1QB 4CYUB 2Z2LA 3OR1B 3P4UB 4DQRA 1NHKL 2YH1A 2YWGA 4ELTA 1U1OA 2DNYA 2HFVA 3OFEA 4P2MA 1TUGB 1F5BA 4Y3CA 1UTAA 2DH8A 3V81A 3CDAA 1FO1A 2WSCC 4UT4A 1S1TB 2CPHA 1VQ7S 1RT4B 2JH3A 2R4FA 1ULRA 3BDEA 3ENQA 2FJVA 2IBOA 1MU2B 3J81j 2RRAA 3OR2B 3S7RA 2Y1IA 2L9WA 2GAGC 2DRDA 2L9NA 3LA0A 4EO8A 3H25A 4DV2F 4EUVA 4C11B 1IXKA 4MFBA 1GEHA 1XMQJ 4TNOA 2QE5A 2APOA 1KVJA 3MEDB 1RTIB 4J37A 3IO1A 4UOGA 5D78A 1GNKA 4I69A 4C0BA 2J0WA 4BWMA 1YZ7A 3VGUA 3GIRA 4CO2A 4NI2B 3PVXA 3K5NA 5L1JA 1HBUB 4I1TA 3SQOP 1D9FA 2IVFB 4MKBA 2RQCA 3FVYA 1UVKA 3M2VB 1VHIA 2GVDA 3LF0A 5GAHI 1NLKL 3CDUA 1JJ4A 4CQ1A 4FYXB 3Q8UA 2IRYA 1I3OB 3LAKA 3FNNA 3FEXB 4QU7A 1WDDA 1IKWB 3C2PA 5EX0A 2HK2A 2POKA 1VK3A 1H3DA 3FQLA 3TO8A 2XSJB 2N4CA 4O3NA 3H98A 3GV5B 3MM7B 2KM8C 3T6BA 2EG2A 4O4RA 1PYSB 3ZC4A 4M63A 3UDCA 2FLLA 1AFIA 1KEKA 4LF6F 4RW9A 4MIWA 1O5JA 4X4VA 2YH0A 4CM0A 2IDEA 2LKZA 4IR9A 3RUBL 2CJXB 3FK4A 1CJKB 3EPIA 2YNGB 3V4IB 4NPOA 2MPUA 2VJVA 1WHYA 4B3OA 4LBPA 4YB5A 2GGPB 1S9FA 4P75A 1NH8A 2IYIA 2CWXA 4ID5A 1WC1A 3G82B 5D0EA 1J5EJ 1T11A 1QTMA 2MGZB 2E66A 1VMBA 1IJFB 1NO8A 3N01A 4C3KA 2Z0GA 4LF9J 3T6JA 4G1PA 1S9GA 1PILA 4ME7E 1U4BA 3KHHA 5JMNA 1W2IA 1CJVA 5T7LA 3PJ9A 4XDDA 2IPOB 5FLXY 1TMMA 4L6V3 2FVSA 5D4PA 1RYSA 2C2DA 3L95X 2Z8QA 3T1AA 4ECVA 4X2BA 4K4ZA 1RTHB 1X4DA 2IFXA 2K7JA 3VVUA 1JLFB 3FSXA 3RU0A 1CQNA 3BQ2A 1IQTA 1AZSA 2FHMA 2JWNA 1B28A 3NOGA 1TL3A 4CLKA 2YNFB 4HACA 2F4VF 3MCSA 2U1AA 1WNEA 4P74A 4LFAJ 2PI5A 5RUBA 1KQKA 3KWMA 4QPTA 1FNOA 3GILA 2OPRA 1H74A 1NZAA 3CDEA 5KFDA 4TLQA 1DTTA 2DR7A 4OJ1A 3BSCA 1LEOA 2UVUA 3P49B 1SUQB 3BGUA 2OD6A 2MJUA 1KQFB 3TW0A 1SH3A 2W25A 4OHWA 1N88A 2BW7A 2UV8G 2F8MA 1RWPB 5C42B 4LF8J 1IKXA 3LPEA 3KLEA 3NGKA 1RHKB 1OPIA 4IRKA 2QN6B 1EKRA 1AYEA 2HHPA 4ECYA 3A13A 4LSNB 3QJLA 3SCLE 2YY3A 4LRBA 4B9MA 4CNZA 2GHWA 2XC9A 2NXUA 2G2YA 2LCWA 1FXDA 3QIPB 4DQPA 1FESA 2LXIA 3IR7A 4ZKAA 1N48A 3HHLC 2QL7B 3QRQA 4A46A 3FEYB 3MURP 4DR3F 3HP6A 3M2RA 3FRZA 4I64A 2XMAA 1CJTA 4PCQA 1N5SA 1OHNA 2ZUGA 3GIMA 4ZDNA 4WJBA 4YB6A 4Y2CA 2NZCA 3GJRB 3DI6B 4OX9J 3PFOA 4KPCA 4K4TA 3HD2A 4XDCA 3PRVA 4KHPF 4F50A 2GHPA 2NCKL 2VBZA 4XIUA 2BJEA 4NLDA 3R1HA 2LYVA 3CE8A 1F9EB 4OZ2A 3B54A 4KE5A 4M1KA 4LRVA 5BYSA 2BE2B 2QL9B 4MYTA 4CTAB 4RU2A 1YDLA 2UVWA 2X7IA 4U96A 4I68A 2CPFA 2N4DA 2FIUA 2R8JA 1SV5A 2MJNA 4LFCF 1CULA 4N76A 4X62J 1H7XA 1QAJA 3W9JA 1CC8A 2BM1A 3KLFA 2ZITA 2ZBPA 1S1WA 2WBMA 5IC4B 3TVYA 3KK1B 1GFWB 2ASDA 1O8BA 5KOWA 4F2SA 3GIIA 3OHAA 2MZJA 2XY7A 2HVEA 3LP1A 2DHAA 3DGPA 1VBZA 1VQ6S 2YNIA 2HHXA 6AT1B 3M2UB 4ILMA 4PRFA 1FXLA 3Q0AA 4RW7A 5KFBA 2Q66A 2EFGA 4CRJA 4DI6A 1SPBP 4K4SA 2ZM6F 2ERRA 1OO0B 5THWA 4NLVA 1NPKA 3SCJE 2UVRA 4PQAA 2DNHA 2GJIA 2J0QD 5I3QA 3CC2S 1HWLA 3MEKA 4PUOA 2M88A 3EICA 3SV3A 5HMZA 1B0TA 4ECXA 1NMEB 1ZS6A 1NKEA 4JV1A 2OO4A 2E5LF 5H9EJ 3W3SA 2ZHAA 3JQJA 2RRNA 1FCAA 1UA0A 5F3TA 5LMUJ 5D4OA 3ZNUA 5HP1B 2FJBB 2ZJPQ 1L3VA 1XBWA 4DL7A 2L08A 3HLUA 4CLYA 3T5JA 2HAFA 3VQSA 2VFVA 5GMEA 5KFWA 1BD6A 1Y11A 2HPUA 2XGQA 5CZXA 1XTZA 3IR5B 3A3OB 2B6AA 5KFMA 1M0SA 4KO0A 4BBYA 4F4XA 5KT7A 1F3FA 1U1RA 1AA1B 4F0KA 4H4MA 2OMOA 1F9FA 3J7Z5 2DNPA 1T05B 4P9SA 2DHGA 3OJSA 2GS8A 1X60A 4RL1A 4DCJB 2G4BA 1FFSB 2MQPA 1W26A 3D0IE 5IT9U 4OHVA 2CAJA 5JUMA 2KYZA 5GMKa 4LVOP 1NH7A 1A6LA 1ZAWA 2DGWA 2MLXA 1TQLA 2W01A 3BDPA 3OL9A 5LSOA 3N9UC 4N41A 4CLWA 4OZ5A 2QT7A 3AB4B 5E2QA 3THVA 1B0PA 4KSEB 2W8LA 4C97A 1RT2A 3NS7B 1TL5A 1VQ8S 3C46A 2XBPA 2XY5A 1NSPA 3BM7A 4WFZA 4DR1J 3ZTOA 3TA1A 1YSJA 2CIMA 1N32J 4IOBA 3H2VE 4JBCA 4LF4J 1J2VA 1VQ9S 2ZH8A 3LWLA 2HLTA 2FY1A 2CNLB 1JLQB 2OEMA 4FS2A 4UOFA 4AYBD 1X4CA 3M30A 3I0SB 3BO4A 5LJ5Y 1HQEB 4UY85 2MB0B 3M8QB 2QIFA 3TZYA 4ECUA 5L1IA 5F8JA 3ULHA 3BSAA 3HSDA 1HR0J 5G0RB 5ETKA 5KTQA 2MHEA 4LFBJ 2R7XA 1Q7YT 1HLWA 2OELA 3OVBA 4QIEA 1O0PA 3M9MB 4YR3A 2ZJRQ 1NSKL 3E01A 3F0NA 1ZA2B 2VG5B 1RE1B 2DHXA 2NZ4A 2LP4A 2C3MA 4L73A 4BHQA 5FJ4A 2C3OA 3KHRA 2RDIA 4DLEA 3HULA 1Y3JA 3CNQP 4DU7A 5B0BA 1RWVB 4UQTA 2VFRA 5E3QA 2M4MA 4B9NA 2MQOA 3GLJA 1WKJA 1YKWA 2J9EA 4M5GA 1M90T 4D8JA 4P7TA 2VPZB 3WC2A 2HRYA 1R7IA 1FE4A 4QBUA 5IOLA 5E33A 2O1PA 2QX0A 3M8PB 3GJTB 2DGVA 4WBFA 3QJPA 3NMAA 1NJXA 1VRTA 4GVLA 4ECTA 1U24A 3W7BA 2M5YA 2YBVA 4KFBB 4Q8EA 9RUBA 5DQHA 1WG5A 1HYSB 3S6EA 1FD2A 2A2DA 1N33F 4LR7A 4X4NA 2FHOB 2CJAA 1YBUA 4ZITA 4ZVTB 1S59A 5HI7A 2LQ8A 5B0GA 3B4DA 2ZBCA 3ZZOA 2VPXB 4P2FA 4C48A 2O5DA 3OFHA 2X1AA 2ZE2A 2B8QA 4O3QA 1MROA 1GAOA 1XMQF 2VKZG 1KVKA 3GR1A 2XM3A 1UEKA 2WB4A 1JIHA 4XTTA 2MEWA 2WTFA 4DZ6A 2MKHA 4I67A 2Z4PA 3HZGA 4E0DA 1NK7A 3KK2A 4ZP9A 3CMES 3IRXA 3TZWA 1WOSA 2K29A 2D41A 1T9TA 3WDOA 2CPYA 1I94J 2HNDA 2NXEA 2KFNA 4GO5X 6FD1A 1RHUB 1RU1A 2EKNA 2I1RA 4YR2A 4QIFA 3EZ5A 2HGLA 3DRPA 4WXWA 4X4QA 3KMQA 4RNNA 5I4MA 4P10A 4YQWA 2J9DA 2C3YA 1FVQA 5M2UA 4Y34A 1U1QA 3SFGA 1S12A 4CLSA 4K8RA 1CJUB 2CG8A 2IY5B 3PEHA 2BJ8A 4Q2LA 5IM0A 1IKYB 4DX6A 4DQSA 3GSDA 1U0HA 1GH8A 4F4WA 3Q83A 5GAGI 4WFYA 3LGNA 2RS2A 5D3GB 1LKZA 1SJ3P 2WSEC 1ZYQA 4IRDA 5GMDA 2CQ3A 2Z57B 4LT6A 2ZC4A 5A6PA 4U9RA 1JXVA 2XO7A 3VAJA 2DY9A 3IS9A 1FF2A 2CQGA 1E6VA 1WD6A 5KG0A 1YG0A 5IT9Y 2GO8A 4NLSA 2D1CA 4GRSA 3KLVA 5ITHA 1S10A 1E6YA 5CXTA 2OTLS 4LF9F 3ADAC 2IVMA 2WSFC 5IT0A 1QSLA 4MT1A 2HLUA 1WORA 4X4UA 2HGMA 1HBNB 3BKFA 1N6QB 1MWZA 3CCJS 3K17A 1RKIA 1UCNA 1V5VA 5SZTA 2BQRA 2CJ9A 3TA0A 3UPFA 2AMCB 3N0VA 3ZZPA 1V6HA 1XWLA 4DUZF 3ET6A 5J2QA 2VG7B 4IOCQ 5DLGA 1SIZA 4HH1A 4ZVPB 1VRUA 2QG9B 1VC6A 5CQGA 5ETQA 3FSYA 4ES3A 4KYZA 4PYAA 3OTCA 2E5GA 4I2QB 4CYUA 4ZOSA 2W4PA 2BDPA 3OR1A 5BYQA 4KHRA 1S1VB 1JMTA 2OD4A 1U47A 1WKKA 4AAIA 2HBZB 3BBFA 3KG4A 2V2ZA 1PAEX 1S1TA 3RBEA 4KGZB 4PQUB 2XY6A 1RT4A 1BQMB 4N8OA 1D0EA 3BYRA 1RWXB 1TV6B 2OIHA 1IN0A 2DTJA 3KG0A 4FVMA 1NB7A 4YMEA 3FCVA 4TY9A 3OR2A 1BGXT 2ZDPA 2BR0A 1R6VA 1RZMA 1U2CA 2LQ5A 3LW5C 4NASA 1RXOB 2Y0BB 1IBMF 2A0FB 2DR8A 3EVWA 1TU0B 1OQ6A 3HXMA 4WYWA 3MEDA 1VI7A 4P7VA 1RTIA 2Y1RI 1VHFA 1YRTA 4NZ6A 3GE9A 5B0DA 2DNRA 3H5YA 3DM2B 4C4WA 4K5RA 1T03B 1U48A 3OL7A 5KFZA 4NI2A 3HKWA 1HBUA 4MIBA 5IWAF 1S1XB 3JQKA 3C19A 1FVSA 4OX6A 1HHQA 2O67A 2YNHB 1JLAB 2JOQA 1EIYB 4DR2F 4UOCA 2IA0A 3ZZYA 2JX2A 2HHQA 2Q79A 4J9OA 3RTVA 5G4DA 2XWXA 3JXOA 4EGLA 3THTA 3GYGA 4TU7A 5A76A 2XO6A 2M0GB 1IKWA 2Y9HA 4LF5J 4X84A 3TZXA 2XSJA 1BDTA 4OX9F 4I0WA 3MM7A 2BJ7A 2XMMA 3W64A 3IBCB 1X0FA 1KS2A 2LA4A 4PAAA 3LP0B 2G9OA 1F5CA 4JV5F 3ENAA 4B3RF 1XNQJ 4DXLA 4LQ9A 1KOHA 3MF5A 2XG8A 3I31A 2WW4A 4KTQA 2CWKA 4OI1A 4LRFA 2I2YA 2YNGA 2J6UA 3AOAA 5CA5A 3IXQA 2KVQE 2HS0A 2H1OE 3CCLS 3CCTA 1R8BA 4EEYA 4X62F 1TKDA 2FB0A 2GGPA 3QGIA 2RD5C 2HFOA 2JXHA 1HW9A 2GV1A 1SKSA 3CTRA 1XIQA 3KJVB 3BSOA 2MGZA 4JV0A 3CW2C 2VV5A 3F56A 2J0XA 2H54B 4I7FA 2E44A 4CT9A 3EX7B 2XNRA 3IA0A 1HIYA 1NU4A 2CQ1A 3CUNA 2PEHA 2V5HG 4NMLA 3MR3A 2F1FA 5GVQA 3LALA 3OFGA 3QFHA 5KFOA 4K0KJ 1W25A 1UPPA 2AP6A 2NLWA 5IS2A 2J8AA 1URRA 5K8NA 1RTHA 4DX8H 4LSLA 4TKTA 4KHMA 1JLFA 5D6GA 3H87C 2XI2A 4PG8A 3GR0A 2OPPB 5DG8A 1BMQB 4RLEA 3FBBA 3CCSS 3O6QA 3H2LA 3OSPA 2GIFA 2PE8A 4KRWA 2DGOA 2G1DA 1ACMB 2PDAA 3JSRA 5T14A 5KG6A 5LMUF 4ZPAA 3FRYA 3TQ1A 2XYHB 4U67Q 3DDIA 5DO2A 5B7WA 1DTQB 1IJEB 2RSQA 4Z7CA 1RLDA 1SUQA 2COLA 5KFPA 4CO3A 4W98A 5I42B 2BJDA 1FJCA 4HV0A 5FDLB 3PM9A 3DRYA 3GZ7A 4ZVSB 3EMTA 2ZD1B 5C42A 1L3SA 5KT4A 4RUBA 3CCQS 5BYRA 1HNIB 5ETTA 1T0TV 1CSJA 2LQBA 3DRSB 5E7OB 2XMTA 3NGUA 3EGZA 2EC2A 2OEJA 2BXJA 4IH5A 4DPYA 5KG3A 2GA7A 2G0JA 5L9XA 5D15A 2IRUA 3AY0A 1T9XA 3QIPA 2B9EA 3BO3A 1BQXA 1RWNB 1B4SA 2HFZA 2F9JA 3DOKB 2KI2A 1FRLA 2QA2A 2A3JA 5D0GA 4HTIA 2DJWA 2C22A 1OY8A 4KGVB 2JFKA 4DR1F 5CCMA 2CQHA 1ARQA 2QV6A 4ED6A 1U45A 1N32F 3BPSP 3W8GA 4LF4F 3C6TA 3DI6A 4NXNJ 4NLXA 3MUTP 1UJ5A 1EQMA 3M1VB 3VV2B 1SQEA 2K3KA 3BH6B 1KBRA 3NWGA 4WF9Q 3T5LA 2GHVC 1KFSA 4JI6J 3KK3B 5K8PA 4ZPBA 5DJBA 3T1YJ 4K5SA 3NLCA 2BE2A 4WFAQ 4CTAA 1VS3A 2Q3PA 2OPSB 3Q8QB 3TEHB 4ZCLA 4LFBF 3O8WA 2K8GA 2KZMA 2QC3A 5DM7Q 2KT2A 2FC9A 2V63A 1D9AA 1KLNA 1FK9A 1Z2LA 1X4BA 3PY8A 1F2GA 2OUGA 1SC1B 3KK1A 1NCLA 2CYYA 1XMOF 3JB9k 2AD9A 3KLGB 2V34A 2A18A 1TKXB 3GCWP 3DLKB 3B4MA 4QR1A 2ROGA 1K9MT 2RKIB 2NQPA 3BREA 2FPHX 3BGRB 3TOQA 3O1LA 3M2UA 4DCPB 3K7RA 4OQJA 2V6AA 3MEEB 3QT7A 1PCAA 2KT5A 1LQ9A 3BH7B 1AXQA 2SXLA 5AJ3J 3R5CA 3CJ0A 4PWDB 1TKTA 5GADU 1T9YA 4B3MJ 3DU6A 4ZPDA 2QRRA 3ENWA 4QOTA 1OYEA 1MNTA 1UZHA 5DETA 4ZPCA 2BE7D 5D77A 4M5NA 2QLJB 4HHHA 1IR1A 5KT2A 4ZVEA 5HP1A 4C3MA 4F4AA 4B9TA 3JAMU 4CP5A 2VOPA 4FYVB 4HKQA 2HSEB 4DDFA 3TUIC 3HHDA 3IBFB 3OLAA 3G8SA 2E7XA 3K5MA 2DGSA 1KVIA 1FFGB 4ZJOA 1T3NA 4X66F 3J7A1 3CB4A 2V4RA 2E9TA 1DRZA 4R8UB 1SL1A 5D0RA 4F4ZA 3RR7A 5E3AA 2KG1A 2AKWB 2DEIA 2PA3A 2HNYB 4JI8J 1L3UA 2RDJA 4X4TA 1L3KA 3DRRB 3HF5A 5KFSA 3PX4A 2C2KB 2ILYA 3CO0P 2LQJA 3NCQA 1QUPA 1X4AA 4NA2A 3MMCB 1ARRA 4YFUA 4C0HA 3DLLQ 4NL5A 2YQ1A 1UWBB 2N3LA 4Y2MA 1Q5VA 3S8SA 4Q43A 1QAIA 2BKNA 4USTA 3Q23A 4OI0A 2C28A 1FWLA 1F9HA 2HS4A 2GQ2A 1QTNB 1Q8KA 3TARA 2RE1A 3NO7A 3ZTPA 4M5DB 3MR6A 3T1HF 1S7IA 2DBBA 3R97A 1IVZA 