3VEAA

Crystal structure of matp-mats23mer
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
MKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrodomain Ter protein
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3veaA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3veaA01
4FXEA 2BJ7A 4ME7E 1Q5VA 2BSQE 1QTGA 2WVCA 2BA3A 2CA9A 3VW4A 2BJ3A 1EA4A 3VEBA 3VEAA 1MYLA 2CAXA 2JXIA 2BJ9A 3QOQA 1B01A 2BNZA 2AY0A 2WVFA 2WVDA 2JXGA 1ARQA 1BDTA 2CAJA 1P94A 2BJ8A 2KELA 2K9IA 1MYKA 1B28A 2BJ1A 2CADA 2WVBA 2GPEA 2K1OA 2H1OE 1NLAA 3LGHA 2CPGA 2JXHA 2K6LA 3OD2A 3FMTA 1BDVA 1PARA 2HZAA 1IRQA 1BAZA 2K5JA 1MNTA 3H87C 4D8JA 2BNWA 1ARRA 4HV0A 2RBFA 1X93A 2WVEA 3FT7A 3GXQA 2HZVA 2K29A 1U9PA
chains in the Genus database with same CATH superfamily
2LM0A 3O3NB 2YIAA 2BA3A 3NAHA 2BJ9A 2GF4A 3CV5A 3DDGA 2WVFA 2YLLA 4UDXX 2YKTA 2C08A 4QPXA 5FLEX 4KIKB 2CPGA 2KKEA 2Z0NA 2K6LA 3ER9B 4UDYX 3H87C 2QKWA 4ATMA 2HZVA 4EZOA 2O0I1 2BSQE 4R5JA 1GNTA 1LQ7A 1ZYLA 3VEBA 3QOQA 1BDTA 2EFLA 2KELA 4NRUA 1HTYA 3BVTA 2GPEA 4HYBA 2ZXQA 2D4CA 3OD2A 1BDVA 1SUFA 3OWGA 1BAZA 2X3WA 1R34A 2X5CA 1I4LA 3UR0A 2F1AA 1X93A 1OA1A 2BJ3A 3O3MB 5FIGA 2AY0A 2CAJA 4EZPA 1SU6A 1E1DA 1SU8A 1NLAA 3EJQA 2JXHA 2YL8A 1DKYA 3D51A 3QE6A 1UPXA 2OZNB 2JBVA 1SIWA 3B51X 3BVUA 2K1OA 3RV1A 2RAKA 1QTGA 2ELBA 3DPOA 2FYVA 3EJRA 2BNZA 2YL9A 3DYTA 2CADA 2H1OE 4FM3A 2EWFA 4HR1B 3FMTA 2RAJA 4EZZA 2WINM 2K5JA 4KIKA 2F7QA 2Q13A 1ZWWA 1OG7A 2PMRA 4FZPA 4EZTA 3I39X 3BUDA 2WVCA 4AZHA 3QNIA 3D4ZA 3EJPA 4WPEA 2X3XA 1MYKA 3ER8C 1OA0A 1QX1A 3D4YA 4EZXA 1PARA 4JL9A 1IRQA 3BUQA 4D8JA 2BNWA 2X3VA 3QWEA 4IW0A 4JWIA 3KAWA 2UUWA 3SYVA 3DX1A 1EA4A 3VEAA 2YIVX 3I2WA 3ZEDA 1P94A 4R5LA 3H5YA 3NO7A 2NCZA 5C5BA 1SH0A 1PS3A 4R5KA 1QWUA 4B9QA 3BVWA 2HZAA 3I04A 3G5OA 4NPHA 1ARRA 3OK8A 3D2EA 3CZSA 3D2FA 2GA9D 3CKDA 2PY6A 4HY9A 3SOGA 3BLBA 4I1QA 3FD9A 4LQ9A 3DX2A 3DDFA 2WVBA 3UQSA 4IWQA 3G9GA 4EZRA 4HR1A 3QA8A 3BUPA 