3VEAA

Crystal structure of matp-mats23mer
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
MKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Macrodomain Ter protein
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3veaA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3veaA01
2CA9A 3GXQA 2JXIA 4FXEA 2BJ7A 2K9IA 2BA3A 2BNWA 1MNTA 1Q5VA 1MYLA 1BAZA 2JXHA 1P94A 4HV0A 2WVEA 2K6LA 2K1OA 1ARQA 2BNZA 2WVBA 2HZAA 1EA4A 2WVCA 3VW4A 2CAJA 4D8JA 2HZVA 1QTGA 1X93A 3FT7A 2H1OE 2K29A 1BDTA 2BJ9A 2GPEA 1MYKA 2BJ3A 3FMTA 1B01A 1PARA 1B28A 2WVFA 1NLAA 3OD2A 4ME7E 2CADA 3VEBA 2RBFA 2BSQE 2CPGA 2AY0A 1ARRA 2BJ1A 2BJ8A 2KELA 2WVDA 3H87C 3LGHA 3VEAA 3QOQA 1IRQA 2CAXA 2K5JA 1U9PA 1BDVA 2JXGA
chains in the Genus database with same CATH superfamily
3HAJA 3BLBA 2JBVA 2Z0OA 3D52A 1R33A 4EZUA 2EFKA 4BNEA 3HAIA 2WVCA 2K29A 1BDTA 2ADLA 3LMFA 3VEAA 2D1LA 5C5BA 1UPXA 4FZPA 2QFFA 4AZBA 4AZ7A 2GAFD 1R34A 2YI8A 4G6QA 1E2UA 2FYVA 4EZQA 1MYKA 3LJPA 1NLAA 2OBLA 4QPXA 4NRUA 3CVRA 3D4YA 4IM0A 2CPGA 1ARRA 1BDVA 2H3AA 4PO2A 2LM0A 3D51A 2Z0VA 3BVXA 3I04A 4EZTA 3EJPA 3QNJA 3CZNA 2BNZA 2C08A 1ZYLA 2ELBA 4NPHA 2YL9A 3B53X 2BJ3A 3SFGA 4IM2A 4AZ6A 2NCZA 4I1QA 3H87C 2RAJA 2YI9A 4DYLA 1URUA 3RPMA 1DKYA 2Z8YA 3QIDA 1OHNA 2EFLA 2F7PA 3I2WA 4F00A 1ZWWA 2O0I1 2K1OA 4B9QA 1Q16A 4IW0A 1OA1A 4AZCA 4KIKB 1QTGA 2H1OE 3Q0KA 4AZGA 2ZXQA 1QWUA 2B43A 4AVMA 3DDFA 4F01A 2BA3A 4IWPA 3L3PA 1HWWA 1I4DA 2ND1A 2YLAA 4HR1B 4AKVA 2F1BA 1SU7A 3O3NB 2WVFA 2YIBA 3QE6A 1I4LA 3ZEDA 3QOQA 3BUBA 2Z0NA 4HV0A 5KBPA 2F7OA 1TQSA 2N3KA 1JQKA 3DYTA 3BVVA 3DX0A 4EZPA 3SFUA 4AZHA 3NAHA 5C5BB 3D4ZA 2WVDA 2WYIA 2JXGA 3DPPA 2OZNB 4R5LA 4AZIA 2OW7A 4E81A 2X5CA 3H5XA 4H6IA 3KAVA 4MJWA 1OA0A 2KOEA 1HTYA 3ER8C 1EA4A 2F1AA 3ABHA 3SYVA 4ME7E 1TQVA 4E3CA 4EZXA 4UDYX 3I01A 3C7NA 4NSWA 4H6HA 2OO2A 3H5YA 1GN9A 3BVWA 2GF4A 4M0MA 1X04A 2RAKA 2A2BA 2UUWA 3UR0A 2YLLA 3EJTA 4ATMA 2YIAA 4WPEA 2GPEA 1B01A 2YIVX 