3DXBA 1OPZA 5FIIA 5EUHA 1UP1A 2GW8A 2ZHBA 4QPXA 4OZLA 1ROFA 3EDRB 4NCGA 4WFNQ 4DPWA 1JLQA 1EP4A 3EVOA 1VFJA 2ZUAA 3MM9B 2J5AA 2QO3A 3I0SA 4HI2A 4BC9A 2HAIA 2UUAJ 4AQYJ 1HQEA 3M8QA 1QJHA 2XMJA 2JEGA 1JXLA 1N5QA 2VQEJ 1GQEA 2FZGB 2CFXA 2V8VA 4OHZA 4EYHB 4LF7F 4IG3B 3EZUA 3T3FA 1M1GA 2D3OR 2ZZMA 3QAEA 1P1TA 2Z2ZA 4TYAA 2DR5A 3EZOA 5HVGA 1K1QA 2VG5A 3M4XA 2DVIA 2RRBA 4BCAA 3A8IA 4C0OC 2R7SA 2Y8YA 5HQLA 4JI7F 2BKPA 3KUGA 2V9KA 5BR8F 3MR5A 2ZHOA 1S4EA 2X1FA 4WP3A 1FKPB 3V6KA 3B78A 1VQ4S 3BJYA 3UR3C 4DV2J 2JLFA 4H54A 1ZM3A 4LF2A 3M6XA 3BN4A 2JFDA 1RCOB 1JWWA 3M8YA 4JI3F 4P73A 2ZOGA 3M8PA 4C98A 4ANDA 2B7CB 4ZCMA 4MK7A 3D4JA 1K0TA 1FJGJ 1R3NA 2XLJA 4K7QA 2EW9A 4ZP7A 2PMZD 4KFBA 2YPYA 3G87A 4I2PB 2ZZNA 2AEFA 4ENOA 3HPOA 3GCXP 1DQ8A 3G6VA 2QL5B 2UUCF 1TZ0A 2UUTA 5HMWA 2JNJA 2PEBA 5K5MA 3P5TL 3H5UA 4H4KA 2DCLA 2A2CA 1TVRB 1TL4A 2DPIA 3MAAB 1QAYA 1RAIB 4QWEA 2R7UA 4FBUA 3O3LA 1YVFA 2IAJB 1JNRB 1U7LA 1I6JA 1JXEA 4USUA 3PIPQ 2PMWA 3FCWA 3DLGB 4F3QA 5A6WA 1FDAA 2IM2A 1S5ZA 2HZAA 2K6LA 4C3LA 3AD9C 1RAHB 2O66A 4OZ0A 3CO9A 2Z2MA 5T41A 2ZH2A 1RQ0A 4KC5A 3NXZA 5H9FJ 2J0SD 4K4XA 1SJ1A 2LFVA 3OT9A 2W7PA 4OFZA 3UFCX 3JAMY 2K06A 3FCHA 1QSSA 3J81U 4FYWB 1F60B 2HBYB 1B7FA 4OJHA 2GX8A 3CGIA 1T02A 1HBMB 2W2MP 2YTCA 1VQSA 1VGYA 2FGCA 1IWGA 1CJUA 4ES2A 1HI1A 4NYPA 3GIJA 2GIRA 4HR2A 3TVZA 1UPMB 2AX0A 2VC0A 4CLPA 1S6PB 3EVMA 2I5JB 1U25A 4K50A 3TJAA 2RIJA 4J9LA 5D3GA 4USKA 1KTQA 2UUBF 2MQ8A 3UNGC 4NYZA 2HVHA 4OV6A 2ROEA 4HHUA 1YHQS 2IM3A 2GZOA 4U8YA 5LT5A 1WHVA 4DR4J 4NYOA 2KELA 3HM9A 5KFCA 3UD3P 1JX4A 1EQ0A 1XJWB 5E3CA 1QTGA 1PJ7A 2B51A 1EARA 4TYBA 1ZM4A 2G0IA 1ITPA 3CD6S 4A8WA 2E5IA 3N6LA 1N56A 2CKWA 4NCBA 4F3MA 1RCXB 5CCLA 1UEVA 3W1YC 3KFWX 1MYKA 3OXFA 4KB7A 1N6QA 1PIEA 1XN9A 2CXEA 1N4LA 4Y2KA 4RKUC 4DZDA 4K0KF 5JXSA 1S6QA 1LWCB 4ZVHA 5A0YB 1MSWD 4R0EA 1NK0A 1VQMS 1Z4UA 5B08A 2RHSB 1R0CB 2IMWP 1XMBA 1KNZA 3TAMB 3V4MA 1SKUB 2VG7A 3EM1A 4PXEA 5I3PA 3QZ8A 3TNVA 5K9FA 3I5BA 1BHNA 3MM6B 3U7JA 4DBQA 5ETNA 3K0JA 3QAUA 2EFQA 4I2QA 5L38A 5LMNF 2ZH3A 1TK8A 3QSYB 3RRGA 4MMOA 1S1VA 2V8PA 4FF2A 3PV8A 3HX9A 2DXFA 3ONQA 4Z2XA 1EKSA 3TX0A 4F67A 1YIJS 2XYGB 1SL0A 1KTVA 1OS5A 1DY3A 2V4JB 4PQUA 4MKVA 1BQMA 1FJEB 3C66A 3EXCX 4MJWA 2JXIA 3DGVA 5DS7A 2VODA 2H4YB 3MECB 1TV6A 1NSQA 3OUYA 3J7YU 2RQ4A 1S72S 1KHVA 2DRBA 1VISA 4L75A 3F44A 3QLHB 4OI2A 2GC8A 4DV1J 1RT3B 4J7CA 2UZAA 4J90A 4UUWA 2XNQA 2LDYA 7AT1B 1GT8A 1YJUA 3TUJC 4KHPJ 1P8GA 1OQ3A 1ZZFA 3DM2A 1WC5A 2ALYB 1MW7A 1T03A 1RJJA 3LWMA 1SIWB 1Q8IA 3PJWA 1UVMA 2ALZA 1WJ9A 1A9NB 1S1XA 5KFEA 1ZPWX 3FFIA 3UWTA 3KLIB 2YNHA 2PO4A 1JLAA 1T3OA 4DSFA 3JYTB 2AN7A 4LFCJ 4ZK7M 4OZNA 5IQ6A 2M2BA 3OXGA 2FTRA 2CAXA 3MD3A 1TAUA 1LXJA 2XMKA 2P8IA 4Q0BB 3HT0A 1PJ6A 2ZBIA 2HRUA 3CMQA 3PKYA 3LQVA 1VCTA 5LSRA 1T8EA 4CM2A 2Q1LA 1AT1B 4NLOA 4FXDA 4ELUA 4DV7F 2M70A 3D6FB 2WVFA 4C2MA 1WTBA 3RB0A 4RX6A 1NEEA 1YBAA 3A12A 2XMWA 3GFYA 2C3UA 2HMIB 4DLGA 3T1YF 4IFYB 5EHHA 2KRRA 2ZM6J 2CA9A 2PA8D 3R5DA 5BJRA 5DDPC 4GKJF 4I6YA 3A8EA 5DQGA 3L09A 3LJPA 3QFWA 3PO5A 1U2FA 1QDUB 2JDJA 1QUVA 2WCXA 3NGRA 2AYMA 4USWA 2XZDB 3POTB 4RNHA 1VBKA 3KJVA 2E5LJ 3KJFB 5LM7E 5KFKA 3ZZUA 3IG1B 2EK1A 3J81Y 1TAQA 1H98A 1F2HA 1ZPVA 2C2ZB 3THPA 4RW4A 4WIQA 1TUVA 2KHDA 3HI9A 3G6YA 5LJ3Y 3ILJA 3OTBA 3NY0A 2O3DA 3VTIA 1KWMA 2B56A 3HSZA 4ER8A 2AYBA 1XQIA 1M5HA 2OFHX 5IXUA 4B3MF 4A8QA 2DCUB 3QMQA 1K47A 4ZHRB 2MZRA 3CSKA 5F8HA 2OPPA 5F9LA 4IOAQ 1NLAA 2WB1D 3KG1A 3N28A 1WI6A 2LMIA 1G7CB 4DV6J 5DQIA 1Y10A 4QYZK 2Q6CA 2D9PA 1N0UA 2EFVA 2XWYA 2R3VA 4ALZA 4DN9A 2HVZA 3Q86A 2PSZA 3HHNB 1MMDA 1WEZA 4DL5A 2KJVA 2GQCA 1DTQA 4LMZA 5HMXA 2ZEJA 5U47A 3H2UB 2EBGA 1CEZA 2VG6B 2GAHC 5I42A 1OSCA 3VCDA 2AEMA 1FX2A 4C7QA 5FDLA 3CCVS 2CNOB 4Y00A 5F8MA 2DO0A 2ZD1A 4FPIA 4FPRA 4DR6F 4WYLA 3H42A 1F5AA 2WONB 1HNIA 1YRXA 4I6WA 3D7SB 3A8KA 3N6MA 1UA1A 3PXGa 2QSFA 3CD5A 2XTJP 3DRSA 2YX1A 5CYQB 1N36F 3Q8PB 4ETXA 3CJ5A 3TUPA 3NAHA 2NR0A 3I32A 4I4BA 2ZJQQ 2B43A 4YP3A 3DOLB 2AQ4A 4URSA 4DF4A 2GQQA 4F7VA 4FXEA 2F3JA 2VPYB 2VQFF 2MQNA 4ED7A 3NNCA 2RNEA 5C25B 3OVAA 2MSTA 2ZFHA 3DOKA 4KV8B 1SQFA 1M5PC 4KY3A 4O23A 2AW0A 1WTFA 2JZ5A 2VHGA 2AT1B 4DUYF 3GFZA 1JLEB 1SXLA 1CLFA 3AJ1A 1IM4A 4DU8A 3FEZA 1H2TZ 1LWEB 4GMKA 3T9NA 4HLBA 3QT6A 3BS9A 2G13A 3HD1A 3QWPA 1FD8A 5HATA 4A8YA 4JI5F 1WELA 3VGVA 3SBMA 1SVDA 2OKQA 1PC5A 1FRKA 2FZCB 2B5JB 1SB6A 5KAKA 3W60A 5KFVA 1YBTA 4FNHA 4CI0B 3KK3A 2VU5A 3EPGA 4O3OA 1SJRA 2OPSA 4CNYA 2BJ3A 1AW0A 1RWKB 3QATA 2BMBA 3ITHB 1YJTA 5MLCV 1NK6A 3AA8A 2MKYA 4MFBB 2V2KA 1NKBA 1TR0A 2H5JB 4FP9A 2CJYB 2BNWA 2WVEA 4LBHA 3T9ZA 1CVJA 3KJNB 4JI4F 1Y3KA 5KFRA 1XK8A 2HHWA 2X1GA 3D9BA 3TR5A 1R8AA 3KLGA 1N33J 3I4PA 1TKXA 1YRUA 2NXCA 3DDKA 2RKIA 3AAWB 1Y4ZB 2UUWA 3BGRA 3QOQA 2P6TA 2DNKA 3D68A 1LW2B 1WEXA 1QLNA 4YHHJ 1D9DA 3MEEA 1B0VA 5LXRA 4L3NA 2OPQB 5B0AA 3LH2S 3HHKA 3KUHA 2JC1A 3ZXWA 2RS8A 2A6OA 3SIPB 1S77D 1URNA 2YKMB 2AZ3A 3I87A 3IWNC 2FJEB 4DL4A 4G1IA 1HW8A 4WFBQ 2ZWPA 1FJGF 1OG7A 3PX6A 1P1LA 2BRKA 4TU9A 2VZ9A 3HFZB 3CPWR 2YWHA 1NHUA 8AT1B 3MMAB 3CF5Q 2ZOMA 4EU0A 4ECSA 2CDRB 3A1YG 2W7AA 4B3OB 4DS4A 1UVJA 1HHSA 1DBDA 3JQMA 3EUNA 4DF8A 1FT8A 2V4QA 4AD6A 1U6ZA 4F2RA 4R8UA 3PEJA 1PGZA 4K2JA 4L72B 2ADLA 5C24B 2C42A 4RW6A 3DHWC 2HNYA 1EB0A 4YDDB 4CIOA 3US5A 3DMJA 2UV8A 4YS2A 3DRRA 4EFAC 2ATCB 4XK8C 2CJKA 4DPUA 2PIIA 2R42A 1UMJA 1C0TB 1R31A 4WK3A 3PHTA 2CJBA 2KL8A 4EYIB 3Q8VA 3V6DB 2CPDA 3EYZA 3UN3A 3MUVP 2R2TA 1LK5A 3TAQA 2YQ3A 2AJQA 4WE1B 1I5OB 4FF3A 3G4SS 4CT8A 2GJFA 1H73A 4M5DA 2ZNYA 1IM6A 3T5KA 3NOCA 1GMWA 2IYGA 3A8JA 4MJKA 2GMHA 1UAWA 2MZQA 1JLGB 4DSEA 2V0NA 2VDIA 1LWXA 4CO0A 4B9SA 2OPRB 3UCZP 5KT5A 2MQQA 3M8ZA 4DUZJ 3NGDA 2HS3A 3VAGA 3NGSA 3LPYA 1L5UA 1LV5A 4GKKJ 3D6MB 1S76D 4DR4F 1EHWA 1NNDA 2VKRA 5CYJA 4DX7A 5HAOA 3CMAS 6FDRA 1CPZA 1UZDA 2W2PP 2QMXA 4IG3A 2D7SA 3SQGB 3UCUP 4RBTA 4LR9A 2HQDA 5ETLA 4A4JA 2KT3A 3AFGA 4LIWA 3MEGB 1HWJA 2V9WA 5CZVA 2C2EA 5HLFB 1Q1KA 2XZWA 4R5PB 3D1OA 5HK4A 3PW7A 3AQOA 3P5BP 1U1PA 2RF2B 3CEDA 4M5JA 1L3TA 3J7ZT 1PBUA 2R9LA 4WU2A 1DURA 3QSIA 4ZP8A 1FDNA 1YX2A 3MAHA 1X4FA 3A4TA 2DPJA 3IAS9 1FKPA 3PKMA 4MTPA 4FZVA 3G2XA 1AFJA 3K5PA 3CDBA 3R5GA 4RUCA 1PAUB 3RAMA 1IBMJ 2BV3A 4U7UK 1CJTB 2KU7A 2ASLA 3CULA 1RTJB 3C15B 4JP8A 3HK2A 1WG1A 4QJVA 4TQSA 1NXIA 2F9DA 1RI7A 2DK2A 2WK4A 2RU3A 4CLLA 1ZH5A 1DJ0A 1RTDB 4M8LA 5IWAJ 3IM9A 2IJRA 2EWHA 5DGAA 2CQDA 2P6SA 2RQKA 3CCWA 4DR2J 1JLCB 4I2PA 3G9CA 1WF2A 3G8QA 2MLZA 1NUEA 2XI3A 2G2ZA 2GMLA 1PYOB 2Z2YB 3NP5A 4HHJA 3SXLA 3HSGA 4DV1F 1TVRA 4X65F 3Q89A 1CULB 4UW2A 3MAAA 3RG6A 2HHHJ 4QCLA 3PRDA 3CIZA 5F0WA 1MN7A 2E5JA 4FYYB 1S1WB 2IAJA 2WVCA 4UY8T 4IR1A 3RBXA 4O44B 4KGKA 4P6QA 3DLGA 3FZ2A 4JV5J 4DS5A 2HBRB 3M6VA 4B3RJ 4FNIA 1LW0B 2B7BB 2HIYA 1R89A 1S57A 2HGNA 2JVRA 5J1EA 4E2FB 5F9NA 2RH3A 2K9IA 5J1PA 2E1CA 1J5OB 1N0VC 3NKYA 4N8NA 1U2RA 2QFJA 2IJFA 2FHJA 3UVJB 4DMZA 2XS2A 1NDKA 4WXOA 3SMZA 2R7QA 3GQCA 2I9SA 2AJ4A 1HI0P 2Y3YA 3CXCR 1PBAA 5ETMA 1HBMA 4J9QA 3U27A 3E8OA 2N82B 4U7UD 1MYLA 2H9ZA 2XHWA 1MMLA 2JRSA 3K5OA 2FZKB 4PABA 1M5KC 1FI4A 4USHA 2I5JA 2IMOA 1RSCA 4ERDA 3K58A 4DFPA 3DYAB 4UOHA 3PTWA 4WZQA 2VF3A 3CJRA 2YQ0A 4LREA 2W2NP 3KLHB 3BKTA 2HWHA 2RILA 3OD2A 1UETA 3JTNA 4HT7A 1IR2A 2IC3B 3ZTRA 4NLGA 3D0GE 1NKCA 2ILZA 3L7OA 3NRBA 4WKRA 2JC0A 2J8SA 2HNZB 1B64A 4OHYA 3L3CA 1JK9B 3L7PA 2DY1A 3CJ2A 2YX7A 2B9WA 3LTOA 3G71S 1IUJA 3MPUB 1LWCA 2X3DA 1RB0A 4RR5A 1RAJA 5A0YA 4RWXA 1MMNA 2R7TA 3BO2A 2UVVA 1FA0A 2FUG9 2Z56B 1VC5A 2BRLA 3FMWA 2EFOA 2V8HA 1VJWA 3TAMA 3DLBA 5A8KB 4EWTA 5A8RB 1NK5A 4AL6A 2MZ1A 5JVGQ 2CZ9A 4USJC 3M32B 3TZZA 1X4GA 3D6TB 3LO3A 4OYXA 4ETZA 5HROA 1X9WA 3EXYA 2Q43A 4EI2A 4P71A 3UNYA 4USIA 2J7UA 1F6TA 3MM6A 4X4SA 3BN7A 1NDCA 1VQKS 4DV6F 5IV3A 4LF1A 1S0VA 3IWLA 4JYAJ 3ZTQA 4JI1J 4DSLA 1U26A 4U6PA 2J6SA 3VGSA 2NSCA 2DH9A 2K7KA 4NX9A 3M05A 1MWQA 2BSQE 2MKIA 3VR1A 2V4JA 3GSIA 5C2CA 5C2GA 4ECQA 1TELA 4CH7A 3MECA 2V94A 2G1HA 3TYTA 1FEEA 4K4YA 4EZ6A 3MMJA 2CZVC 1YK9A 2XMUA 4DHVA 3WX8A 4IFVB 3OPKA 3QLHA 1RT3A 1ZTTA 3KXDA 2C1EB 3SSRA 2Z58B 3PYDA 4NA3A 1XNRF 4OMFG 3PW4A 2H3EB 4ZPWR 4J9PA 3TJ8A 2DR9A 1U1LA 3MUMP 3K57A 1EAYC 2JJ4D 5GAGU 4MK9A 1N54B 4NLWA 3Q8SB 5E3PA 2DHHA 1SIWA 1X9SA 4QIWD 3TP2A 3RAXA 3MR7A 5A8WB 3OQ2A 3VZIA 4OX7A 2N7CA 2K2PA 3KLIA 2KHCA 2ADBA 2NXJA 3R6LB 2B9YA 1S9EB 3JYTA 4B9VA 4ED4A 5KFAA 4TQRA 2BW2A 2B3TB 5HBMB 3DLHA 4HYKA 4TN2A 4PG7A 5LL6d 4IO1A 4F36A 4JV2A 1Q53A 4HEA9 4Q0BA 1UL3A 1NK8A 2ABYA 3GONA 1XMOJ 1M5OC 4NCAA 1UJ4A 3GYXB 2D3O1 2ZH6A 1HFEL 1O51A 3UDLA 4CH1A 1VRTB 1LFPA 2HRTA 4U8VA 2WBRA 1I51B 1LK7A 1NB2A 2E5HA 2HYIB 4J9NA 2MKCA 4PG5A 2BYCA 1EZZB 3BEGB 3WQPA 2HMIA 4Y28C 1D8ZA 3TA2A 2CQBA 1S0MA 2BVZA 3J7AN 3QQCD 4N47A 1FKOB 1AROP 5M2PA 2BZ2A 1W2BR 1PC4A 3QT8A 1S99A 2LLZA 3POTA 2VBXA 3PYFA 3VWSA 2QEXS 4OYZA 3W2WB 5CABA 2HKEA 4KAIA 5B0FA 3QRPA 2IJNA 3IG1A 3W9HA 3TUZC 3I0RB 4B3TF 2C2RA 3KNAA 3IFEA 4YHHF 2DNZA 2FJAB 4RNMA 1FHTA 2JLGA 4X66J 1T7PA 1NM2A 3GV7B 5L1LA 