2RT6A 3H5XA 4AZCA 1X04A 2BJ7A 2RAIA 3BVXA 2B43A 2KOEA 4WPCA 5C5BB 2JNSA 3EJSA 1TQUA 3LVTA 1QWNA 2WYHA 3LGHA 4AKVA 2YIBA 3B53X 2Q2KA 3T48A 4JNFA 3QNJA 3O3OB 4HV0A 3ERCC 2F18A 2YLAA 4EZVA 4DYLA 2ADLA 4EZNA 1TQWA 2H3AA 3D50A 3CAZA 4LRVA 4JNEA 1O7DC 2GAFD 2BJ8A 2AN7A 4LQ3A 4AZBA 1I49A 3BSNA 2OW7A 4JWDA 3SFUA 3ABHA 3KAVA 3Q84A 2YL5A 4AZCB 2LXYA 2FICA 3GXQA 3LJPA 2F7PA 2KHOA 2OW6A 4FZOA 3T46A 1R5EA 1OHNA 4BNEA 2QFFA 2JXGA 1ARQA 1DKXA 1SU7A 2K9IA 1B28A 2OBLA 4E3CA 3CZNA 3BSOA 4G6QA 1Y2OA 4JWCA 4R5GA 4PO2A 2Z8YA 4R5IA 1GN9A 1URUA 3HAHA 1SH3A 1HWWA 3VW4A 3T4AG 4IM0A 2F7RA 4AZ7A 1MJGA 5TKYA 4EZWA 1JQKA 4AZGA 1GNLA 1U00A 3BUBA 3D52A 1MYLA 1U9PA 4MJWA 2CKWA 3QIDA 4AZ5A 2CA9A 1DKZA 3F7WA 3SFGA 2Z0VA 2ALWA 1X03A 4IWOA 4JLCA 2YI8A 4JWEA 3RPMA 3LLLA 3LMFA 1HXKA 4H6IA 2A2BA 1OAOA 4F01A 1I4DA 3NAIA 2WYIA 3A98A 3EJUA 5E84A 4AZ6A 3FT7A 4NQIA 2K29A 3UITA 4F00A 5KBPA 2F1BA 2EFKA 2F7OA 3DX0A 3IR7A 4NSWA 3DPPA 4AZIA 4EZSA 2Z0OA 2Q12A 1TQVA 2YI9A 1TQSA 1O7DB 1E9VA 2RBFA 4EZQA 3T49A 2N3KA 4AVMA 1Q16A 4H8SA 2CAXA 2JXIA 1WDZA 4FZSA 3HAIA 4H6HA 4IM3A 2WK4A 1W9MA 2BJ1A 3VKHA 1SH2A 3ACOA 3DPQA 2V0OA 1MNTA 2OO2A 2WVEA 3T47A 3DX3A 4O4RA 4FXEA 1TQTA 4DCNC 2ND0A 1Q5VA 2YL6A 1R33A 3CVRA 3HAJA 3L3OM 3BUIA 2ND1A 3EJTA 1B01A 2WVDA 1E2UA 3OHXM 4EZUA 2D1LA 3DX4A 3I01A 3RV0A 2MI7A 4IM2A 2OBMA 3BVVA 3NNEA 4ME7E 3GI7A 3B52X 4EZYA 4E81A 4JN4A 4AAIA 2QXLA 4IWPA 3PLTA 4NRTA 3M3WA 3Q0KA 1I4TA 2JNKA 3KDRA 2EX3B 2UUTA 3L3PA 1YWMA 3UPFA 4M0MA 3C7NA
chains in the Genus database with same CATH topology
4EZTA 3I39X 2LM0A 3O3NB 4EZNA 3UITA 2YIAA 2WVCA 4F00A 2BA3A 2BJ9A 2WVFA 4JNEA 4UDXX 2GAFD 2BJ8A 3DPPA 4EZSA 1MYKA 3ER8C 5FLEX 4KIKB 4JWDA 2CPGA 2YI9A 1OA0A 2K6LA 3KAVA 3ER9B 4EZXA 1PARA 4JL9A 1IRQA 4UDYX 3H87C 1E9VA 4D8JA 2BNWA 2RBFA 2HZVA 4EZQA 3GXQA 4IW0A 3T49A 4EZOA 4JWIA 2N3KA 2KHOA 2BSQE 4R5JA 1GNTA 1ZYLA 3KAWA 1EA4A 3VEBA 3VEAA 2CAXA 3T46A 2JXIA 3QOQA 2YIVX 3ZEDA 2QFFA 