4LRVA 3QWEA 3VEBA 4IWOA 3G5OA 3RV0A 4LQ3A 3F7WA 3LGHA 5FLEX 3EJUA 2ALWA 3EJRA 3B51X 1X03A 1BAZA 1MJGA 3M3WA 3OK8A 3Q84A 3I39X 4AZCB 3DX2A 1QX1A 3OHXM 2YL6A 1I49A 2Q2KA 3DX4A 3T46A 1B28A 3BSOA 2EWFA 2LXYA 5E84A 1SH0A 3DDGA 1TQWA 2X3XA 4JLCA 3G9GA 2YL8A 1O7DC 1MYLA 2Q13A 3FD9A 1P94A 4EZNA 4EZRA 3D50A 1OAOA 2OW6A 3BVTA 3QA8A 4WPCA 3UITA 3NAIA 5FIGA 1O7DB 1QWNA 4FM3A 2QKWA 1GNLA 1E9VA 3SOGA 3DPQA 4JNFA 1HXKA 1E1DA 4FZOA 4FXEA 2BJ7A 3O3MB 4R5JA 2BNWA 1OG7A 3OWGA 3BSNA 4HY9A 5TKYA 3DX1A 2HZAA 2PY6A 4D8JA 1DKZA 3BUPA 4H8SA 3CAZA 3D2FA 2UUTA 4HYBA 3CV5A 3NNEA 3OD2A 1I4TA 1Y2OA 3T47A 2KELA 2CAXA 4EZWA 4NRTA 4FZSA 1SUFA 4AAIA 3GXQA 1SIWA 4O4RA 1PS3A 1TQUA 1Q5VA 1TQTA 3A98A 2K6LA 2OBMA 1YWMA 2D4CA 2YL5A 2HZVA 4UDXX 1X93A 1SH3A 3FMTA 3EJQA 3KAWA 3NO7A 4IWQA 3BVUA 4R5KA 2BSQE 1DKXA 3T49A 2AY0A 2BJ8A 4EZYA 2RT6A 2K5JA 1U9PA 4AZ5A 2Q12A 2GA9D 2AN7A 4JWCA 4JN4A 4JWIA 1WDZA 3T4AG 2X3VA 2RAIA 3LLLA 4JL9A 4JWDA 3FT7A 2F18A 2X3WA 3L3OM 3IR7A 2MI7A 3EJSA 2BJ1A 2JNSA 4R5GA 1SU8A 3CZSA 2CA9A 1W9MA 3BUIA 4LQ9A 2WINM 4JWEA 1MNTA 3ERCC 4DCNC 3KDRA 2WVEA 1ARQA 3RV1A 3T48A 3O3OB 2QXLA 2JNKA 3BUQA 2F7RA 2BJ9A 1GNTA 2F7QA 2WYHA 2RBFA 3VKHA 4EZOA 2WK4A 2FICA 2K9IA 2EX3B 1SU6A 3GI7A 2JXHA 1LQ7A 2ND0A 3D2EA 2KKEA 2CKWA 3UQSA 2CAJA 3VW4A 3HAHA 4NQIA 3UPFA 4KIKA 1PARA 3QNIA 4R5IA 2CADA 2KHOA 1IRQA 2PMRA 4IM3A 4JNEA 2JXIA 3DX3A 3CKDA 4EZZA 4EZSA 3B52X 3ER9B 2WVBA 3BUDA 4HR1A 4EZVA 3DPOA 1U00A 1SH2A 3ACOA 3PLTA 3LVTA 1R5EA 2YKTA 2V0OA
chains in the Genus database with same CATH topology
4F01A 2BA3A 3B51X 4IWPA 1BAZA 2GA9D 1MJGA 4JWCA 4JN4A 4EZUA 4JWIA 2ND1A 3I39X 3T4AG 4HR1B 3OHXM 2WVCA 4JL9A 4JWDA 3FT7A 2K29A 1BDTA 1SU7A 3T46A 3O3NB 1B28A 2WVFA 3L3OM 2YIBA 2EWFA 3LMFA 5E84A 3VEAA 2BJ1A 2JNSA 4R5GA 3ZEDA 1UPXA 3QOQA 4JLCA 1SU8A 2QFFA 2CA9A 1W9MA 2WINM 4JWEA 2GAFD 1MNTA 1MYLA 3FD9A 3ERCC 1P94A 4HV0A 3KDRA 4EZNA 2WVEA 1ARQA 2N3KA 2YI8A 3RV1A 3T48A 4EZRA 4G6QA 