3I5AA 2KRBA 4BC7A 1HMVB 4ZHRA 2H5EA 2QLBB 5IT4A 1OY6A 1J27A 1UFKA 1RT1B 3V2UC 4USMA 1GMVA 2BACA 2YKAA 3BKUA 1P94A 2N3OA 3H20A 3LP2B 3SSSA 2M8HA 4YB7A 3AXKA 2XCPA 1HWIA 5HSPA 3RW7A 3SDEB 4MH8A 2XQCA 2FYXA 3K8WA 1GX5A 3M8SA 3D28A 2MKSA 3OL6A 4ED3A 2VG6A 2BQ3A 3EJMA 2RJZA 4DOZA 3T41A 4JUZA 4DSIA 3T1HJ 1RT6B 2CPGA 2LEPA 4DPTA 3U1MA 3RBDA 2WONA 1HNZF 3H59A 3EE3A 3HVTB 5KG1A 4GC7A 1FWKA 2AWZA 5CYQA 3C6UB 2DGUA 5AE3A 4K59A 5HJXA 3VW4A 3DLEB 1XEZA 1QSYA 3DOLA 4F0MA 3U02A 1R43A 3EDQB 4QIVA 1RWOB 4QWBA 2CQPA 3QWUA 1LWFB 4NXMJ 4QR2A 5C25A 1HQUB 4J9VA 4Q7AA 3U1LA 4KV8A 4LF7J 3M6UA 1S0OA 3HDSA 4ZVGA 1B3TA 2HIQA 4FKYA 2L48A 1YI2S 2UP1A 4G6VB 1JLEA 1K44A 1RT7B 3TWZA 3VQTA 4HTJA 4ILRA 3UCGA 1NJIT 2VOOA 4BLGA 1VLOA 1LWEA 1REVB 1T94A 4NRUA 2BOAA 4OYMA 2JVOA 2CVEA 1GMWD 4JI7J 2YX4A 5BR8J 3OTOF 4J9KA 2B5JA 2NYIA 4GKKF 1WC3A 2DKOB 4YY3F 1TP7A 3UI3A 4K4UA 1WOPA 2H51B 4N7TA 3MR2A 1YJWS 2RVJA 1OMSA 3LGMA 4K4VA 4G1QA 4IO9Q 4YB1P 4JI3J 1RAGB 1Z2ZA 3ITHA 3CJKB 3TVKA 5HQ8A 2ZH1A 1RLCL 5DDRC 1VQOS 4TVAB 2Y1LB 5IZHA 2EKYA 3ZZ0A 2PFFB 3T19A 3CC4S 1FERA 2XLKA 3Q2SC 2KH9A 1MU2A 3UDEA 4TU8A 1QAXA 2AF6A 2UUCJ 3CJ4A 3N5BA 1N5YB 4LR8A 5H9EK 1LW2A 3BGFA 3QPIA 4C11A 4DL3A 4AFFA 2W9CB 2OPQA 1HD1A 2HG4A 4OYIA 4TY8B 1N34F 3SI8A 4O4GB 3L9ZA 5K20B 2YKMA 4DV5F 2BABA 3A3NB 1UW9A 1SH2A 4E8UA 1KR4A 2FLNA 3R6GB 2WRMA 3SCIE 2BM0A 1JJCB 4W92B 3M2VA 4ZLNA 5F3ZA 2EK6A 1VRQC 3TQEA 1U9PA 2IDLA 1P27B 2FY8A 3TEGA 3MMAA 2ZH5A 5CHCB 3HJFA 3RRKA 4IYQA 2C2MB 1WF0A 2HHHF 2FVCA 2JL9A 3HFVA 4EBEA 4OJGA 5GAEI 3IBWA 4Z37A 5KT3A 2HHTA 2WOMB 3ISZA 2BANB 3FBEA 5EGYA 2ZNZA 3QBCA 5I3UB 4WIIA 4YEAA 5F8NA 2YWFA 3QO9B 5C24A 1X5OA 3NNEA 3EWGA 1VYAA 2YWWA 2AV5A 4I7FB 1OY9A 3PHEA 3CC7S 1T9WA 3ZTSA 2NSBA 2C2OB 1CJKA 4OLOA 2UUBJ 3V4IA 3TANA 2EBEA 3PW0A 3ZFVA 3FZBA 1Q8LA 3ETMA 1FXRA 1C0TA 3I9ZA 2R7VA 4ZVUB 4W4MA 2W4CA 5CYMB 4HI1A 2V2VA 4A8SA 3G82A 1RABB 3OJUA 4LSLB 3V6DA 3K8VA 2NXNA 2OHDA 3NGTA 1OWXA 3MOZA 3AHPA 4WE1A 2FHJD 2AGQA 4ED2A 3HSJA 1U8WA 2R2UA 3FSIA 4K4WA 4DSJA 2V8DA 3I82A 3SYZA 1WDTA 1RAFB 1TFWA 4DL2A 1LNQA 1VK8A 1JLGA 4YOEA 3E2EA 2B4VA 2OTJS 2DH7A 3MZIA 2FJXA 2R2SA 1YJVA 2LDIA 1VIXA 1U02A 2XS5A 4JI2J 3TX8A 4J9RA 2YNFA 3BZQA 2CZ4A 4IDKB 3L4BC 2VONA 2JLEA 5LMNJ 4OI6A 2W8KA 3SQGA 3T5HA 4PXBA 2HZVA 4QU6A 1ZOTA 2E1RA 2KM8B 3GPAA 3MEGA 1BQNB 3ISND 5HLFA 3TJ9A 4R5PA 4IQMA 3QGHA 4C8KA 1KSPA 4DL6A 2QLWA 2RF2A 1VBXA 1VOMA 1REGX 2KOEA 5F8GA 5CD4H 2O01C 1PO6A 4KH0B 1TL7B 5LOQA 1JKHB 4C9DA 4RO0A 5EX3A 1HNWF 2CRLA 3SEOA 1ZZNA 4OX8A 3LGHA 2OP5A 4LSZB 3DDNA 1F1BB 1C1CB 3VAIA 1FDBA 2HVIA 1LXNA 3JS9A 3G96A 4LSNA 3KMSA 1RTJA 1YZ6A 3ILLA 3C15A 3RB6A 1ZTWA 1EJ7L 2E1MC 5F41A 2UXCJ 4IKAA 1P9QC 4CLZA 4JYAF 4JI1F 1FRIA 3C6TB 4LBIA 4MKYA 2QMWA 2GJ2A 3AH6A 4E98A 1RTDA 3GFHA 2AJ0A 2OFGX 4OHXA 4CLFA 1U0SA 2XULA 2ZZTA 5E0OA 3O5TB 2HHUA 1MNEA 2XSFA 1SQGA 1JLCA 2DNGA 4FS1A 2K3IA 3R7BB 1FRXA 3GP9A 4WTOB 3DXSX 4LRDA 1ZM9A 4BS2A 1N52B 5HL7Q 4A8FA 2FVQA 2W2QP 3QJJA 3RBZA 4WWSA 4DEZA 5L39A 3PJXA 1FK9B 4V1Ak 2L41A 2ACYA 1N8RT 3M7VA 3R9LA 3HT3A 4O0NA 4DV0J 1LFWA 2DGTA 4DV7J 3NWRA 2HQGA 2JEIA 1S48A 2KFZA 4O44A 2A2BA 1S97A 2M3DA 4Y2AA 1GMUA 1LW0A 4LRCA 1IBKF 3W2VB 2FC8A 3D5MA 4PYDA 4Q45A 2QTWA 1HA1A 4UQGA 2PT0A 3RAQA 4GKJJ 4WU3A 2C3PA 1J5OA 1KLMB 3UVJA 2V50A 3R3TA 1VLYA 4N77A 2ZKUA 1XERA 1TKTB 4OYPA 4DPXA 4M95A 1HBOB 4Y2IA 3OBIA 1A0OB 2B4PA 1K0VA 1HHTP
chains in the Genus database with same CATH topology
4FXEA 2CA9A 2CADA 1MYLA 1EA4A 2WVDA 2H1OE 1NLAA 2K5JA 1IRQA 3VEAA 1U9PA 3FMTA 2BNWA 2WVEA 3BKUA 3GXQA 2JXHA 3QSIA 1P94A 2PC6A 1PARA 2WVCA 2JXGA 2WVBA 1Q5YA 2AY0A 1B01A 3FT7A 4D8JA 3LGHA 2NZCA 4ME7E 2BNZA 1ARQA 2K29A 3QOQA 2KELA 2BA3A 4HV0A 3BKTA 2HZAA 2K6LA 2BJ9A 2CAXA 3OD2A 2F1FA 2RBFA 1BDVA 1BAZA 2BSQE 2K9IA 1BDTA 1QTGA 2JXIA 2BJ1A 1X93A 2CAJA 2CPGA 3BKFA 2BJ7A 1MNTA 1MYKA 3VEBA 1ARRA 2WVFA 2Y3YA 3PHTA 2HZVA 3H87C 3VW4A 2K1OA 2BJ3A 2FGCA 1B28A 1Q5VA 2GPEA 2BJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FXE A;  2CA9 A;  2CAD A;  1MYL A;  1EA4 A;  2WVD A;  2H1O E;  1NLA A;  2K5J A;  1IRQ A;  3VEA A;  1U9P A;  3FMT A;  2BNW A;  2WVE A;  3BKU A;  3GXQ A;  2JXH A;  3QSI A;  1P94 A;  2PC6 A;  1PAR A;  2WVC A;  2JXG A;  2WVB A;  1Q5Y A;  2AY0 A;  1B01 A;  3FT7 A;  4D8J A;  3LGH A;  2NZC A;  4ME7 E;  2BNZ A;  1ARQ A;  2K29 A;  3QOQ A;  2KEL A;  2BA3 A;  4HV0 A;  3BKT A;  2HZA A;  2K6L A;  2BJ9 A;  2CAX A;  3OD2 A;  2F1F A;  2RBF A;  1BDV A;  1BAZ A;  2BSQ E;  2K9I A;  1BDT A;  1QTG A;  2JXI A;  2BJ1 A;  1X93 A;  2CAJ A;  2CPG A;  3BKF A;  2BJ7 A;  1MNT A;  1MYK A;  3VEB A;  1ARR A;  2WVF A;  2Y3Y A;  3PHT A;  2HZV A;  3H87 C;  3VW4 A;  2K1O A;  2BJ3 A;  2FGC A;  1B28 A;  1Q5V A;  2GPE A;  2BJ8 A; 
#chains in the Genus database with same CATH topology
 2NS1 B;  3SFU A;  1K1S A;  3UQS A;  3BPD A;  4CDI A;  3QT5 A;  3AOD A;  4HL9 A;  4ID8 A;  1R27 B;  2R8G A;  2FJD B;  1V3Z A;  2GFF A;  1PAR A;  4USV A;  2AZ1 A;  2CPZ A;  1RA6 A;  5F8L A;  3CCE S;  3HHE A;  3HHL B;  3DYA A;  2AJ1 A;  3VAL A;  1FEH A;  1T95 A;  4ZPV R;  1Y9O A;  4MK8 A;  3R1L A;  1Y5I B;  3KLH A;  5KFI A;  1SC3 B;  3JTO A;  3D54 A;  4MYU A;  4A8X A;  2IC3 A;  4FBT A;  3Q8Y A;  3FBF A;  4G3I A;  4ECW A;  2R8H A;  2QLX A;  4ZJQ A;  2HNZ A;  4QWD A;  3V5R A;  4F0H A;  1WUU A;  3D3B J;  3UDV A;  1SI9 A;  1D1U A;  4V19 X;  1IKV B;  4I6A A;  4PXD A;  3QZ7 A;  3MCO A;  1C0U B;  2D74 B;  5JJB A;  2J6T A;  1CC7 A;  1GXT A;  4IH6 A;  2W4D A;  3MCM A;  3IAM 9;  3RGI A;  5K8M A;  4Q2M A;  4WCE Q;  4DR6 J;  5A2Q U;  5A8K A;  2UXB J;  5A8R A;  4IQX A;  2MQM A;  3EGW B;  3M32 A;  1T05 A;  1KRP A;  4O3S A;  1N36 J;  4PPD A;  2UU9 J;  4N56 A;  4AXJ A;  2I6W A;  2BQU A;  4TXS A;  3ZZZ A;  1YLX A;  1VQY A;  3M9N B;  2VJU A;  2ASY A;  1UW4 A;  4PXC A;  2ACM A;  2FJW A;  2MMY A;  4NCG B;  2J9D E;  1Q82 T;  3CWJ A;  4AUK A;  4C8M A;  2VQF J;  1EP4 B;  3W9I A;  1IQZ A;  2J7W A;  3B82 A;  1P6T A;  8RUC A;  1WG4 A;  2NRE A;  2XYP B;  4B9U A;  4DUY J;  3H4B A;  3EGN A;  4PG4 A;  1RWU A;  5AT1 B;  4DR5 J;  4U7C A;  2QJ3 A;  3VVT A;  4UZB A;  3C3L A;  1HAR A;  1WHX A;  3MOJ B;  2HQF A;  1U1N A;  4IFV A;  3PCO B;  3KHG A;  1SH0 A;  4EBD A;  5DRK A;  4Q5V A;  2WVD A;  2FLO A;  1KON A;  2W2O P;  2YKP A;  2QFI A;  4EMD A;  3N5F A;  1QVF R;  4JI5 J;  3DHX A;  1RP5 A;  2AYE A;  2X51 A;  1GXU A;  3G8T A;  3FBC A;  3PDN A;  2KO1 A;  2EG1 A;  1NJY A;  1UEU A;  2GIQ A;  2IM0 A;  2J7K A;  4EO6 A;  1S0N A;  3NNH A;  5A8W A;  2HUR A;  3MMB B;  2VIC A;  4NXM F;  4FF4 A;  3V6J A;  5B0E A;  5G0R A;  3P8B B;  5D8H B;  2FHK A;  1S9E A;  2DGX A;  1FTR A;  2YKQ A;  3AOB A;  4H4O B;  5HBM A;  3BR9 A;  2A6M A;  4RUA A;  2MTL A;  4B9L A;  4ICL B;  3MM5 B;  2CQC A;  1QE1 B;  2QSW A;  3NS6 A;  2E1A A;  4JI4 J;  5M2R A;  2RDD A;  1YIT S;  2PI4 A;  3OLB A;  1SKW A;  2DNN A;  4UUX A;  1RBO B;  2EFN A;  1C2P A;  2FDN A;  2E7W A;  3UD4 P;  4RUH A;  2Z30 B;  1NBE B;  1ZAX A;  3DU5 A;  1JQG A;  2QMU B;  3DFE A;  5KFG A;  3R7S B;  4ZPT R;  2DT9 A;  5ETS A;  4YUD A;  1FKO A;  5DG9 A;  3NL0 A;  3NAI A;  3ISN C;  1NPP A;  1TUW A;  1FFW B;  3GYN A;  1V3S A;  3NBP B;  3AD8 C;  2P9C A;  3GFX A;  4R25 A;  2UXD J;  5KG2 A;  2BA3 A;  3MM8 B;  4OLP A;  3ZZT A;  4PPZ A;  3W2W A;  1SBR A;  1HYS A;  4NWB A;  4M5H A;  4OYB A;  4EZ9 A;  2ZDO A;  3WIU A;  3I0R A;  1ICE B;  2U2F A;  1C4C A;  2VDH A;  2VPW B;  4HDH A;  4NZ0 A;  4YDX A;  3KDN A;  4ELV A;  3SSQ A;  4EBC A;  4D3G A;  2KKE A;  1C1B B;  5HN0 A;  3I6P A;  1WSR A;  1HMV A;  2CQ2 A;  1RT1 A;  2HEK A;  1UJ6 A;  4ZVO B;  3D3C J;  4QR0 A;  5D4L A;  3N6N A;  3UN2 A;  1ZBT A;  3BB5 A;  1X4E A;  3HVW A;  1H6K X;  2RHQ B;  3LP2 A;  2WZ1 A;  3PYE A;  1BY9 A;  3KOA A;  1X5S A;  1KHW A;  3SDE A;  2FLP A;  3MPV A;  4C8N A;  5L9N A;  5KFY A;  3P3D A;  2FVR A;  2MHN A;  1KQS R;  4Q8F A;  3QID A;  2HK3 A;  1S6O A;  2H1Y A;  1RIS A;  1SC4 B;  2B9X A;  1YJ7 A;  4A47 A;  3HCX A;  4CO4 A;  3BGL A;  1X93 A;  2A1B A;  1HD0 A;  1J5E F;  2WW8 A;  1RT6 A;  1DLO B;  4ECR A;  1FNX H;  2AU0 A;  1FRH A;  3R5A A;  1CG2 A;  1IKY A;  1XC9 A;  1T9U A;  3HVT A;  1OIA A;  3F41 A;  4X64 J;  1S49 A;  5A2Q Y;  3UO0 A;  1HI8 A;  3PRB A;  3C6U A;  2HHS A;  5HMY A;  3SCK E;  2V2Q A;  5E41 A;  2Q6B A;  3C16 B;  5J2M B;  4KPY A;  3DLE A;  3J80 U;  4ILL A;  5KG7 A;  1H2V Z;  1WOO A;  5J2N B;  1S6Q B;  4WKY A;  2ZH4 A;  2E1P A;  3RB4 A;  2L9D A;  1NJW A;  2CNN B;  4M5M A;  1LWF A;  1R0A B;  3CIM A;  5KG5 A;  4KKO B;  1RK8 A;  1HQU A;  4OZ1 A;  1RGV A;  1NRK A;  1Q5Y A;  4R0J A;  1FDD A;  4PEO A;  3CJ3 A;  5ETV A;  4QW8 A;  4URQ U;  1RT7 A;  1HBN A;  1Y7P A;  1REV A;  1TK5 A;  1TL1 B;  4KQZ A;  4LFA F;  2MYF A;  3FC9 A;  4OZ3 A;  3PW2 A;  1XR5 A;  4YN3 B;  3WBZ A;  2L3M A;  1UVI A;  1Q16 B;  2KDO A;  2VB6 A;  1JLB B;  1DQA A;  4DR7 J;  5AXL A;  3FGV A;  4AXI A;  