4H6HA 2JXGA 4IM3A 1ARQA 1BDTA 1P94A 2KELA 1DKXA 2K9IA 1B28A 1SU7A 1W9MA 2BJ1A 4R5LA 2GPEA 2NCZA 3VKHA 4HYBA 2OBLA 4E3CA 4R5KA 3OD2A 4G6QA 4JWCA 1BDVA 1SUFA 3OWGA 2HZAA 4R5GA 1BAZA 4B9QA 4EZVA 4PO2A 3DPQA 1MNTA 3I04A 2X5CA 2Z8YA 4NPHA 1ARRA 4R5IA 1X93A 2WVEA 1GN9A 3T47A 4FXEA 2ND0A 3D2EA 1Q5VA 3L3OM 1OA1A 2GA9D 3D2FA 3VW4A 2BJ3A 2ND1A 3O3MB 3T4AG 4IM0A 2PY6A 1B01A 4HY9A 5FIGA 2AY0A 2WVDA 1E2UA 3FD9A 3OHXM 2CAJA 4EZPA 4EZUA 1SU6A 2WVBA 1E1DA 1SU8A 1NLAA 3I01A 3RV0A 2JXHA 4IM2A 1MJGA 2OBMA 1DKYA 4IWQA 1UPXA 5TKYA 4EZRA 4HR1A 4EZWA 1JQKA 3QA8A 2RT6A 3B51X 1GNLA 1U00A 1MYLA 2K1OA 1U9PA 2BJ7A 4ME7E 3RV1A 1QTGA 3GI7A 2CA9A 1DKZA 3DPOA 3B52X 3F7WA 4EZYA 2BNZA 4E81A 4JN4A 4IWOA 4JLCA 2YI8A 2QXLA 2JNSA 4IWPA 2CADA 4JWEA 2H1OE 4FM3A 3LGHA 2YIBA 3B53X 2EWFA 4HR1B 3LMFA 3FMTA 4EZZA 2WINM 2K5JA 3T48A 4JNFA 4KIKA 3QNJA 3KDRA 4H6IA 2EX3B 1OAOA 4F01A 3O3OB 3A98A 4HV0A 3ERCC 4M0MA 5E84A 3FT7A 2K29A 3C7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FXE A;  2BJ7 A;  4ME7 E;  1Q5V A;  2BSQ E;  1QTG A;  2WVC A;  2BA3 A;  2CA9 A;  3VW4 A;  2BJ3 A;  1EA4 A;  3VEB A;  3VEA A;  1MYL A;  2CAX A;  2JXI A;  2BJ9 A;  3QOQ A;  1B01 A;  2BNZ A;  2AY0 A;  2WVF A;  2WVD A;  2JXG A;  1ARQ A;  1BDT A;  2CAJ A;  1P94 A;  2BJ8 A;  2KEL A;  2K9I A;  1MYK A;  1B28 A;  2BJ1 A;  2CAD A;  2WVB A;  2GPE A;  2K1O A;  2H1O E;  1NLA A;  3LGH A;  2CPG A;  2JXH A;  2K6L A;  3OD2 A;  3FMT A;  1BDV A;  1PAR A;  2HZA A;  1IRQ A;  1BAZ A;  2K5J A;  1MNT A;  3H87 C;  4D8J A;  2BNW A;  1ARR A;  4HV0 A;  2RBF A;  1X93 A;  2WVE A;  3FT7 A;  3GXQ A;  2HZV A;  2K29 A;  1U9P A; 
#chains in the Genus database with same CATH topology