1JQKA 1E2UA 3O3OB 1OAOA 3QA8A 3UITA 5FIGA 2QXLA 4EZQA 2BJ9A 1MYKA 1GNTA 4FM3A 2RT6A 4EZPA 1GNLA 1NLAA 2OBLA 1E9VA 2RBFA 4IM0A 3DPQA 3VKHA 2CPGA 4JNFA 1ARRA 2WVDA 4EZOA 1BDVA 2JXGA 3DPPA 1E1DA 4R5LA 4E81A 4PO2A 4FXEA 2BJ7A 2K9IA 2EX3B 2X5CA 3O3MB 4H6IA 1SU6A 2BNWA 2LM0A 3GI7A 4R5JA 2JXHA 3KAVA 2ND0A 3OWGA 4EZTA 3I04A 4HY9A 1OA0A 3QNJA 3D2EA 5TKYA 3ER8C 2BNZA 2HZAA 1EA4A 2PY6A 3VW4A 2CAJA 4D8JA 1DKZA 1ZYLA 4NPHA 3D2FA 4KIKA 1PARA 3B53X 2BJ3A 4HYBA 3OD2A 4IM2A 4ME7E 2CADA 4R5IA 2NCZA 4E3CA 4EZXA 2KHOA 4UDYX 3T47A 2KELA 3H87C 3I01A 2YI9A 1IRQA 2CAXA 3C7NA 4EZWA 4H6HA 4IM3A 1SUFA 3GXQA 1DKYA 2Z8YA 4JNEA 2JXIA 1Q5VA 1GN9A 4F00A 4M0MA 4EZZA 3A98A 2K6LA 2K1OA 2OBMA 4EZSA 4B9QA 3B52X 3ER9B 2WVBA 4IW0A 1OA1A 2HZVA 4KIKB 4HR1A 1QTGA 1X93A 4UDXX 2YIAA 2H1OE 4EZVA 2GPEA 1B01A 3FMTA 2YIVX 3DPOA 1U00A 3VEBA 3KAWA 4IWOA 4IWQA 4R5KA 3RV0A 2BSQE 1DKXA 3T49A 2AY0A 3F7WA 2BJ8A 3LGHA 4EZYA 5FLEX 2K5JA 1U9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CA9 A;  3GXQ A;  2JXI A;  4FXE A;  2BJ7 A;  2K9I A;  2BA3 A;  2BNW A;  1MNT A;  1Q5V A;  1MYL A;  1BAZ A;  2JXH A;  1P94 A;  4HV0 A;  2WVE A;  2K6L A;  2K1O A;  1ARQ A;  2BNZ A;  2WVB A;  2HZA A;  1EA4 A;  2WVC A;  3VW4 A;  2CAJ A;  4D8J A;  2HZV A;  1QTG A;  1X93 A;  3FT7 A;  2H1O E;  2K29 A;  1BDT A;  2BJ9 A;  2GPE A;  1MYK A;  2BJ3 A;  3FMT A;  1B01 A;  1PAR A;  1B28 A;  2WVF A;  1NLA A;  3OD2 A;  4ME7 E;  2CAD A;  3VEB A;  2RBF A;  2BSQ E;  2CPG A;  2AY0 A;  1ARR A;  2BJ1 A;  2BJ8 A;  2KEL A;  2WVD A;  3H87 C;  3LGH A;  3VEA A;  3QOQ A;  1IRQ A;  2CAX A;  2K5J A;  1U9P A;  1BDV A;  2JXG A; 
#chains in the Genus database with same CATH topology