5EWG A;  3ZZR A;  1S1U B;  3N4W A;  3FQK A;  2F63 A;  3OUY B;  3GJS B;  1YJ9 S;  2W24 A;  4XPE A;  2DIS A;  3AOC A;  4LF8 F;  4JI2 F;  4NZ7 A;  1IBC B;  4DQQ A;  2CQ4 A;  2CUY A;  3DOM B;  4YR0 A;  2HVD A;  1OYD A;  5ADZ A;  2YPZ A;  2DIT A;  5KFJ A;  3CJK A;  2CPJ A;  1NAQ A;  3QRR A;  3GTY X;  4ANC A;  1Q78 A;  3LOU A;  3MWB A;  2YKN B;  1HNX J;  3Q2T C;  2DNM A;  3D67 A;  2F4F A;  3IRW P;  2H48 B;  4QWC A;  4JB8 B;  4J9S A;  1WKL A;  3CDW A;  2D3U A;  2JSX A;  2I0X A;  2ZKT A;  2QGF B;  1DQ9 A;  2D69 A;  3NG8 A;  1HKA A;  3KTQ A;  2JEJ A;  1N5Y A;  1RA7 A;  1Q4R A;  3FFI B;  1NDP A;  3LUY A;  3OV7 A;  1R6Y A;  1IWA A;  1QM9 A;  2DGQ A;  4AL5 A;  4WFX A;  4X65 J;  4NLR A;  1RKJ A;  5LXY A;  4A48 A;  3VAH A;  4F3O A;  2W9C A;  4OV1 A;  4TY8 A;  1U6B A;  4O4G A;  2DB1 A;  4KBI A;  5J2P B;  2QA4 G;  3R5B A;  2UXC F;  1RBL A;  1HNV B;  5IFM A;  3BF4 A;  2Q2K A;  3MTK A;  1V3R A;  1D3W A;  1CS4 B;  2OH2 A;  5IC6 B;  2ATL A;  2VFT A;  1KQG B;  3KKF A;  4DUT A;  1DAR A;  2KXH A;  1U1M A;  4WP8 A;  3HVR A;  2ASJ A;  2DNO A;  2YWK A;  1TK0 A;  2PD1 A;  1SJF A;  2J76 E;  2Y0S D;  2RAQ A;  4Z7Y A;  2LVW A;  1HL6 A;  2E7V A;  2GMJ A;  2QA1 A;  3R2D J;  1UWA A;  2F5G A;  1DZ5 A;  1B70 B;  4TLR A;  3PZP A;  4DV0 F;  2WOM A;  2BAN A;  2E9R X;  5I3U A;  3Q22 A;  2P9E A;  2W1B A;  3QO9 A;  3LP0 A;  3U1N A;  3C14 B;  3Q8R B;  3M9O B;  1Z1Z A;  4P52 A;  1BXN A;  3WZ0 A;  3QGP A;  2IA6 A;  1B99 A;  2DYA A;  3OSN A;  4RW4 B;  2GVZ B;  2DR6 A;  4ZMM A;  1R0B G;  1X5T A;  2HQI A;  2BA9 A;  3TAP A;  4C8Y A;  1VC0 A;  1TTH B;  1D09 B;  1X31 C;  5CYM A;  5F0U A;  4DFK A;  2MKK A;  4LUB A;  3D66 A;  2W9B B;  3R5J B;  4IH7 A;  2IIH A;  1M1H A;  4WTY A;  2HZC A;  1X4H A;  3IN5 A;  2AIR B;  3FKB A;  1NDL A;  4AT1 B;  1K8A T;  1B01 A;  4ANE A;  4C8Z A;  5E3R A;  4RNO A;  2FVP A;  4DG1 B;  2CQ0 A;  1RHM B;  4L3K A;  1YGY A;  3V6H A;  3OXL A;  3PG9 A;  4BDP A;  4NEY A;  5SUH A;  4GVB B;  1FJ7 A;  4NLP A;  4DV3 J;  3WX4 A;  2DXD A;  2M7S A;  3UW1 A;  1Q86 T;  2HHV A;  4ZS6 A;  1EET B;  1RT5 B;  3J80 Y;  2JBV A;  1XR6 A;  2AJF E;  3BYP A;  4OI4 A;  1M5V C;  1N5T A;  3G6E S;  1Y0H A;  2MDA A;  3P6Y C;  4IDK A;  1DFD A;  2DNL A;  1WC0 A;  3LAN A;  2K1O A;  2C2N A;  1TKZ B;  1KFD A;  5K14 B;  3K59 A;  5KFT A;  4OZJ A;  3CVK A;  2I8E A;  1RAE B;  2CAD A;  1BQN A;  1EA4 A;  3GJQ B;  3CCU S;  3WC0 A;  1HPZ B;  3CJQ A;  3VAM A;  2VUG A;  2EXU A;  1Q81 T;  2AJ2 A;  1MG7 A;  3RJM B;  4NLQ A;  1FX4 A;  3JSM B;  3F73 A;  3KYL A;  1TL7 A;  2AY0 A;  3ILI A;  1JKH A;  1GTH A;  4ZIW A;  1Q95 G;  2MKJ A;  2QZ8 A;  4CO5 A;  2UXB F;  3AJD A;  5KFF A;  1C1C A;  1XNR J;  1Y5N B;  4X4P A;  2BJ9 A;  3AB2 B;  2B4O A;  2Y8W A;  4IG0 B;  3OTD A;  1WSV A;  2DEJ A;  1NSA A;  2UU9 F;  1SJQ A;  3PR5 B;  2K1R B;  1VQP S;  2EPI A;  4LRA A;  3MPD A;  4ZCI A;  3AJ2 A;  4ZIV A;  4PKD B;  3KHL A;  3UD5 A;  1UVN A;  4U95 A;  5D4N A;  4JI0 J;  4XPC A;  2VAS A;  1NK9 A;  1AUS L;  1S79 A;  2AYG A;  2DD8 S;  4RW8 B;  3I96 A;  3I5C A;  3IMQ J;  3R7N B;  1PSD A;  2RT3 A;  2PMH A;  4A8O A;  4DR5 F;  3HMJ G;  4KH1 B;  3DC2 A;  2QLF B;  1HR0 F;  3UE2 A;  1I1G A;  2IBK A;  5HAN A;  2ZOF A;  2JHE A;  2BEF A;  2V8G A;  4QW9 A;  4A8M P;  3TRG A;  3W62 A;  3GXQ A;  1NPR A;  4ZVF A;  3MCN A;  4F4K A;  1EX8 A;  3M8W A;  2R8I A;  5H9F K;  3S01 A;  4IRC A;  3DRX A;  3M1V A;  4X4R A;  2MY8 A;  3MHY A;  3V81 B;  2DHS A;  2XZT B;  2RUG A;  1RTZ A;  4NRT A;  2DO4 A;  2MZS A;  3WHI A;  3I4H X;  3CD7 A;  2KXF A;  3RYL A;  1U09 A;  5CH7 B;  4DV4 J;  5KOX A;  3W2V A;  1UFW A;  4B02 A;  4B17 A;  3ZNJ 1;  2P5V A;  1TFY A;  3G6X A;  2KZZ A;  2R7W A;  4J9U E;  1ZET A;  1KLM A;  4C8O A;  1R8C A;  3ICL A;  2FGO A;  1Q8B A;  3BQ1 A;  2H4W B;  1YTY A;  5B0C A;  4F02 A;  1D8Y A;  2B4U A;  3HZE A;  1Y00 A;  3H7H B;  4M94 A;  2EVZ A;  1HBO A;  3W61 A;  2VA3 A;  3KUE A;  2RQM A;  3DLK A;  3PX0 A;  4CZC A;  2MQL A;  1FTC A;  2LU1 A;  4B3S J;  3NNA A;  4B3T J;  2LA6 A;  3RZA A;  1XR7 A;  2GVD B;  3CCZ A;  2HBQ B;  1GX6 A;  1RWW B;  1S6U A;  2R2R A;  3IM8 A;  1YJR A;  3K2Y A;  3PAC A;  3VAF A;  4NEZ A;  3HHL A;  3HFK A;  4MIA A;  4BWJ A;  2JEF A;  4PWD A;  5AXM A;  1X8D A;  1V9O A;  3H5S A;  4PG6 A;  1RAO A;  1FRM A;  1G2E A;  2V67 A;  9ATC B;  1QD1 A;  2ZVS A;  2WAQ D;  2UXD F;  4F4Y A;  2KXN B;  4OYW A;  1QVG R;  1IBL J;  1FRJ A;  4RW6 B;  3MD1 A;  4NA1 A;  2OSR A;  4RW9 B;  2HWI A;  5E5N A;  3VF0 B;  3HO1 A;  3DLJ A;  1IR0 A;  4QYR A;  2ZC3 A;  1KN6 A;  3OHB A;  4ED1 A;  2KJW A;  5KFH A;  3W5X A;  3H90 A;  3DMJ B;  1JJH A;  2MZT A;  1I94 F;  1WWH A;  2GCF A;  1IKV A;  3GB0 A;  4FN5 A;  2GO9 A;  4XAK A;  1SL2 A;  2OJ3 A;  4FVC A;  1C0U A;  1G4C A;  1APS A;  3GG1 A;  3CJT A;  4DFJ A;  4ID5 B;  3VEA A;  4KJI A;  2LXF A;  1DAX A;  1U49 A;  3I9V 9;  4Y0F A;  2KVI A;  1HNZ J;  3PYG A;  2CVI A;  2LEB A;  1S9G B;  4C8L A;  1VBY A;  1WC4 A;  2VH7 A;  4FXW A;  5DZ6 A;  1CJV B;  2D9O A;  5T7L B;  4F8R A;  2NPI A;  1JJ2 R;  2HFU A;  3WIV A;  4GO7 X;  7FD1 A;  3O2I A;  2CG4 A;  3BGO P;  1RAD B;  4OYA A;  1BUX A;  2EI5 A;  2F8H A;  3MMC A;  1CBK A;  3AA9 A;  5AXK A;  2ZBQ A;  1FKA F;  1UWB A;  1WAC A;  2P9G A;  4UF4 A;  1BWE A;  2DIV A;  3D2W A;  1RHQ B;  1OSD A;  2BX6 A;  5HO4 A;  4DPO A;  5LSL A;  1DHM A;  3FJ2 A;  3M6W A;  2F8E X;  4ZVQ B;  4AL7 A;  1AZS B;  3X3U A;  1TL3 B;  3MGJ A;  3I56 S;  4HAC B;  1RU2 A;  4O3R A;  3EGV A;  3M8R A;  4QQB A;  4X64 F;  1RUS A;  1W7W A;  4PR6 A;  3BR8 A;  1RHR B;  2B8P A;  3G86 A;  3IC1 A;  1DTT B;  1H72 C;  1WHW A;  3MM9 A;  1BWV A;  3OTO J;  1RHJ B;  3P45 B;  3AT1 B;  4P2X A;  4OL8 A;  4YY3 J;  1KD1 T;  3G5O A;  2IRX A;  4DX5 A;  2YKO A;  2BBE A;  3PW5 A;  3NCP A;  4NMX A;  2CPX A;  3MMB A;  4PWW A;  2XEX A;  3ETO A;  1S7H A;  1G3O A;  4QYZ J;  1IKX B;  4MAK A;  2DNQ A;  2OML A;  4K2X A;  4H4O A;  3KLE B;  4DJB A;  4ZVR B;  5C7P A;  3RB3 A;  2MY7 A;  4GC6 A;  4ICL A;  3MAQ A;  5GAD I;  2XCA A;  3N79 A;  3MM5 A;  1R8P A;  1QE1 A;  2RUS A;  3GIK A;  4QWA A;  5DZ7 A;  2BKO A;  3L7U A;  3W5Y A;  2EEY A;  4G65 A;  1X5P A;  4Q44 A;  4ED0 A;  2ADC A;  1PYT A;  1G1X A;  2VIH A;  2MXY A;  4O0I A;  2H5I B;  2OI2 A;  3IR7 B;  2LQ9 A;  1F3V A;  1X0P A;  4DR7 F;  4N5S A;  2RML A;  2KTQ A;  3BSN A;  3S1T A;  4RWW A;  3M2R B;  2AX1 A;  5DM6 Q;  3R2C J;  3IGV A;  4ITS A;  4L74 A;  2DIU A;  1MLA A;  3RRH A;  1N34 J;  1B7Y B;  2FQQ B;  2A10 A;  3K89 A;  4DV5 J;  5DLF A;  3BQ0 A;  2NYH A;  1MWY A;  3MTJ A;  3NBP A;  3E3X A;  1HQ2 A;  5DDO C;  3AXM A;  5HVF A;  1HNX F;  5EN1 A;  1VQN S;  3LAM A;  3MM8 A;  1SJ4 P;  3KNG A;  4LF6 J;  1FWP A;  4UZC A;  2LXU A;  4I56 A;  2BE9 B;  4WP9 A;  2CJQ A;  5DDQ C;  3SZ2 A;  4S0M A;  5J1E B;  1SV5 B;  3JSY A;  1HWK A;  4QIG A;  1SCJ B;  4MKA A;  4DN0 A;  3KLF B;  1UKU A;  2GPE A;  1BLU A;  3OVS A;  2Y1J A;  1BE4 A;  4HVZ A;  1RAA B;  2R8K A;  3I55 S;  5AXN A;  4LF5 F;  1C1B A;  3QNW B;  1H0H B;  4B08 A;  2V68 A;  3W65 A;  3FMT A;  1M1K T;  4RU9 A;  2LEA A;  4P72 A;  4KR0 B;  3IGN A;  1P9Y A;  3LP1 B;  3DGP B;  2YNI B;  2E9Z A;  4KGX B;  2V69 A;  4RPF A;  4RW7 B;  3FT7 A;  5ETO A;  2BUN A;  3HJV A;  1XNQ F;  4FKX A;  3B8H A;  3R27 A;  3RR8 A;  4V19 J;  1Q79 A;  4CCH A;  3JSB A;  2XGP A;  1RAC B;  4CO1 A;  1WEY A;  4PUO B;  4W90 B;  4O3P A;  3NMR A;  2YWE A;  4M5K A;  4OI3 A;  2OSQ A;  1CQM A;  2XHC A;  4ECZ A;  4IUF A;  1DLO A;  1RWM B;  2QYG A;  3SV4 A;  2F4V J;  3Q24 A;  2G2O A;  3IP0 A;  3VAK A;  4RZR A;  1S6P A;  3O44 A;  1AUD A;  4RNF A;  5KFQ A;  1RDR A;  3RW6 A;  2YXL A;  1BC6 A;  3MFH A;  4J91 A;  2OGU A;  2CNK B;  4ZJL A;  5J2M A;  3C16 A;  5CD4 A;  1ZA1 B;  3CJS A;  3H4D A;  2PFD A;  5JVH Q;  3IWX A;  2HW3 A;  5J2N A;  2AGP A;  2B6A B;  2PC6 A;  4KO0 B;  1R0A A;  4KKO A;  4H4M B;  3ZO7 A;  1GXL A;  2KB2 A;  3NCR A;  5HQM A;  2B0G A;  2KG0 A;  5KFU A;  5HRO B;  2RB7 A;  5K8O A;  5EDW A;  3W63 A;  1H2U X;  5AE1 A;  5AE2 A;  5IV4 A;  4Y6I A;  4F25 A;  1YWX A;  1VDH A;  2NPF A;  2HQC A;  1A7G E;  1KKH A;  3D1Q A;  2OLW A;  1MN9 A;  1TL1 A;  1U1K A;  2F65 A;  3D0H E;  4OJ3 A;  4ZLP A;  2CQI A;  3CCM S;  5L8R C;  4DV3 F;  2HFN A;  1Q16 A;  1JLB A;  2XMV A;  1VR6 A;  2W9A A;  1HNW J;  3BV8 A;  2I38 A;  2X1B A;  3VHQ A;  1U6F A;  3MI7 X;  1S1U A;  1RT2 B;  4DR3 J;  1K73 T;  2OAU A;  4DCO B;  2BOP A;  1UFL A;  3W5Z A;  2H65 B;  1VQL S;  4ZP6 A;  3D6H B;  2F7V A;  3DOM A;  3TI0 A;  1H38 A;  2PGC A;  4FF1 A;  1N5V A;  4HDG A;  1NJZ A;  1T9V A;  5L46 A;  4Y65 A;  2MLY A;  2VBY A;  1PJ5 A;  2YKN A;  2YVS A;  3H5X A;  4P2S A;  4X4O A;  2XS7 A;  3UR0 A;  2F40 A;  4OIX A;  2IVY A;  5DGB A;  4F26 A;  2GNK A;  5KFL A;  4ZN3 A;  4NE9 C;  5IQQ A;  3M30 B;  2HWT A;  4H4K C;  4M5I A;  2ZBR A;  4DL0 C;  1FE0 A;  5MAO A;  4EK2 A;  3DNC