 2LM0 A;  3O3N B;  2YIA A;  2BA3 A;  3NAH A;  2BJ9 A;  2GF4 A;  3CV5 A;  3DDG A;  2WVF A;  2YLL A;  4UDX X;  2YKT A;  2C08 A;  4QPX A;  5FLE X;  4KIK B;  2CPG A;  2KKE A;  2Z0N A;  2K6L A;  3ER9 B;  4UDY X;  3H87 C;  2QKW A;  4ATM A;  2HZV A;  4EZO A;  2O0I 1;  2BSQ E;  4R5J A;  1GNT A;  1LQ7 A;  1ZYL A;  3VEB A;  3QOQ A;  1BDT A;  2EFL A;  2KEL A;  4NRU A;  1HTY A;  3BVT A;  2GPE A;  4HYB A;  2ZXQ A;  2D4C A;  3OD2 A;  1BDV A;  1SUF A;  3OWG A;  1BAZ A;  2X3W A;  1R34 A;  2X5C A;  1I4L A;  3UR0 A;  2F1A A;  1X93 A;  1OA1 A;  2BJ3 A;  3O3M B;  5FIG A;  2AY0 A;  2CAJ A;  4EZP A;  1SU6 A;  1E1D A;  1SU8 A;  1NLA A;  3EJQ A;  2JXH A;  2YL8 A;  1DKY A;  3D51 A;  3QE6 A;  1UPX A;  2OZN B;  2JBV A;  1SIW A;  3B51 X;  3BVU A;  2K1O A;  3RV1 A;  2RAK A;  1QTG A;  2ELB A;  3DPO A;  2FYV A;  3EJR A;  2BNZ A;  2YL9 A;  3DYT A;  2CAD A;  2H1O E;  4FM3 A;  2EWF A;  4HR1 B;  3FMT A;  2RAJ A;  4EZZ A;  2WIN M;  2K5J A;  4KIK A;  2F7Q A;  2Q13 A;  1ZWW A;  1OG7 A;  2PMR A;  4FZP A;  4EZT A;  3I39 X;  3BUD A;  2WVC A;  4AZH A;  3QNI A;  3D4Z A;  3EJP A;  4WPE A;  2X3X A;  1MYK A;  3ER8 C;  1OA0 A;  1QX1 A;  3D4Y A;  4EZX A;  1PAR A;  4JL9 A;  1IRQ A;  3BUQ A;  4D8J A;  2BNW A;  2X3V A;  3QWE A;  4IW0 A;  4JWI A;  3KAW A;  2UUW A;  3SYV A;  3DX1 A;  1EA4 A;  3VEA A;  2YIV X;  3I2W A;  3ZED A;  1P94 A;  4R5L A;  3H5Y A;  3NO7 A;  2NCZ A;  5C5B A;  1SH0 A;  1PS3 A;  4R5K A;  1QWU A;  4B9Q A;  3BVW A;  2HZA A;  3I04 A;  3G5O A;  4NPH A;  1ARR A;  3OK8 A;  3D2E A;  3CZS A;  3D2F A;  2GA9 D;  3CKD A;  2PY6 A;  4HY9 A;  3SOG A;  3BLB A;  4I1Q A;  3FD9 A;  4LQ9 A;  3DX2 A;  3DDF A;  2WVB A;  3UQS A;  4IWQ A;  3G9G A;  4EZR A;  4HR1 A;  3QA8 A;  3BUP A;  2RT6 A;  3H5X A;  4AZC A;  1X04 A;  2BJ7 A;  2RAI A;  3BVX A;  2B43 A;  2KOE A;  4WPC A;  5C5B B;  2JNS A;  3EJS A;  1TQU A;  3LVT A;  1QWN A;  2WYH A;  3LGH A;  4AKV A;  2YIB A;  3B53 X;  2Q2K A;  3T48 A;  4JNF A;  3QNJ A;  3O3O B;  4HV0 A;  3ERC C;  2F18 A;  2YLA A;  4EZV A;  4DYL A;  2ADL A;  4EZN A;  1TQW A;  2H3A A;  3D50 A;  3CAZ A;  4LRV A;  4JNE A;  1O7D C;  2GAF D;  2BJ8 A;  2AN7 A;  4LQ3 A;  4AZB A;  1I49 A;  3BSN A;  2OW7 A;  4JWD