 3HAJ A;  3BLB A;  2JBV A;  2Z0O A;  3D52 A;  1R33 A;  4EZU A;  2EFK A;  4BNE A;  3HAI A;  2WVC A;  2K29 A;  1BDT A;  2ADL A;  3LMF A;  3VEA A;  2D1L A;  5C5B A;  1UPX A;  4FZP A;  2QFF A;  4AZB A;  4AZ7 A;  2GAF D;  1R34 A;  2YI8 A;  4G6Q A;  1E2U A;  2FYV A;  4EZQ A;  1MYK A;  3LJP A;  1NLA A;  2OBL A;  4QPX A;  4NRU A;  3CVR A;  3D4Y A;  4IM0 A;  2CPG A;  1ARR A;  1BDV A;  2H3A A;  4PO2 A;  2LM0 A;  3D51 A;  2Z0V A;  3BVX A;  3I04 A;  4EZT A;  3EJP A;  3QNJ A;  3CZN A;  2BNZ A;  2C08 A;  1ZYL A;  2ELB A;  4NPH A;  2YL9 A;  3B53 X;  2BJ3 A;  3SFG A;  4IM2 A;  4AZ6 A;  2NCZ A;  4I1Q A;  3H87 C;  2RAJ A;  2YI9 A;  4DYL A;  1URU A;  3RPM A;  1DKY A;  2Z8Y A;  3QID A;  1OHN A;  2EFL A;  2F7P A;  3I2W A;  4F00 A;  1ZWW A;  2O0I 1;  2K1O A;  4B9Q A;  1Q16 A;  4IW0 A;  1OA1 A;  4AZC A;  4KIK B;  1QTG A;  2H1O E;  3Q0K A;  4AZG A;  2ZXQ A;  1QWU A;  2B43 A;  4AVM A;  3DDF A;  4F01 A;  2BA3 A;  4IWP A;  3L3P A;  1HWW A;  1I4D A;  2ND1 A;  2YLA A;  4HR1 B;  4AKV A;  2F1B A;  1SU7 A;  3O3N B;  2WVF A;  2YIB A;  3QE6 A;  1I4L A;  3ZED A;  3QOQ A;  3BUB A;  2Z0N A;  4HV0 A;  5KBP A;  2F7O A;  1TQS A;  2N3K A;  1JQK A;  3DYT A;  3BVV A;  3DX0 A;  4EZP A;  3SFU A;  4AZH A;  3NAH A;  5C5B B;  3D4Z A;  2WVD A;  2WYI A;  2JXG A;  3DPP A;  2OZN B;  4R5L A;  4AZI A;  2OW7 A;  4E81 A;  2X5C A;  3H5X A;  4H6I A;  3KAV A;  4MJW A;  1OA0 A;  2KOE A;  1HTY A;  3ER8 C;  1EA4 A;  2F1A A;  3ABH A;  3SYV A;  4ME7 E;  1TQV A;  4E3C A;  4EZX A;  4UDY X;  3I01 A;  3C7N A;  4NSW A;  4H6H A;  2OO2 A;  3H5Y A;  1GN9 A;  3BVW A;  2GF4 A;  4M0M A;  1X04 A;  2RAK A;  2A2B A;  2UUW A;  3UR0 A;  2YLL A;  3EJT A;  4ATM A;  2YIA A;  4WPE A;  2GPE A;  1B01 A;  2YIV X;  4LRV A;  3QWE A;  3VEB A;  4IWO A;  3G5O A;  3RV0 A;  4LQ3 A;  3F7W A;  3LGH A;  5FLE X;  3EJU A;  2ALW A;  3EJR A;  3B51 X;  1X03 A;  1BAZ A;  1MJG A;  3M3W A;  3OK8 A;  3Q84 A;  3I39 X;  4AZC B;  3DX2 A;  1QX1 A;  3OHX M;  2YL6 A;  1I49 A;  2Q2K A;  3DX4 A;  3T46 A;  1B28 A;  3BSO A;  2EWF A;  2LXY A;  5E84 A;  1SH0 A;  3DDG A;  1TQW A;  2X3X A;  4JLC A;  3G9G A;  2YL8 A;  1O7D C;  1MYL A;  2Q13 A;  3FD9 A;  1P94 A;  4EZN A;  4EZR A;  3D50 