A;  1NZ8 A;  3PIO Q;  2M52 A;  2M9K A;  4XO0 A;  1BDV A;  4C6A A;  3D1H A;  1WF1 A;  3CT9 A;  3JTP A;  4ES1 A;  5F8I A;  4CH0 S;  3AQP A;  1C4A A;  4HH0 A;  5BXI A;  2QA4 S;  2DXE A;  1KOO A;  3KDO A;  1KDN A;  2RU9 A;  3E01 B;  2R7R A;  2N7Y A;  5J2P A;  3OFF A;  1U8S A;  4D3H A;  1HNV A;  2LU2 A;  3NEK A;  4OYO A;  2NUH A;  4NXN F;  1FNM A;  5HVH A;  4WK1 A;  4CLT A;  1CS4 A;  2ROP A;  3A3P B;  4JI0 F;  1IBK J;  2EFP A;  3VZH A;  1R8H A;  4FYD A;  3H40 A;  4CWB A;  2VD3 A;  4JI6 F;  3H0P A;  4ZN1 A;  2G0C A;  2ZH9 A;  2P2C B;  2IM1 A;  3HKZ D;  2JXG A;  1AB8 A;  4LJM A;  4FXV A;  2EC0 A;  4DSK A;  1KP6 A;  3UN5 A;  3HVA A;  1NHV A;  1JB0 C;  1S4F A;  3GV8 B;  2KFY A;  2DRA A;  1X7V A;  2CPE A;  4QZV B;  1Q0N A;  1BAZ A;  2WHO A;  5KT6 A;  3C14 A;  3W66 A;  4IFY A;  2OEK A;  4URG A;  4DV4 F;  2GVZ A;  1ZAV A;  4KIA A;  8ATC B;  2HQ3 A;  3NS5 A;  4KGM A;  3ENV A;  2W7O A;  2ZE2 B;  5FD1 A;  1KC8 T;  3R8Y A;  2ZWO A;  2MSS A;  2CDQ A;  1RYR A;  1MRO B;  3ELH A;  5AJ3 F;  3P96 A;  1QY7 A;  4ZCK A;  5C5J A;  3GWC A;  5ETP A;  1TMJ A;  3VGT A;  5EWE A;  1M5S A;  2W9B A;  1WI8 A;  4ZLL A;  1V5I B;  4UTG A;  1VJQ A;  2X3G A;  3PNI A;  3GU0 A;  3KK2 B;  2WVB A;  5EWF A;  3QGG A;  3IRX B;  1H7W A;  1ELO A;  4DWI A;  1HWU A;  3C8Y A;  2ZVI A;  2ZH7 A;  2NUU G;  4B3S F;  2HND B;  2BNZ A;  2VC1 A;  2H3A A;  4LQ3 A;  4DG1 A;  1PG5 B;  5DG7 A;  2J9C A;  3DKD A;  4LIR A;  4AE5 A;  2AHO B;  4DQI A;  1VIO A;  5D0H A;  5HJY A;  2VFS A;  5GAH U;  1YJN S;  2LEC A;  3DRP B;  1ZM2 A;  2RBF A;  1PKU A;  1NK4 A;  4GVB A;  1Y5L B;  3DCA A;  2HFS A;  2BJ1 A;  1SC6 A;  3J7Y I;  4RJV A;  2VBW A;  3CJ8 A;  3B6B A;  2VA2 A;  1RBA A;  3HHL D;  1EET A;  3CD0 A;  1RT5 A;  3OW2 R;  4DFM A;  4ZLJ A;  5FLX U;  4HT5 A;  7FDR A;  4RBV A;  3FUY A;  1YQH A;  5H1S V;  1IBL F;  3GG0 A;  4WPA A;  1GK8 A;  3OTE A;  5IM0 B;  3IR6 B;  1U0H B;  3MFI A;  1TKZ A;  3E51 A;  5K14 A;  5B09 A;  4JI8 F;  4NLY A;  5ETR A;  3AD7 C;  1G6B A;  1UVL A;  3PFE A;  3MPY A;  1IRQ A;  1GTE A;  3FDS A;  1HPZ A;  3BBB A;  2KKH A;  2XLI A;  5KFX A;  2QYC A;  3GMG A;  3IS9 B;  4ED8 A;  3MDF A;  1E6V B;  1O6X A;  1LOU A;  3JSM A;  2IHR 1;  2R7O A;  5CAA A;  2KYX A;  1F0X A;  5GAE U;  4L76 A;  1E6Y B;  2M8D B;  5L1K A;  1SKR A;  3ILO A;  2KN4 A;  4RBU A;  3KJQ B;  3PR4 A;  3DN9 A;  2PN6 A;  2E29 A;  2D3Z A;  4WZM A;  4KT0 C;  4IG0 A;  2K1R A;  4NOH A;  2XB2 D;  3QYY A;  4CLU A;  3K5L A;  3FMB A;  4LVN P;  2AGO A;  3VEB A;  3H8Y A;  4ZA1 A;  3BBC A;  4J9M A;  4ED5 A;  3CCR S;  2AEJ A;  4JOU A;  3PO4 A;  4FDF A;  5KG4 A;  3W8P A;  3ET6 B;  4A8K A;  5J2Q B;  1X9M A;  5KFN A;  2UUA F;  4AQY F;  4J5O A;  1JNZ B;  4NLT A;  3MXH P;  4M5L A;  1WC6 A;  4PWU A;  4RW8 A;  1VRU B;  2VFU A;  2K5J A;  3OL8 A;  2VQE F;  4PZV A;  2CPI A;  4NLU A;  4ATN A;  4F04 B;  2VL1 A;  1Q7L B;  3MPW A;  3X1L B;  1VQ5 S;  1OJ4 A;  5J1N A;  2FD2 A;  4G1Q B;  4CYU B;  2Z2L A;  3OR1 B;  3P4U B;  4DQR A;  1NHK L;  2YH1 A;  2YWG A;  4ELT A;  1U1O A;  2DNY A;  2HFV A;  3OFE A;  4P2M A;  1TUG B;  1F5B A;  4Y3C A;  1UTA A;  2DH8 A;  3V81 A;  3CDA A;  1FO1 A;  2WSC C;  4UT4 A;  1S1T B;  2CPH A;  1VQ7 S;  1RT4 B;  2JH3 A;  2R4F A;  1ULR A;  3BDE A;  3ENQ A;  2FJV A;  2IBO A;  1MU2 B;  3J81 j;  2RRA A;  3OR2 B;  3S7R A;  2Y1I A;  2L9W A;  2GAG C;  2DRD A;  2L9N A;  3LA0 A;  4EO8 A;  3H25 A;  4DV2 F;  4EUV A;  4C11 B;  1IXK A;  4MFB A;  1GEH A;  1XMQ J;  4TNO A;  2QE5 A;  2APO A;  1KVJ A;  3MED B;  1RTI B;  4J37 A;  3IO1 A;  4UOG A;  5D78 A;  1GNK A;  4I69 A;  4C0B A;  2J0W A;  4BWM A;  1YZ7 A;  3VGU A;  3GIR A;  4CO2 A;  4NI2 B;  3PVX A;  3K5N A;  5L1J A;  1HBU B;  4I1T A;  3SQO P;  1D9F A;  2IVF B;  4MKB A;  2RQC A;  3FVY A;  1UVK A;  3M2V B;  1VHI A;  2GVD A;  3LF0 A;  5GAH I;  1NLK L;  3CDU A;  1JJ4 A;  4CQ1 A;  4FYX B;  3Q8U A;  2IRY A;  1I3O B;  3LAK A;  3FNN A;  3FEX B;  4QU7 A;  1WDD A;  1IKW B;  3C2P A;  5EX0 A;  2HK2 A;  2POK A;  1VK3 A;  1H3D A;  3FQL A;  3TO8 A;  2XSJ B;  2N4C A;  4O3N A;  3H98 A;  3GV5 B;  3MM7 B;  2KM8 C;  3T6B A;  2EG2 A;  4O4R A;  1PYS B;  3ZC4 A;  4M63 A;  3UDC A;  2FLL A;  1AFI A;  1KEK A;  4LF6 F;  4RW9 A;  4MIW A;  1O5J A;  4X4V A;  2YH0 A;  4CM0 A;  2IDE A;  2LKZ A;  4IR9 A;  3RUB L;  2CJX B;  3FK4 A;  1CJK B;  3EPI A;  2YNG B;  3V4I B;  4NPO A;  2MPU A;  2VJV A;  1WHY A;  4B3O A;  4LBP A;  4YB5 A;  2GGP B;  1S9F A;  4P75 A;  1NH8 A;  2IYI A;  2CWX A;  4ID5 A;  1WC1 A;  3G82 B;  5D0E A;  1J5E J;  1T11 A;  1QTM A;  2MGZ B;  2E66 A;  1VMB A;  1IJF B;  1NO8 A;  3N01 A;  4C3K A;  2Z0G A;  4LF9 J;  3T6J A;  4G1P A;  1S9G A;  1PIL A;  4ME7 E;  1U4B A;  3KHH A;  5JMN A;  1W2I A;  1CJV A;  5T7L A;  3PJ9 A;  4XDD A;  2IPO B;  5FLX Y;  1TMM A;  4L6V 3;  2FVS A;  5D4P A;  1RYS A;  2C2D A;  3L95 X;  2Z8Q A;  3T1A A;  4ECV A;  4X2B A;  4K4Z A;  1RTH B;  1X4D A;  2IFX A;  2K7J A;  3VVU A;  1JLF B;  3FSX A;  3RU0 A;  1CQN A;  3BQ2 A;  1IQT A;  1AZS A;  2FHM A;  2JWN A;  1B28 A;  3NOG A;  1TL3 A;  4CLK A;  2YNF B;  4HAC A;  2F4V F;  3MCS A;  2U1A A;  1WNE A;  4P74 A;  4LFA J;  2PI5 A;  5RUB A;  1KQK A;  3KWM A;  4QPT A;  1FNO A;  3GIL A;  2OPR A;  1H74 A;  1NZA A;  3CDE A;  5KFD A;  4TLQ A;  1DTT A;  2DR7 A;  4OJ1 A;  3BSC A;  1LEO A;  2UVU A;  3P49 B;  1SUQ B;  3BGU A;  2OD6 A;  2MJU A;  1KQF B;  3TW0 A;  1SH3 A;  2W25 A;  4OHW A;  1N88 A;  2BW7 A;  2UV8 G;  2F8M A;  1RWP B;  5C42 B;  4LF8 J;  1IKX A;  3LPE A;  3KLE A;  3NGK A;  1RHK B;  1OPI A;  4IRK A;  2QN6 B;  1EKR A;  1AYE A;  2HHP A;  4ECY A;  3A13 A;  4LSN B;  3QJL A;  3SCL E;  2YY3 A;  4LRB A;  4B9M A;  4CNZ A;  2GHW A;  2XC9 A;  2NXU A;  2G2Y A;  2LCW A;  1FXD A;  3QIP B;  4DQP A;  1FES A;  2LXI A;  3IR7 A;  4ZKA A;  1N48 A;  3HHL C;  2QL7 B;  3QRQ A;  4A46 A;  3FEY B;  3MUR P;  4DR3 F;  3HP6 A;  3M2R A;  3FRZ A;  4I64 A;  2XMA A;  1CJT A;  4PCQ A;  1N5S A;  1OHN A;  2ZUG A;  3GIM A;  4ZDN A;  4WJB A;  4YB6 A;  4Y2C A;  2NZC A;  3GJR B;  3DI6 B;  4OX9 J;  3PFO A;  4KPC A;  4K4T A;  3HD2 A;  4XDC A;  3PRV A;  4KHP F;  4F50 A;  2GHP A;  2NCK L;  2VBZ A;  4XIU A;  2BJE A;  4NLD A;  3R1H A;  2LYV A;  3CE8 A;  1F9E B;  4OZ2 A;  3B54 A;  4KE5 A;  4M1K A;  4LRV A;  5BYS A;  2BE2 B;  2QL9 B;  4MYT A;  4CTA B;  4RU2 A;  1YDL A;  2UVW A;  2X7I A;  4U96 A;  4I68 A;  2CPF A;  2N4D A;  2FIU A;  2R8J A;  1SV5 A;  2MJN A;  4LFC F;  1CUL A;  4N76 A;  4X62 J;  1H7X A;  1QAJ A;  3W9J A;  1CC8 A;  2BM1 A;  3KLF A;  2ZIT A;  2ZBP A;  1S1W A;  2WBM A;  5IC4 B;  3TVY A;  3KK1 B;  1GFW B;  2ASD A;  1O8B A;  5KOW A;  4F2S A;  3GII A;  3OHA A;  2MZJ A;  2XY7 A;  2HVE A;  3LP1 A;  2DHA A;  3DGP A;  1VBZ A;  1VQ6 S;  2YNI A;  2HHX A;  6AT1 B;  3M2U B;  4ILM A;  4PRF A;  1FXL A;  3Q0A A;  4RW7 A;  5KFB A;  2Q66 A;  2EFG A;  4CRJ A;  4DI6 A;  1SPB P;  4K4S A;  2ZM6 F;  2ERR A;  1OO0 B;  5THW A;  4NLV A;  1NPK A;  3SCJ E;  2UVR A;  4PQA A;  2DNH A;  2GJI A;  2J0Q D;  5I3Q A;  3CC2 S;  1HWL A;  3MEK A;  4PUO A;  2M88 A;  3EIC A;  3SV3 A;  5HMZ A;  1B0T A;  4ECX A;  1NME B;  1ZS6 A;  1NKE A;  4JV1 A;  2OO4 A;  2E5L F;  5H9E J;  3W3S A;  2ZHA A;  3JQJ A;  2RRN A;  1FCA A;  1UA0 A;  5F3T A;  5LMU J;  5D4O A;  3ZNU A;  5HP1 B;  2FJB B;  2ZJP Q;  1L3V A;  1XBW A;  4DL7 A;  2L08 A;  3HLU A;  4CLY A;  3T5J A;  2HAF A;  3VQS A;  2VFV A;  5GME A;  5KFW A;  1BD6 A;  1Y11 A;  2HPU A;  2XGQ A;  5CZX A;  1XTZ A;  3IR5 B;  3A3O B;  2B6A A;  5KFM A;  1M0S A;  4KO0 A;  4BBY A;  4F4X A;  5KT7 A;  1F3F A;  1U1R A;  1AA1 B;  4F0K A;  4H4M A;  2OMO A;  1F9F A;  3J7Z 5;  2DNP A;  1T05 B;  4P9S A;  2DHG A;  3OJS A;  2GS8 A;  1X60 A;  4RL1 A;  4DCJ B;  2G4B A;  1FFS B;  2MQP A;  1W26 A;  3D0I E;  5IT9 U;  4OHV A;  2CAJ A;  5JUM A;  2KYZ A;  5GMK a;  4LVO P;  1NH7 A;  1A6L A;  1ZAW A;  2DGW A;  2MLX A;  1TQL A;  2W01 A;  3BDP A;  3OL9 A;  5LSO A;  3N9U C;  4N41 A;  4CLW A;  4OZ5 A;  2QT7 A;  3AB4 B;  5E2Q A;  3THV A;  1B0P A;  4KSE B;  2W8L A;  4C97 A;  1RT2 A;  3NS7 B;  1TL5 A;  1VQ8 S;  3C46 A;  2XBP A;  2XY5 A;  1NSP A;  3BM7 A;  4WFZ A;  4DR1 J;  3ZTO A;  3TA1 A;  1YSJ A;  2CIM A;  1N32 J;  4IOB A;  3H2V E;  4JBC A;  4LF4 J;  1J2V A;  1VQ9 S;  2ZH8 A;  3LWL A;  2HLT A;  2FY1 A;  2CNL B;  1JLQ B;  2OEM A;  4FS2 A;  4UOF A;  4AYB D;  1X4C A;  3M30 A;  3I0S B;  3BO4 A;  5LJ5 Y;  1HQE B;  4UY8 5;  2MB0 B;  3M8Q B;  2QIF A;  3TZY A;  4ECU A;  5L1I A;  5F8J A;  3ULH A;  3BSA A;  3HSD A;  1HR0 J;  5G0R B;  5ETK A;  5KTQ A;  2MHE A;  4LFB J;  2R7X A;  1Q7Y T;  1HLW A;  2OEL A;  3OVB A;  4QIE A;  1O0P A;  3M9M B;  4YR3 A;  2ZJR Q;  1NSK L;  3E01 A;  3F0N A;  1ZA2 B;  2VG5 B;  1RE1 B;  2DHX A;  2NZ4 A;  2LP4 A;  2C3M A;  4L73 A;  4BHQ A;  5FJ4 A;  2C3O A;  3KHR A;  2RDI A;  4DLE A;  3HUL A;  1Y3J A;  3CNQ P;  4DU7 A;  5B0B A;  1RWV B;  4UQT