A;  3SFU A;  3ABH A;  3KAV A;  3Q84 A;  2YL5 A;  4AZC B;  2LXY A;  2FIC A;  3GXQ A;  3LJP A;  2F7P A;  2KHO A;  2OW6 A;  4FZO A;  3T46 A;  1R5E A;  1OHN A;  4BNE A;  2QFF A;  2JXG A;  1ARQ A;  1DKX A;  1SU7 A;  2K9I A;  1B28 A;  2OBL A;  4E3C A;  3CZN A;  3BSO A;  4G6Q A;  1Y2O A;  4JWC A;  4R5G A;  4PO2 A;  2Z8Y A;  4R5I A;  1GN9 A;  1URU A;  3HAH A;  1SH3 A;  1HWW A;  3VW4 A;  3T4A G;  4IM0 A;  2F7R A;  4AZ7 A;  1MJG A;  5TKY A;  4EZW A;  1JQK A;  4AZG A;  1GNL A;  1U00 A;  3BUB A;  3D52 A;  1MYL A;  1U9P A;  4MJW A;  2CKW A;  3QID A;  4AZ5 A;  2CA9 A;  1DKZ A;  3F7W A;  3SFG A;  2Z0V A;  2ALW A;  1X03 A;  4IWO A;  4JLC A;  2YI8 A;  4JWE A;  3RPM A;  3LLL A;  3LMF A;  1HXK A;  4H6I A;  2A2B A;  1OAO A;  4F01 A;  1I4D A;  3NAI A;  2WYI A;  3A98 A;  3EJU A;  5E84 A;  4AZ6 A;  3FT7 A;  4NQI A;  2K29 A;  3UIT A;  4F00 A;  5KBP A;  2F1B A;  2EFK A;  2F7O A;  3DX0 A;  3IR7 A;  4NSW A;  3DPP A;  4AZI A;  4EZS A;  2Z0O A;  2Q12 A;  1TQV A;  2YI9 A;  1TQS A;  1O7D B;  1E9V A;  2RBF A;  4EZQ A;  3T49 A;  2N3K A;  4AVM A;  1Q16 A;  4H8S A;  2CAX A;  2JXI A;  1WDZ A;  4FZS A;  3HAI A;  4H6H A;  4IM3 A;  2WK4 A;  1W9M A;  2BJ1 A;  3VKH A;  1SH2 A;  3ACO A;  3DPQ A;  2V0O A;  1MNT A;  2OO2 A;  2WVE A;  3T47 A;  3DX3 A;  4O4R A;  4FXE A;  1TQT A;  4DCN C;  2ND0 A;  1Q5V A;  2YL6 A;  1R33 A;  3CVR A;  3HAJ A;  3L3O M;  3BUI A;  2ND1 A;  3EJT A;  1B01 A;  2WVD A;  1E2U A;  3OHX M;  4EZU A;  2D1L A;  3DX4 A;  3I01 A;  3RV0 A;  2MI7 A;  4IM2 A;  2OBM A;  3BVV A;  3NNE A;  4ME7 E;  3GI7 A;  3B52 X;  4EZY A;  4E81 A;  4JN4 A;  4AAI A;  2QXL A;  4IWP A;  3PLT A;  4NRT A;  3M3W A;  3Q0K A;  1I4T A;  2JNK A;  3KDR A;  2EX3 B;  2UUT A;  3L3P A;  1YWM A;  3UPF A;  4M0M A;  3C7N A; 
#chains in the Genus database with same CATH homology