A;  1OAO A;  2OW6 A;  3BVT A;  3QA8 A;  4WPC A;  3UIT A;  3NAI A;  5FIG A;  1O7D B;  1QWN A;  4FM3 A;  2QKW A;  1GNL A;  1E9V A;  3SOG A;  3DPQ A;  4JNF A;  1HXK A;  1E1D A;  4FZO A;  4FXE A;  2BJ7 A;  3O3M B;  4R5J A;  2BNW A;  1OG7 A;  3OWG A;  3BSN A;  4HY9 A;  5TKY A;  3DX1 A;  2HZA A;  2PY6 A;  4D8J A;  1DKZ A;  3BUP A;  4H8S A;  3CAZ A;  3D2F A;  2UUT A;  4HYB A;  3CV5 A;  3NNE A;  3OD2 A;  1I4T A;  1Y2O A;  3T47 A;  2KEL A;  2CAX A;  4EZW A;  4NRT A;  4FZS A;  1SUF A;  4AAI A;  3GXQ A;  1SIW A;  4O4R A;  1PS3 A;  1TQU A;  1Q5V A;  1TQT A;  3A98 A;  2K6L A;  2OBM A;  1YWM A;  2D4C A;  2YL5 A;  2HZV A;  4UDX X;  1X93 A;  1SH3 A;  3FMT A;  3EJQ A;  3KAW A;  3NO7 A;  4IWQ A;  3BVU A;  4R5K A;  2BSQ E;  1DKX A;  3T49 A;  2AY0 A;  2BJ8 A;  4EZY A;  2RT6 A;  2K5J A;  1U9P A;  4AZ5 A;  2Q12 A;  2GA9 D;  2AN7 A;  4JWC A;  4JN4 A;  4JWI A;  1WDZ A;  3T4A G;  2X3V A;  2RAI A;  3LLL A;  4JL9 A;  4JWD A;  3FT7 A;  2F18 A;  2X3W A;  3L3O M;  3IR7 A;  2MI7 A;  3EJS A;  2BJ1 A;  2JNS A;  4R5G A;  1SU8 A;  3CZS A;  2CA9 A;  1W9M A;  3BUI A;  4LQ9 A;  2WIN M;  4JWE A;  1MNT A;  3ERC C;  4DCN C;  3KDR A;  2WVE A;  1ARQ A;  3RV1 A;  3T48 A;  3O3O B;  2QXL A;  2JNK A;  3BUQ A;  2F7R A;  2BJ9 A;  1GNT A;  2F7Q A;  2WYH A;  2RBF A;  3VKH A;  4EZO A;  2WK4 A;  2FIC A;  2K9I A;  2EX3 B;  1SU6 A;  3GI7 A;  2JXH A;  1LQ7 A;  2ND0 A;  3D2E A;  2KKE A;  2CKW A;  3UQS A;  2CAJ A;  3VW4 A;  3HAH A;  4NQI A;  3UPF A;  4KIK A;  1PAR A;  3QNI A;  4R5I A;  2CAD A;  2KHO A;  1IRQ A;  2PMR A;  4IM3 A;  4JNE A;  2JXI A;  3DX3 A;  3CKD A;  4EZZ A;  4EZS A;  3B52 X;  3ER9 B;  2WVB A;  3BUD A;  4HR1 A;  4EZV A;  3DPO A;  1U00 A;  1SH2 A;  3ACO A;  3PLT A;  3LVT A;  1R5E A;  2YKT A;  2V0O A; 
#chains in the Genus database with same CATH homology