A;  2VFR A;  5E3Q A;  2M4M A;  4B9N A;  2MQO A;  3GLJ A;  1WKJ A;  1YKW A;  2J9E A;  4M5G A;  1M90 T;  4D8J A;  4P7T A;  2VPZ B;  3WC2 A;  2HRY A;  1R7I A;  1FE4 A;  4QBU A;  5IOL A;  5E33 A;  2O1P A;  2QX0 A;  3M8P B;  3GJT B;  2DGV A;  4WBF A;  3QJP A;  3NMA A;  1NJX A;  1VRT A;  4GVL A;  4ECT A;  1U24 A;  3W7B A;  2M5Y A;  2YBV A;  4KFB B;  4Q8E A;  9RUB A;  5DQH A;  1WG5 A;  1HYS B;  3S6E A;  1FD2 A;  2A2D A;  1N33 F;  4LR7 A;  4X4N A;  2FHO B;  2CJA A;  1YBU A;  4ZIT A;  4ZVT B;  1S59 A;  5HI7 A;  2LQ8 A;  5B0G A;  3B4D A;  2ZBC A;  3ZZO A;  2VPX B;  4P2F A;  4C48 A;  2O5D A;  3OFH A;  2X1A A;  2ZE2 A;  2B8Q A;  4O3Q A;  1MRO A;  1GAO A;  1XMQ F;  2VKZ G;  1KVK A;  3GR1 A;  2XM3 A;  1UEK A;  2WB4 A;  1JIH A;  4XTT A;  2MEW A;  2WTF A;  4DZ6 A;  2MKH A;  4I67 A;  2Z4P A;  3HZG A;  4E0D A;  1NK7 A;  3KK2 A;  4ZP9 A;  3CME S;  3IRX A;  3TZW A;  1WOS A;  2K29 A;  2D41 A;  1T9T A;  3WDO A;  2CPY A;  1I94 J;  2HND A;  2NXE A;  2KFN A;  4GO5 X;  6FD1 A;  1RHU B;  1RU1 A;  2EKN A;  2I1R A;  4YR2 A;  4QIF A;  3EZ5 A;  2HGL A;  3DRP A;  4WXW A;  4X4Q A;  3KMQ A;  4RNN A;  5I4M A;  4P10 A;  4YQW A;  2J9D A;  2C3Y A;  1FVQ A;  5M2U A;  4Y34 A;  1U1Q A;  3SFG A;  1S12 A;  4CLS A;  4K8R A;  1CJU B;  2CG8 A;  2IY5 B;  3PEH A;  2BJ8 A;  4Q2L A;  5IM0 A;  1IKY B;  4DX6 A;  4DQS A;  3GSD A;  1U0H A;  1GH8 A;  4F4W A;  3Q83 A;  5GAG I;  4WFY A;  3LGN A;  2RS2 A;  5D3G B;  1LKZ A;  1SJ3 P;  2WSE C;  1ZYQ A;  4IRD A;  5GMD A;  2CQ3 A;  2Z57 B;  4LT6 A;  2ZC4 A;  5A6P A;  4U9R A;  1JXV A;  2XO7 A;  3VAJ A;  2DY9 A;  3IS9 A;  1FF2 A;  2CQG A;  1E6V A;  1WD6 A;  5KG0 A;  1YG0 A;  5IT9 Y;  2GO8 A;  4NLS A;  2D1C A;  4GRS A;  3KLV A;  5ITH A;  1S10 A;  1E6Y A;  5CXT A;  2OTL S;  4LF9 F;  3ADA C;  2IVM A;  2WSF C;  5IT0 A;  1QSL A;  4MT1 A;  2HLU A;  1WOR A;  4X4U A;  2HGM A;  1HBN B;  3BKF A;  1N6Q B;  1MWZ A;  3CCJ S;  3K17 A;  1RKI A;  1UCN A;  1V5V A;  5SZT A;  2BQR A;  2CJ9 A;  3TA0 A;  3UPF A;  2AMC B;  3N0V A;  3ZZP A;  1V6H A;  1XWL A;  4DUZ F;  3ET6 A;  5J2Q A;  2VG7 B;  4IOC Q;  5DLG A;  1SIZ A;  4HH1 A;  4ZVP B;  1VRU A;  2QG9 B;  1VC6 A;  5CQG A;  5ETQ A;  3FSY A;  4ES3 A;  4KYZ A;  4PYA A;  3OTC A;  2E5G A;  4I2Q B;  4CYU A;  4ZOS A;  2W4P A;  2BDP A;  3OR1 A;  5BYQ A;  4KHR A;  1S1V B;  1JMT A;  2OD4 A;  1U47 A;  1WKK A;  4AAI A;  2HBZ B;  3BBF A;  3KG4 A;  2V2Z A;  1PAE X;  1S1T A;  3RBE A;  4KGZ B;  4PQU B;  2XY6 A;  1RT4 A;  1BQM B;  4N8O A;  1D0E A;  3BYR A;  1RWX B;  1TV6 B;  2OIH A;  1IN0 A;  2DTJ A;  3KG0 A;  4FVM A;  1NB7 A;  4YME A;  3FCV A;  4TY9 A;  3OR2 A;  1BGX T;  2ZDP A;  2BR0 A;  1R6V A;  1RZM A;  1U2C A;  2LQ5 A;  3LW5 C;  4NAS A;  1RXO B;  2Y0B B;  1IBM F;  2A0F B;  2DR8 A;  3EVW A;  1TU0 B;  1OQ6 A;  3HXM A;  4WYW A;  3MED A;  1VI7 A;  4P7V A;  1RTI A;  2Y1R I;  1VHF A;  1YRT A;  4NZ6 A;  3GE9 A;  5B0D A;  2DNR A;  3H5Y A;  3DM2 B;  4C4W A;  4K5R A;  1T03 B;  1U48 A;  3OL7 A;  5KFZ A;  4NI2 A;  3HKW A;  1HBU A;  4MIB A;  5IWA F;  1S1X B;  3JQK A;  3C19 A;  1FVS A;  4OX6 A;  1HHQ A;  2O67 A;  2YNH B;  1JLA B;  2JOQ A;  1EIY B;  4DR2 F;  4UOC A;  2IA0 A;  3ZZY A;  2JX2 A;  2HHQ A;  2Q79 A;  4J9O A;  3RTV A;  5G4D A;  2XWX A;  3JXO A;  4EGL A;  3THT A;  3GYG A;  4TU7 A;  5A76 A;  2XO6 A;  2M0G B;  1IKW A;  2Y9H A;  4LF5 J;  4X84 A;  3TZX A;  2XSJ A;  1BDT A;  4OX9 F;  4I0W A;  3MM7 A;  2BJ7 A;  2XMM A;  3W64 A;  3IBC B;  1X0F A;  1KS2 A;  2LA4 A;  4PAA A;  3LP0 B;  2G9O A;  1F5C A;  4JV5 F;  3ENA A;  4B3R F;  1XNQ J;  4DXL A;  4LQ9 A;  1KOH A;  3MF5 A;  2XG8 A;  3I31 A;  2WW4 A;  4KTQ A;  2CWK A;  4OI1 A;  4LRF A;  2I2Y A;  2YNG A;  2J6U A;  3AOA A;  5CA5 A;  3IXQ A;  2KVQ E;  2HS0 A;  2H1O E;  3CCL S;  3CCT A;  1R8B A;  4EEY A;  4X62 F;  1TKD A;  2FB0 A;  2GGP A;  3QGI A;  2RD5 C;  2HFO A;  2JXH A;  1HW9 A;  2GV1 A;  1SKS A;  3CTR A;  1XIQ A;  3KJV B;  3BSO A;  2MGZ A;  4JV0 A;  3CW2 C;  2VV5 A;  3F56 A;  2J0X A;  2H54 B;  4I7F A;  2E44 A;  4CT9 A;  3EX7 B;  2XNR A;  3IA0 A;  1HIY A;  1NU4 A;  2CQ1 A;  3CUN A;  2PEH A;  2V5H G;  4NML A;  3MR3 A;  2F1F A;  5GVQ A;  3LAL A;  3OFG A;  3QFH A;  5KFO A;  4K0K J;  1W25 A;  1UPP A;  2AP6 A;  2NLW A;  5IS2 A;  2J8A A;  1URR A;  5K8N A;  1RTH A;  4DX8 H;  4LSL A;  4TKT A;  4KHM A;  1JLF A;  5D6G A;  3H87 C;  2XI2 A;  4PG8 A;  3GR0 A;  2OPP B;  5DG8 A;  1BMQ B;  4RLE A;  3FBB A;  3CCS S;  3O6Q A;  3H2L A;  3OSP A;  2GIF A;  2PE8 A;  4KRW A;  2DGO A;  2G1D A;  1ACM B;  2PDA A;  3JSR A;  5T14 A;  5KG6 A;  5LMU F;  4ZPA A;  3FRY A;  3TQ1 A;  2XYH B;  4U67 Q;  3DDI A;  5DO2 A;  5B7W A;  1DTQ B;  1IJE B;  2RSQ A;  4Z7C A;  1RLD A;  1SUQ A;  2COL A;  5KFP A;  4CO3 A;  4W98 A;  5I42 B;  2BJD A;  1FJC A;  4HV0 A;  5FDL B;  3PM9 A;  3DRY A;  3GZ7 A;  4ZVS B;  3EMT A;  2ZD1 B;  5C42 A;  1L3S A;  5KT4 A;  4RUB A;  3CCQ S;  5BYR A;  1HNI B;  5ETT A;  1T0T V;  1CSJ A;  2LQB A;  3DRS B;  5E7O B;  2XMT A;  3NGU A;  3EGZ A;  2EC2 A;  2OEJ A;  2BXJ A;  4IH5 A;  4DPY A;  5KG3 A;  2GA7 A;  2G0J A;  5L9X A;  5D15 A;  2IRU A;  3AY0 A;  1T9X A;  3QIP A;  2B9E A;  3BO3 A;  1BQX A;  1RWN B;  1B4S A;  2HFZ A;  2F9J A;  3DOK B;  2KI2 A;  1FRL A;  2QA2 A;  2A3J A;  5D0G A;  4HTI A;  2DJW A;  2C22 A;  1OY8 A;  4KGV B;  2JFK A;  4DR1 F;  5CCM A;  2CQH A;  1ARQ A;  2QV6 A;  4ED6 A;  1U45 A;  1N32 F;  3BPS P;  3W8G A;  4LF4 F;  3C6T A;  3DI6 A;  4NXN J;  4NLX A;  3MUT P;  1UJ5 A;  1EQM A;  3M1V B;  3VV2 B;  1SQE A;  2K3K A;  3BH6 B;  1KBR A;  3NWG A;  4WF9 Q;  3T5L A;  2GHV C;  1KFS A;  4JI6 J;  3KK3 B;  5K8P A;  4ZPB A;  5DJB A;  3T1Y J;  4K5S A;  3NLC A;  2BE2 A;  4WFA Q;  4CTA A;  1VS3 A;  2Q3P A;  2OPS B;  3Q8Q B;  3TEH B;  4ZCL A;  4LFB F;  3O8W A;  2K8G A;  2KZM A;  2QC3 A;  5DM7 Q;  2KT2 A;  2FC9 A;  2V63 A;  1D9A A;  1KLN A;  1FK9 A;  1Z2L A;  1X4B A;  3PY8 A;  1F2G A;  2OUG A;  1SC1 B;  3KK1 A;  1NCL A;  2CYY A;  1XMO F;  3JB9 k;  2AD9 A;  3KLG B;  2V34 A;  2A18 A;  1TKX B;  3GCW P;  3DLK B;  3B4M A;  4QR1 A;  2ROG A;  1K9M T;  2RKI B;  2NQP A;  3BRE A;  2FPH X;  3BGR B;  3TOQ A;  3O1L A;  3M2U A;  4DCP B;  3K7R A;  4OQJ A;  2V6A A;  3MEE B;  3QT7 A;  1PCA A;  2KT5 A;  1LQ9 A;  3BH7 B;  1AXQ A;  2SXL A;  5AJ3 J;  3R5C A;  3CJ0 A;  4PWD B;  1TKT A;  5GAD U;  1T9Y A;  4B3M J;  3DU6 A;  4ZPD A;  2QRR A;  3ENW A;  4QOT A;  1OYE A;  1MNT A;  1UZH A;  5DET A;  4ZPC A;  2BE7 D;  5D77 A;  4M5N A;  2QLJ B;  4HHH A;  1IR1 A;  5KT2 A;  4ZVE A;  5HP1 A;  4C3M A;  4F4A A;  4B9T A;  3JAM U;  4CP5 A;  2VOP A;  4FYV B;  4HKQ A;  2HSE B;  4DDF A;  3TUI C;  3HHD A;  3IBF B;  3OLA A;  3G8S A;  2E7X A;  3K5M A;  2DGS A;  1KVI A;  1FFG B;  4ZJO A;  1T3N A;  4X66 F;  3J7A 1;  3CB4 A;  2V4R A;  2E9T A;  1DRZ A;  4R8U B;  1SL1 A;  5D0R A;  4F4Z A;  3RR7 A;  5E3A A;  2KG1 A;  2AKW B;  2DEI A;  2PA3 A;  2HNY B;  4JI8 J;  1L3U A;  2RDJ A;  4X4T A;  1L3K A;  3DRR B;  3HF5 A;  5KFS A;  3PX4 A;  2C2K B;  2ILY A;  3CO0 P;  2LQJ A;  3NCQ A;  1QUP A;  1X4A A;  4NA2 A;  3MMC B;  1ARR A;  4YFU A;  4C0H A;  3DLL Q;  4NL5 A;  2YQ1 A;  1UWB B;  2N3L A;  4Y2M A;  1Q5V A;  3S8S A;  4Q43 A;  1QAI A;  2BKN A;  4UST A;  3Q23 A;  4OI0 A;  2C28 A;  1FWL A;  1F9H A;  2HS4 A;  2GQ2 A;  1QTN B;  1Q8K A;  3TAR A;  2RE1 A;  3NO7 A;  3ZTP A;  4M5D B;  3MR6 A;  3T1H F;  1S7I A;  2DBB A;  3R97 A;  1IVZ A;  3DXB A;  1OPZ A;  5FII A;  5EUH A;  1UP1 A;  2GW8 A;  2ZHB A;  4QPX A;  4OZL A;  1ROF A;  3EDR B;  4NCG A;  4WFN Q;  4DPW A;  1JLQ A;  1EP4 A;  3EVO A;  1VFJ A;  2ZUA A;  3MM9 B;  2J5A A;  2QO3 A;  3I0S A;  4HI2 A;  4BC9 A;  2HAI A;  2UUA J;  4AQY J;  1HQE A;  3M8Q A;  1QJH A;  2XMJ A;  2JEG A;  1JXL A;  1N5Q A;  2VQE J;  1GQE A;  2FZG B;  2CFX A;  2V8V A;  4OHZ A;  4EYH B;  4LF7 F;  4IG3 B;  3EZU A;  3T3F A;  1M1G A;  2D3O R;  2ZZM A;  3QAE A;  1P1T A;  2Z2Z A;  4TYA A;  2DR5 A;  3EZO A;  5HVG A;  1K1Q A;  2VG5 A;  3M4X A;  2DVI A;  2RRB A;  4BCA A;  3A8I A;  4C0O C;  2R7S A;  2Y8Y A;  5HQL A;  4JI7 F;  2BKP A;  3KUG A;  2V9K A;  5BR8 F;  3MR5 A;  2ZHO A;  1S4E A;  2X1F A;  4WP3 A;  1FKP B;  3V6K A;  3B78 A;  1VQ4 S;  3BJY A;  3UR3 C;  4DV2 J;  2JLF A;  4H54 A;  1ZM3 A;  4LF2 A;  3M6X A;  3BN4 A;  2JFD A;  1RCO B;  1JWW A;  3M8Y A;  4JI3 F;  4P73 A;  2ZOG A;  3M8P A;  4C98 A;  4AND A;  2B7C B;  4ZCM A;  4MK7 A;  3D4J A;  1K0T A;  1FJG J;  1R3N A;  2XLJ A;  4K7Q A;  2EW9 A;  4ZP7 A;  2PMZ D;  4KFB A;  2YPY A;  3G87 A;  4I2P B;  2ZZN A;  2AEF A;  4ENO A;  3HPO A;  3GCX P;  1DQ8 A;  3G6V A;  2QL5 B;  2UUC F;  1TZ0 A;  2UUT A;  5HMW A;  2JNJ A;  2PEB A;  5K5M A;  3P5T L;  3H5U A;  4H4K A;  2DCL A;  2A2C A;  1TVR B;  1TL4 A;  2DPI A;  3MAA B;  1QAY A;  1RAI B;  4QWE A;  2R7U A;  4FBU A;  3O3L A;  1YVF A;  2IAJ B;  1JNR B;  1U7L A;  1I6J A;  1JXE A;  4USU A;  3PIP Q;  2PMW A;  3FCW A;  