 4EZT A;  3I39 X;  2LM0 A;  3O3N B;  4EZN A;  3UIT A;  2YIA A;  2WVC A;  4F00 A;  2BA3 A;  2BJ9 A;  2WVF A;  4JNE A;  4UDX X;  2GAF D;  2BJ8 A;  3DPP A;  4EZS A;  1MYK A;  3ER8 C;  5FLE X;  4KIK B;  4JWD A;  2CPG A;  2YI9 A;  1OA0 A;  2K6L A;  3KAV A;  3ER9 B;  4EZX A;  1PAR A;  4JL9 A;  1IRQ A;  4UDY X;  3H87 C;  1E9V A;  4D8J A;  2BNW A;  2RBF A;  2HZV A;  4EZQ A;  3GXQ A;  4IW0 A;  3T49 A;  4EZO A;  4JWI A;  2N3K A;  2KHO A;  2BSQ E;  4R5J A;  1GNT A;  1ZYL A;  3KAW A;  1EA4 A;  3VEB A;  3VEA A;  2CAX A;  3T46 A;  2JXI A;  3QOQ A;  2YIV X;  3ZED A;  2QFF A;  4H6H A;  2JXG A;  4IM3 A;  1ARQ A;  1BDT A;  1P94 A;  2KEL A;  1DKX A;  2K9I A;  1B28 A;  1SU7 A;  1W9M A;  2BJ1 A;  4R5L A;  2GPE A;  2NCZ A;  3VKH A;  4HYB A;  2OBL A;  4E3C A;  4R5K A;  3OD2 A;  4G6Q A;  4JWC A;  1BDV A;  1SUF A;  3OWG A;  2HZA A;  4R5G A;  1BAZ A;  4B9Q A;  4EZV A;  4PO2 A;  3DPQ A;  1MNT A;  3I04 A;  2X5C A;  2Z8Y A;  4NPH A;  1ARR A;  4R5I A;  1X93 A;  2WVE A;  1GN9 A;  3T47 A;  4FXE A;  2ND0 A;  3D2E A;  1Q5V A;  3L3O M;  1OA1 A;  2GA9 D;  3D2F A;  3VW4 A;  2BJ3 A;  2ND1 A;  3O3M B;  3T4A G;  4IM0 A;  2PY6 A;  1B01 A;  4HY9 A;  5FIG A;  2AY0 A;  2WVD A;  1E2U A;  3FD9 A;  3OHX M;  2CAJ A;  4EZP A;  4EZU A;  1SU6 A;  2WVB A;  1E1D A;  1SU8 A;  1NLA A;  3I01 A;  3RV0 A;  2JXH A;  4IM2 A;  1MJG A;  2OBM A;  1DKY A;  4IWQ A;  1UPX A;  5TKY A;  4EZR A;  4HR1 A;  4EZW A;  1JQK A;  3QA8 A;  2RT6 A;  3B51 X;  1GNL A;  1U00 A;  1MYL A;  2K1O A;  1U9P A;  2BJ7 A;  4ME7 E;  3RV1 A;  1QTG A;  3GI7 A;  2CA9 A;  1DKZ A;  3DPO A;  3B52 X;  3F7W A;  4EZY A;  2BNZ A;  4E81 A;  4JN4 A;  4IWO A;  4JLC A;  2YI8 A;  2QXL A;  2JNS A;  4IWP A;  2CAD A;  4JWE A;  2H1O E;  4FM3 A;  3LGH A;  2YIB A;  3B53 X;  2EWF A;  4HR1 B;  3LMF A;  3FMT A;  4EZZ A;  2WIN M;  2K5J A;  3T48 A;  4JNF A;  4KIK A;  3QNJ A;  3KDR A;  4H6I A;  2EX3 B;  1OAO A;  4F01 A;  3O3O B;  3A98 A;  4HV0 A;  3ERC C;  4M0M A;  5E84 A;  3FT7 A;  2K29 A;  3C7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...