 4F01 A;  2BA3 A;  3B51 X;  4IWP A;  1BAZ A;  2GA9 D;  1MJG A;  4JWC A;  4JN4 A;  4EZU A;  4JWI A;  2ND1 A;  3I39 X;  3T4A G;  4HR1 B;  3OHX M;  2WVC A;  4JL9 A;  4JWD A;  3FT7 A;  2K29 A;  1BDT A;  1SU7 A;  3T46 A;  3O3N B;  1B28 A;  2WVF A;  3L3O M;  2YIB A;  2EWF A;  3LMF A;  5E84 A;  3VEA A;  2BJ1 A;  2JNS A;  4R5G A;  3ZED A;  1UPX A;  3QOQ A;  4JLC A;  1SU8 A;  2QFF A;  2CA9 A;  1W9M A;  2WIN M;  4JWE A;  2GAF D;  1MNT A;  1MYL A;  3FD9 A;  3ERC C;  1P94 A;  4HV0 A;  3KDR A;  4EZN A;  2WVE A;  1ARQ A;  2N3K A;  2YI8 A;  3RV1 A;  3T48 A;  4EZR A;  4G6Q A;  1JQK A;  1E2U A;  3O3O B;  1OAO A;  3QA8 A;  3UIT A;  5FIG A;  2QXL A;  4EZQ A;  2BJ9 A;  1MYK A;  1GNT A;  4FM3 A;  2RT6 A;  4EZP A;  1GNL A;  1NLA A;  2OBL A;  1E9V A;  2RBF A;  4IM0 A;  3DPQ A;  3VKH A;  2CPG A;  4JNF A;  1ARR A;  2WVD A;  4EZO A;  1BDV A;  2JXG A;  3DPP A;  1E1D A;  4R5L A;  4E81 A;  4PO2 A;  4FXE A;  2BJ7 A;  2K9I A;  2EX3 B;  2X5C A;  3O3M B;  4H6I A;  1SU6 A;  2BNW A;  2LM0 A;  3GI7 A;  4R5J A;  2JXH A;  3KAV A;  2ND0 A;  3OWG A;  4EZT A;  3I04 A;  4HY9 A;  1OA0 A;  3QNJ A;  3D2E A;  5TKY A;  3ER8 C;  2BNZ A;  2HZA A;  1EA4 A;  2PY6 A;  3VW4 A;  2CAJ A;  4D8J A;  1DKZ A;  1ZYL A;  4NPH A;  3D2F A;  4KIK A;  1PAR A;  3B53 X;  2BJ3 A;  4HYB A;  3OD2 A;  4IM2 A;  4ME7 E;  2CAD A;  4R5I A;  2NCZ A;  4E3C A;  4EZX A;  2KHO A;  4UDY X;  3T47 A;  2KEL A;  3H87 C;  3I01 A;  2YI9 A;  1IRQ A;  2CAX A;  3C7N A;  4EZW A;  4H6H A;  4IM3 A;  1SUF A;  3GXQ A;  1DKY A;  2Z8Y A;  4JNE A;  2JXI A;  1Q5V A;  1GN9 A;  4F00 A;  4M0M A;  4EZZ A;  3A98 A;  2K6L A;  2K1O A;  2OBM A;  4EZS A;  4B9Q A;  3B52 X;  3ER9 B;  2WVB A;  4IW0 A;  1OA1 A;  2HZV A;  4KIK B;  4HR1 A;  1QTG A;  1X93 A;  4UDX X;  2YIA A;  2H1O E;  4EZV A;  2GPE A;  1B01 A;  3FMT A;  2YIV X;  3DPO A;  1U00 A;  3VEB A;  3KAW A;  4IWO A;  4IWQ A;  4R5K A;  3RV0 A;  2BSQ E;  1DKX A;  3T49 A;  2AY0 A;  3F7W A;  2BJ8 A;  3LGH A;  4EZY A;  5FLE X;  2K5J A;  1U9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...