3DLG B;  4F3Q A;  5A6W A;  1FDA A;  2IM2 A;  1S5Z A;  2HZA A;  2K6L A;  4C3L A;  3AD9 C;  1RAH B;  2O66 A;  4OZ0 A;  3CO9 A;  2Z2M A;  5T41 A;  2ZH2 A;  1RQ0 A;  4KC5 A;  3NXZ A;  5H9F J;  2J0S D;  4K4X A;  1SJ1 A;  2LFV A;  3OT9 A;  2W7P A;  4OFZ A;  3UFC X;  3JAM Y;  2K06 A;  3FCH A;  1QSS A;  3J81 U;  4FYW B;  1F60 B;  2HBY B;  1B7F A;  4OJH A;  2GX8 A;  3CGI A;  1T02 A;  1HBM B;  2W2M P;  2YTC A;  1VQS A;  1VGY A;  2FGC A;  1IWG A;  1CJU A;  4ES2 A;  1HI1 A;  4NYP A;  3GIJ A;  2GIR A;  4HR2 A;  3TVZ A;  1UPM B;  2AX0 A;  2VC0 A;  4CLP A;  1S6P B;  3EVM A;  2I5J B;  1U25 A;  4K50 A;  3TJA A;  2RIJ A;  4J9L A;  5D3G A;  4USK A;  1KTQ A;  2UUB F;  2MQ8 A;  3UNG C;  4NYZ A;  2HVH A;  4OV6 A;  2ROE A;  4HHU A;  1YHQ S;  2IM3 A;  2GZO A;  4U8Y A;  5LT5 A;  1WHV A;  4DR4 J;  4NYO A;  2KEL A;  3HM9 A;  5KFC A;  3UD3 P;  1JX4 A;  1EQ0 A;  1XJW B;  5E3C A;  1QTG A;  1PJ7 A;  2B51 A;  1EAR A;  4TYB A;  1ZM4 A;  2G0I A;  1ITP A;  3CD6 S;  4A8W A;  2E5I A;  3N6L A;  1N56 A;  2CKW A;  4NCB A;  4F3M A;  1RCX B;  5CCL A;  1UEV A;  3W1Y C;  3KFW X;  1MYK A;  3OXF A;  4KB7 A;  1N6Q A;  1PIE A;  1XN9 A;  2CXE A;  1N4L A;  4Y2K A;  4RKU C;  4DZD A;  4K0K F;  5JXS A;  1S6Q A;  1LWC B;  4ZVH A;  5A0Y B;  1MSW D;  4R0E A;  1NK0 A;  1VQM S;  1Z4U A;  5B08 A;  2RHS B;  1R0C B;  2IMW P;  1XMB A;  1KNZ A;  3TAM B;  3V4M A;  1SKU B;  2VG7 A;  3EM1 A;  4PXE A;  5I3P A;  3QZ8 A;  3TNV A;  5K9F A;  3I5B A;  1BHN A;  3MM6 B;  3U7J A;  4DBQ A;  5ETN A;  3K0J A;  3QAU A;  2EFQ A;  4I2Q A;  5L38 A;  5LMN F;  2ZH3 A;  1TK8 A;  3QSY B;  3RRG A;  4MMO A;  1S1V A;  2V8P A;  4FF2 A;  3PV8 A;  3HX9 A;  2DXF A;  3ONQ A;  4Z2X A;  1EKS A;  3TX0 A;  4F67 A;  1YIJ S;  2XYG B;  1SL0 A;  1KTV A;  1OS5 A;  1DY3 A;  2V4J B;  4PQU A;  4MKV A;  1BQM A;  1FJE B;  3C66 A;  3EXC X;  4MJW A;  2JXI A;  3DGV A;  5DS7 A;  2VOD A;  2H4Y B;  3MEC B;  1TV6 A;  1NSQ A;  3OUY A;  3J7Y U;  2RQ4 A;  1S72 S;  1KHV A;  2DRB A;  1VIS A;  4L75 A;  3F44 A;  3QLH B;  4OI2 A;  2GC8 A;  4DV1 J;  1RT3 B;  4J7C A;  2UZA A;  4J90 A;  4UUW A;  2XNQ A;  2LDY A;  7AT1 B;  1GT8 A;  1YJU A;  3TUJ C;  4KHP J;  1P8G A;  1OQ3 A;  1ZZF A;  3DM2 A;  1WC5 A;  2ALY B;  1MW7 A;  1T03 A;  1RJJ A;  3LWM A;  1SIW B;  1Q8I A;  3PJW A;  1UVM A;  2ALZ A;  1WJ9 A;  1A9N B;  1S1X A;  5KFE A;  1ZPW X;  3FFI A;  3UWT A;  3KLI B;  2YNH A;  2PO4 A;  1JLA A;  1T3O A;  4DSF A;  3JYT B;  2AN7 A;  4LFC J;  4ZK7 M;  4OZN A;  5IQ6 A;  2M2B A;  3OXG A;  2FTR A;  2CAX A;  3MD3 A;  1TAU A;  1LXJ A;  2XMK A;  2P8I A;  4Q0B B;  3HT0 A;  1PJ6 A;  2ZBI A;  2HRU A;  3CMQ A;  3PKY A;  3LQV A;  1VCT A;  5LSR A;  1T8E A;  4CM2 A;  2Q1L A;  1AT1 B;  4NLO A;  4FXD A;  4ELU A;  4DV7 F;  2M70 A;  3D6F B;  2WVF A;  4C2M A;  1WTB A;  3RB0 A;  4RX6 A;  1NEE A;  1YBA A;  3A12 A;  2XMW A;  3GFY A;  2C3U A;  2HMI B;  4DLG A;  3T1Y F;  4IFY B;  5EHH A;  2KRR A;  2ZM6 J;  2CA9 A;  2PA8 D;  3R5D A;  5BJR A;  5DDP C;  4GKJ F;  4I6Y A;  3A8E A;  5DQG A;  3L09 A;  3LJP A;  3QFW A;  3PO5 A;  1U2F A;  1QDU B;  2JDJ A;  1QUV A;  2WCX A;  3NGR A;  2AYM A;  4USW A;  2XZD B;  3POT B;  4RNH A;  1VBK A;  3KJV A;  2E5L J;  3KJF B;  5LM7 E;  5KFK A;  3ZZU A;  3IG1 B;  2EK1 A;  3J81 Y;  1TAQ A;  1H98 A;  1F2H A;  1ZPV A;  2C2Z B;  3THP A;  4RW4 A;  4WIQ A;  1TUV A;  2KHD A;  3HI9 A;  3G6Y A;  5LJ3 Y;  3ILJ A;  3OTB A;  3NY0 A;  2O3D A;  3VTI A;  1KWM A;  2B56 A;  3HSZ A;  4ER8 A;  2AYB A;  1XQI A;  1M5H A;  2OFH X;  5IXU A;  4B3M F;  4A8Q A;  2DCU B;  3QMQ A;  1K47 A;  4ZHR B;  2MZR A;  3CSK A;  5F8H A;  2OPP A;  5F9L A;  4IOA Q;  1NLA A;  2WB1 D;  3KG1 A;  3N28 A;  1WI6 A;  2LMI A;  1G7C B;  4DV6 J;  5DQI A;  1Y10 A;  4QYZ K;  2Q6C A;  2D9P A;  1N0U A;  2EFV A;  2XWY A;  2R3V A;  4ALZ A;  4DN9 A;  2HVZ A;  3Q86 A;  2PSZ A;  3HHN B;  1MMD A;  1WEZ A;  4DL5 A;  2KJV A;  2GQC A;  1DTQ A;  4LMZ A;  5HMX A;  2ZEJ A;  5U47 A;  3H2U B;  2EBG A;  1CEZ A;  2VG6 B;  2GAH C;  5I42 A;  1OSC A;  3VCD A;  2AEM A;  1FX2 A;  4C7Q A;  5FDL A;  3CCV S;  2CNO B;  4Y00 A;  5F8M A;  2DO0 A;  2ZD1 A;  4FPI A;  4FPR A;  4DR6 F;  4WYL A;  3H42 A;  1F5A A;  2WON B;  1HNI A;  1YRX A;  4I6W A;  3D7S B;  3A8K A;  3N6M A;  1UA1 A;  3PXG a;  2QSF A;  3CD5 A;  2XTJ P;  3DRS A;  2YX1 A;  5CYQ B;  1N36 F;  3Q8P B;  4ETX A;  3CJ5 A;  3TUP A;  3NAH A;  2NR0 A;  3I32 A;  4I4B A;  2ZJQ Q;  2B43 A;  4YP3 A;  3DOL B;  2AQ4 A;  4URS A;  4DF4 A;  2GQQ A;  4F7V A;  4FXE A;  2F3J A;  2VPY B;  2VQF F;  2MQN A;  4ED7 A;  3NNC A;  2RNE A;  5C25 B;  3OVA A;  2MST A;  2ZFH A;  3DOK A;  4KV8 B;  1SQF A;  1M5P C;  4KY3 A;  4O23 A;  2AW0 A;  1WTF A;  2JZ5 A;  2VHG A;  2AT1 B;  4DUY F;  3GFZ A;  1JLE B;  1SXL A;  1CLF A;  3AJ1 A;  1IM4 A;  4DU8 A;  3FEZ A;  1H2T Z;  1LWE B;  4GMK A;  3T9N A;  4HLB A;  3QT6 A;  3BS9 A;  2G13 A;  3HD1 A;  3QWP A;  1FD8 A;  5HAT A;  4A8Y A;  4JI5 F;  1WEL A;  3VGV A;  3SBM A;  1SVD A;  2OKQ A;  1PC5 A;  1FRK A;  2FZC B;  2B5J B;  1SB6 A;  5KAK A;  3W60 A;  5KFV A;  1YBT A;  4FNH A;  4CI0 B;  3KK3 A;  2VU5 A;  3EPG A;  4O3O A;  1SJR A;  2OPS A;  4CNY A;  2BJ3 A;  1AW0 A;  1RWK B;  3QAT A;  2BMB A;  3ITH B;  1YJT A;  5MLC V;  1NK6 A;  3AA8 A;  2MKY A;  4MFB B;  2V2K A;  1NKB A;  1TR0 A;  2H5J B;  4FP9 A;  2CJY B;  2BNW A;  2WVE A;  4LBH A;  3T9Z A;  1CVJ A;  3KJN B;  4JI4 F;  1Y3K A;  5KFR A;  1XK8 A;  2HHW A;  2X1G A;  3D9B A;  3TR5 A;  1R8A A;  3KLG A;  1N33 J;  3I4P A;  1TKX A;  1YRU A;  2NXC A;  3DDK A;  2RKI A;  3AAW B;  1Y4Z B;  2UUW A;  3BGR A;  3QOQ A;  2P6T A;  2DNK A;  3D68 A;  1LW2 B;  1WEX A;  1QLN A;  4YHH J;  1D9D A;  3MEE A;  1B0V A;  5LXR A;  4L3N A;  2OPQ B;  5B0A A;  3LH2 S;  3HHK A;  3KUH A;  2JC1 A;  3ZXW A;  2RS8 A;  2A6O A;  3SIP B;  1S77 D;  1URN A;  2YKM B;  2AZ3 A;  3I87 A;  3IWN C;  2FJE B;  4DL4 A;  4G1I A;  1HW8 A;  4WFB Q;  2ZWP A;  1FJG F;  1OG7 A;  3PX6 A;  1P1L A;  2BRK A;  4TU9 A;  2VZ9 A;  3HFZ B;  3CPW R;  2YWH A;  1NHU A;  8AT1 B;  3MMA B;  3CF5 Q;  2ZOM A;  4EU0 A;  4ECS A;  2CDR B;  3A1Y G;  2W7A A;  4B3O B;  4DS4 A;  1UVJ A;  1HHS A;  1DBD A;  3JQM A;  3EUN A;  4DF8 A;  1FT8 A;  2V4Q A;  4AD6 A;  1U6Z A;  4F2R A;  4R8U A;  3PEJ A;  1PGZ A;  4K2J A;  4L72 B;  2ADL A;  5C24 B;  2C42 A;  4RW6 A;  3DHW C;  2HNY A;  1EB0 A;  4YDD B;  4CIO A;  3US5 A;  3DMJ A;  2UV8 A;  4YS2 A;  3DRR A;  4EFA C;  2ATC B;  4XK8 C;  2CJK A;  4DPU A;  2PII A;  2R42 A;  1UMJ A;  1C0T B;  1R31 A;  4WK3 A;  3PHT A;  2CJB A;  2KL8 A;  4EYI B;  3Q8V A;  3V6D B;  2CPD A;  3EYZ A;  3UN3 A;  3MUV P;  2R2T A;  1LK5 A;  3TAQ A;  2YQ3 A;  2AJQ A;  4WE1 B;  1I5O B;  4FF3 A;  3G4S S;  4CT8 A;  2GJF A;  1H73 A;  4M5D A;  2ZNY A;  1IM6 A;  3T5K A;  3NOC A;  1GMW A;  2IYG A;  3A8J A;  4MJK A;  2GMH A;  1UAW A;  2MZQ A;  1JLG B;  4DSE A;  2V0N A;  2VDI A;  1LWX A;  4CO0 A;  4B9S A;  2OPR B;  3UCZ P;  5KT5 A;  2MQQ A;  3M8Z A;  4DUZ J;  3NGD A;  2HS3 A;  3VAG A;  3NGS A;  3LPY A;  1L5U A;  1LV5 A;  4GKK J;  3D6M B;  1S76 D;  4DR4 F;  1EHW A;  1NND A;  2VKR A;  5CYJ A;  4DX7 A;  5HAO A;  3CMA S;  6FDR A;  1CPZ A;  1UZD A;  2W2P P;  2QMX A;  4IG3 A;  2D7S A;  3SQG B;  3UCU P;  4RBT A;  4LR9 A;  2HQD A;  5ETL A;  4A4J A;  2KT3 A;  3AFG A;  4LIW A;  3MEG B;  1HWJ A;  2V9W A;  5CZV A;  2C2E A;  5HLF B;  1Q1K A;  2XZW A;  4R5P B;  3D1O A;  5HK4 A;  3PW7 A;  3AQO A;  3P5B P;  1U1P A;  2RF2 B;  3CED A;  4M5J A;  1L3T A;  3J7Z T;  1PBU A;  2R9L A;  4WU2 A;  1DUR A;  3QSI A;  4ZP8 A;  1FDN A;  1YX2 A;  3MAH A;  1X4F A;  3A4T A;  2DPJ A;  3IAS 9;  1FKP A;  3PKM A;  4MTP A;  4FZV A;  3G2X A;  1AFJ A;  3K5P A;  3CDB A;  3R5G A;  4RUC A;  1PAU B;  3RAM A;  1IBM J;  2BV3 A;  4U7U K;  1CJT B;  2KU7 A;  2ASL A;  3CUL A;  1RTJ B;  3C15 B;  4JP8 A;  3HK2 A;  1WG1 A;  4QJV A;  4TQS A;  1NXI A;  2F9D A;  1RI7 A;  2DK2 A;  2WK4 A;  2RU3 A;  4CLL A;  1ZH5 A;  1DJ0 A;  1RTD B;  4M8L A;  5IWA J;  3IM9 A;  2IJR A;  2EWH A;  5DGA A;  2CQD A;  2P6S A;  2RQK A;  3CCW A;  4DR2 J;  1JLC B;  4I2P A;  3G9C A;  1WF2 A;  3G8Q A;  2MLZ A;  1NUE A;  2XI3 A;  2G2Z A;  2GML A;  1PYO B;  2Z2Y B;  3NP5 A;  4HHJ A;  3SXL A;  3HSG A;  4DV1 F;  1TVR A;  4X65 F;  3Q89 A;  1CUL B;  4UW2 A;  3MAA A;  3RG6 A;  2HHH J;  4QCL A;  3PRD A;  3CIZ A;  5F0W A;  1MN7 A;  2E5J A;  4FYY B;  1S1W B;  2IAJ A;  2WVC A;  4UY8 T;  4IR1 A;  3RBX A;  4O44 B;  4KGK A;  4P6Q A;  3DLG A;  3FZ2 A;  4JV5 J;  4DS5 A;  2HBR B;  3M6V A;  4B3R J;  4FNI A;  1LW0 B;  2B7B B;  2HIY A;  1R89 A;  1S57 A;  2HGN A;  2JVR A;  5J1E A;  4E2F B;  5F9N A;  2RH3 A;  2K9I A;  5J1P A;  2E1C A;  1J5O B;  1N0V C;  3NKY A;  4N8N A;  1U2R A;  2QFJ A;  2IJF A;  2FHJ A;  3UVJ B;  4DMZ A;  2XS2 A;  1NDK A;  4WXO A;  3SMZ A;  2R7Q A;  3GQC A;  2I9S A;  2AJ4 A;  1HI0 P;  2Y3Y A;  3CXC R;  1PBA A;  5ETM A;  1HBM A;  4J9Q A;  3U27 A;  3E8O A;  2N82 B;  4U7U D;  1MYL A;  2H9Z A;  2XHW A;  1MML A;  2JRS A;  3K5O A;  2FZK B;  4PAB A;  1M5K C;  1FI4 A;  4USH A;  2I5J A;  2IMO A;  1RSC A;  4ERD A;  3K58 A;  4DFP A;  3DYA B;  4UOH A;  3PTW A;  4WZQ A;  2VF3 A;  3CJR A;  2YQ0 A;  4LRE A;  2W2N P;  3KLH B;  3BKT A;  2HWH A;  2RIL A;  3OD2 A;  1UET A;  3JTN A;  4HT7 A;  1IR2 A;  2IC3 B;  3ZTR A;  4NLG A;  3D0G E;  1NKC A;  2ILZ A;  3L7O A;  3NRB A;  4WKR A;  2JC0 A;  2J8S A;  2HNZ B;  1B64 A;  4OHY A;  3L3C A;  1JK9 B;  3L7P A;  2DY1 A;  3CJ2 A;  2YX7 A;  2B9W A;  3LTO A;  3G71 S;  1IUJ A;  3MPU B;  1LWC A;  2X3D A;  1RB0 A;  4RR5 A;  1RAJ A;  5A0Y A;  4RWX A;  1MMN A;  2R7T A;  3BO2 A;  2UVV A;  1FA0 A;  2FUG 9;  2Z56 B;  1VC5 A;  2BRL A;  3FMW A;  2EFO A;  2V8H A;  1VJW A;  3TAM A;  3DLB A;  5A8K B;  4EWT A;  5A8R B;  1NK5 A;  4AL6 A;  2MZ1 A;  5JVG Q;  2CZ9 A;  4USJ C;  3M32 B;  3TZZ A;  1X4G A;  3D6T B;  3LO3 A;  4OYX A;  4ETZ A;  5HRO A;  1X9W A;  3EXY A;  2Q43 A;  4EI2 A;  4P71 A;  3UNY A;  4USI A;  2J7U A;  1F6T A;  3MM6 A;  4X4S A;  3BN7 A;  1NDC A;  1VQK S;  4DV6 F;  5IV3 A;  4LF1 A;  1S0V A;  3IWL A;  4JYA J;  3ZTQ A;  4JI1 J;  4DSL A;  1U26 A;  4U6P A;  2J6S A;  3VGS A;  2NSC A;  2DH9 A;  2K7K A;  4NX9 A;  3M05 A;  1MWQ A;  2BSQ E;  2MKI A;  3VR1 A;  2V4J A;  3GSI A;  5C2C A;  5C2G A;  4ECQ A;  1TEL A;  4CH7 A;  3MEC A;  2V94 A;  2G1H A;  3TYT A;  1FEE A;  4K4Y A;  4EZ6 A;  3MMJ A;  2CZV C;  1YK9 A;  2XMU A;  4DHV A;  3WX8 A;  4IFV B;  3OPK A;  3QLH A;  1RT3 A;  1ZTT A;  3KXD A;  2C1E B;  3SSR A;  2Z58 B;  3PYD A;  4NA3 A;  1XNR F;  4OMF G;  3PW4 A;  2H3E B;  4ZPW R;  4J9P A;  3TJ8 A;  2DR9 A;  1U1L A;  3MUM P;  3K57 A;  1EAY C;  2JJ4 D;  5GAG U;  4MK9 A;  1N54 B;  4NLW A;  3Q8S B;  5E3P A;  2DHH A;  1SIW A;  1X9S A;  4QIW D;  3TP2 A;  3RAX A;  3MR7 A;  5A8W B;  3OQ2 A;  3VZI A;  4OX7 A;  2N7C A;  2K2P A;  3KLI A;  2KHC A;  2ADB A;  2NXJ A;  3R6L B;  2B9Y A;  1S9E B;  3JYT A;  4B9V A;  4ED4 A;  5KFA A;  4TQR A;  2BW2 A;  2B3T B;  5HBM B;  3DLH A;  4HYK A;  4TN2 A;  4PG7 A;  5LL6 d;  4IO1 A;  4F36 A;  4JV2 A;  1Q53 A;  4HEA 9;  4Q0B A;  1UL3 A;  1NK8 A;  2ABY A;  3GON A;  1XMO J;  1M5O C;  4NCA A;  1UJ4 A;  3GYX B;  2D3O 1;  2ZH6 A;  1HFE L;  1O51 A;  3UDL A;  4CH1 A;  1VRT B;  1LFP A;  2HRT A;  4U8V A;  2WBR A;  1I51 B;  1LK7 A;  1NB2 A;  2E5H A;  2HYI B;  4J9N A;  2MKC A;  4PG5 A;  2BYC A;  1EZZ B;  3BEG B;  3WQP A;  2HMI A;  4Y28 C;  1D8Z A;  3TA2 A;  2CQB A;  1S0M A;  2BVZ A;  3J7A N;  3QQC D;  4N47 A;  1FKO B;  1ARO P;  5M2P A;  2BZ2 A;  1W2B R;  1PC4 A;  3QT8 A;  1S99 A;  2LLZ A;  3POT A;  2VBX A;  3PYF A;  3VWS A;  2QEX S;  4OYZ A;  3W2W B;  5CAB A;  2HKE A;  4KAI A;  5B0F A;  3QRP A;  2IJN A;  3IG1 A;  3W9H A;  3TUZ C;  3I0R B;  4B3T F;  2C2R A;  3KNA A;  3IFE A;  4YHH F;  2DNZ A;  2FJA B;  4RNM A;  1FHT A;  2JLG A;  4X66 J;  1T7P A;  1NM2 A;  3GV7 B;  5L1L A;  3I5A A;  2KRB A;  4BC7 A;  1HMV B;  4ZHR A;  2H5E A;  2QLB B;  5IT4 A;  1OY6 A;  1J27 A;  1UFK A;  1RT1 B;  3V2U C;  4USM A;  1GMV A;  2BAC A;  2YKA A;  3BKU A;  1P94 A;  2N3O A;  3H20 A;  3LP2 B;  3SSS A;  2M8H A;  4YB7 A;  3AXK A;  2XCP A;  1HWI A;  5HSP A;  3RW7 A;  3SDE B;  4MH8 A;  2XQC A;  2FYX A;  3K8W A;  1GX5 A;  3M8S A;  3D28 A;  2MKS A;  3OL6 A;  4ED3 A;  2VG6 A;  2BQ3 A;  3EJM A;  2RJZ A;  4DOZ A;  3T41 A;  4JUZ A;  4DSI A;  3T1H J;  1RT6 B;  2CPG A;  2LEP A;  4DPT A;  3U1M A;  3RBD A;  2WON A;  1HNZ F;  3H59 A;  3EE3 A;  3HVT B;  5KG1 A;  4GC7 A;  1FWK A;  2AWZ A;  5CYQ A;  3C6U B;  2DGU A;  5AE3 A;  4K59 A;  5HJX A;  3VW4 A;  3DLE B;  1XEZ A;  1QSY A;  3DOL A;  4F0M A;  3U02 A;  1R43 A;  3EDQ B;  4QIV A;  1RWO B;  4QWB A;  2CQP A;  3QWU A;  1LWF B;  4NXM J;  4QR2 A;  5C25 A;  1HQU B;  4J9V A;  4Q7A A;  3U1L A;  4KV8 A;  4LF7 J;  3M6U A;  1S0O A;  3HDS A;  4ZVG A;  1B3T A;  2HIQ A;  4FKY A;  2L48 A;  1YI2 S;  2UP1 A;  4G6V B;  1JLE A;  1K44 A;  1RT7 B;  3TWZ A;  3VQT A;  4HTJ A;  4ILR A;  3UCG A;  1NJI T;  2VOO A;  4BLG A;  1VLO A;  1LWE A;  1REV B;  1T94 A;  4NRU A;  2BOA A;  4OYM A;  2JVO A;  2CVE A;  1GMW D;  4JI7 J;  2YX4 A;  5BR8 J;  3OTO F;  4J9K A;  2B5J A;  2NYI A;  4GKK F;  1WC3 A;  2DKO B;  4YY3 F;  1TP7 A;  3UI3 A;  4K4U A;  1WOP A;  2H51 B;  4N7T A;  3MR2 A;  1YJW S;  2RVJ A;  1OMS A;  3LGM A;  4K4V A;  4G1Q A;  4IO9 Q;  4YB1 P;  4JI3 J;  1RAG B;  1Z2Z A;  3ITH A;  3CJK B;  3TVK A;  5HQ8 A;  2ZH1 A;  1RLC L;  5DDR C;  1VQO S;  4TVA B;  2Y1L B;  5IZH A;  2EKY A;  3ZZ0 A;  2PFF B;  3T19 A;  3CC4 S;  1FER A;  2XLK A;  3Q2S C;  2KH9 A;  1MU2 A;  3UDE A;  4TU8 A;  1QAX A;  2AF6 A;  2UUC J;  3CJ4 A;  3N5B A;  1N5Y B;  4LR8 A;  5H9E K;  1LW2 A;  3BGF A;  3QPI A;  4C11 A;  4DL3 A;  4AFF A;  2W9C B;  2OPQ A;  1HD1 A;  2HG4 A;  4OYI A;  4TY8 B;  1N34 F;  3SI8 A;  4O4G B;  3L9Z A;  5K20 B;  2YKM A;  4DV5 F;  2BAB A;  3A3N B;  1UW9 A;  1SH2 A;  4E8U A;  1KR4 A;  2FLN A;  3R6G B;  2WRM A;  3SCI E;  2BM0 A;  1JJC B;  4W92 B;  3M2V A;  4ZLN A;  5F3Z A;  2EK6 A;  1VRQ C;  3TQE A;  1U9P A;  2IDL A;  1P27 B;  2FY8 A;  3TEG A;  3MMA A;  2ZH5 A;  5CHC B;  3HJF A;  3RRK A;  4IYQ A;  2C2M B;  1WF0 A;  2HHH F;  2FVC A;  2JL9 A;  3HFV A;  4EBE A;  4OJG A;  5GAE I;  3IBW A;  4Z37 A;  5KT3 A;  2HHT A;  2WOM B;  3ISZ A;  2BAN B;  3FBE A;  5EGY A;  2ZNZ A;  3QBC A;  5I3U B;  4WII A;  4YEA A;  5F8N A;  2YWF A;  3QO9 B;  5C24 A;  1X5O A;  3NNE A;  3EWG A;  1VYA A;  2YWW A;  2AV5 A;  4I7F B;  1OY9 A;  3PHE A;  3CC7 S;  1T9W A;  3ZTS A;  2NSB A;  2C2O B;  1CJK A;  4OLO A;  2UUB J;  3V4I A;  3TAN A;  2EBE A;  3PW0 A;  3ZFV A;  3FZB A;  1Q8L A;  3ETM A;  1FXR A;  1C0T A;  3I9Z A;  2R7V A;  4ZVU B;  4W4M A;  2W4C A;  5CYM B;  4HI1 A;  2V2V A;  4A8S A;  3G82 A;  1RAB B;  3OJU A;  4LSL B;  3V6D A;  3K8V A;  2NXN A;  2OHD A;  3NGT A;  1OWX A;  3MOZ A;  3AHP A;  4WE1 A;  2FHJ D;  2AGQ A;  4ED2 A;  3HSJ A;  1U8W A;  2R2U A;  3FSI A;  4K4W A;  4DSJ A;  2V8D A;  3I82 A;  3SYZ A;  1WDT A;  1RAF B;  1TFW A;  4DL2 A;  1LNQ A;  1VK8 A;  1JLG A;  4YOE A;  3E2E A;  2B4V A;  2OTJ S;  2DH7 A;  3MZI A;  2FJX A;  2R2S A;  1YJV A;  2LDI A;  1VIX A;  1U02 A;  2XS5 A;  4JI2 J;  3TX8 A;  4J9R A;  2YNF A;  3BZQ A;  2CZ4 A;  4IDK B;  3L4B C;  2VON A;  2JLE A;  5LMN J;  4OI6 A;  2W8K A;  3SQG A;  3T5H A;  4PXB A;  2HZV A;  4QU6 A;  1ZOT A;  2E1R A;  2KM8 B;  3GPA A;  3MEG A;  1BQN B;  3ISN D;  5HLF A;  3TJ9 A;  4R5P A;  4IQM A;  3QGH A;  4C8K A;  1KSP A;  4DL6 A;  2QLW A;  2RF2 A;  1VBX A;  1VOM A;  1REG X;  2KOE A;  5F8G A;  5CD4 H;  2O01 C;  1PO6 A;  4KH0 B;  1TL7 B;  5LOQ A;  1JKH B;  4C9D A;  4RO0 A;  5EX3 A;  1HNW F;  2CRL A;  3SEO A;  1ZZN A;  4OX8 A;  3LGH A;  2OP5 A;  4LSZ B;  3DDN A;  1F1B B;  1C1C B;  3VAI A;  1FDB A;  2HVI A;  1LXN A;  3JS9 A;  3G96 A;  4LSN A;  3KMS A;  1RTJ A;  1YZ6 A;  3ILL A;  3C15 A;  3RB6 A;  1ZTW A;  1EJ7 L;  2E1M C;  5F41 A;  2UXC J;  4IKA A;  1P9Q C;  4CLZ A;  4JYA F;  4JI1 F;  1FRI A;  3C6T B;  4LBI A;  4MKY A;  2QMW A;  2GJ2 A;  3AH6 A;  4E98 A;  1RTD A;  3GFH A;  2AJ0 A;  2OFG X;  4OHX A;  4CLF A;  1U0S A;  2XUL A;  2ZZT A;  5E0O A;  3O5T B;  2HHU A;  1MNE A;  2XSF A;  1SQG A;  1JLC A;  2DNG A;  4FS1 A;  2K3I A;  3R7B B;  1FRX A;  3GP9 A;  4WTO B;  3DXS X;  4LRD A;  1ZM9 A;  4BS2 A;  1N52 B;  5HL7 Q;  4A8F A;  2FVQ A;  2W2Q P;  3QJJ A;  3RBZ A;  4WWS A;  4DEZ A;  5L39 A;  3PJX A;  1FK9 B;  4V1A k;  2L41 A;  2ACY A;  1N8R T;  3M7V A;  3R9L A;  3HT3 A;  4O0N A;  4DV0 J;  1LFW A;  2DGT A;  4DV7 J;  3NWR A;  2HQG A;  2JEI A;  1S48 A;  2KFZ A;  4O44 A;  2A2B A;  1S97 A;  2M3D A;  4Y2A A;  1GMU A;  1LW0 A;  4LRC A;  1IBK F;  3W2V B;  2FC8 A;  3D5M A;  4PYD A;  4Q45 A;  2QTW A;  1HA1 A;  4UQG A;  2PT0 A;  3RAQ A;  4GKJ J;  4WU3 A;  2C3P A;  1J5O A;  1KLM B;  3UVJ A;  2V50 A;  3R3T A;  1VLY A;  4N77 A;  2ZKU A;  1XER A;  1TKT B;  4OYP A;  4DPX A;  4M95 A;  1HBO B;  4Y2I A;  3OBI A;  1A0O B;  2B4P A;  1K0V A;  1HHT P; 
#chains in the Genus database with same CATH homology
 4FXE A;  2CA9 A;  2CAD A;  1MYL A;  1EA4 A;  2WVD A;  2H1O E;  1NLA A;  2K5J A;  1IRQ A;  3VEA A;  1U9P A;  3FMT A;  2BNW A;  2WVE A;  3BKU A;  3GXQ A;  2JXH A;  3QSI A;  1P94 A;  2PC6 A;  1PAR A;  2WVC A;  2JXG A;  2WVB A;  1Q5Y A;  2AY0 A;  1B01 A;  3FT7 A;  4D8J A;  3LGH A;  2NZC A;  4ME7 E;  2BNZ A;  1ARQ A;  2K29 A;  3QOQ A;  2KEL A;  2BA3 A;  4HV0 A;  3BKT A;  2HZA A;  2K6L A;  2BJ9 A;  2CAX A;  3OD2 A;  2F1F A;  2RBF A;  1BDV A;  1BAZ A;  2BSQ E;  2K9I A;  1BDT A;  1QTG A;  2JXI A;  2BJ1 A;  1X93 A;  2CAJ A;  2CPG A;  3BKF A;  2BJ7 A;  1MNT A;  1MYK A;  3VEB A;  1ARR A;  2WVF A;  2Y3Y A;  3PHT A;  2HZV A;  3H87 C;  3VW4 A;  2K1O A;  2BJ3 A;  2FGC A;  1B28 A;  1Q5V A;  2GPE A;  2BJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...