3VEAA

Crystal structure of matp-mats23mer
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
b'MKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrodomain Ter protein
molecule tags Dna binding protein/dna
source organism Yersinia pestis
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3veaA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3veaA01
2BA3A 2K6LA 2CAJA 2HZAA 1X93A 3VEAA 2WVBA 1BAZA 2KELA 2WVEA 2WVFA 2K9IA 1EA4A 1U9PA 2K29A 2JXGA 2RBFA 2CAXA 3FMTA 1MYKA 2CA9A 2K1OA 2BJ3A 1MYLA 1BDTA 2H1OE 1PARA 4HV0A 2BJ1A 2WVDA 3LGHA 2CPGA 3VEBA 3OD2A 3GXQA 1BDVA 4ME7E 2JXHA 3FT7A 1ARRA 2CADA 1Q5VA 2BJ9A 1IRQA 1MNTA 2BSQE 1NLAA 2AY0A 3H87C 2BNZA 1QTGA 2HZVA 2K5JA 3VW4A 4D8JA 3QOQA 2JXIA 2BJ8A 2WVCA 4FXEA 2BNWA 1ARQA 2BJ7A 1B28A 2GPEA 1P94A 1B01A
chains in the Genus database with same CATH superfamily
1X03A 3PLTA 4JNFA 2YI9A 2EFLA 2Q13A 4IM2A 1I4LA 3GI7A 3Q84A 3BSNA 5KBPA 4JWCA 3T49A 1BDTA 3BUIA 4DYLA 2ND0A 2FICA 3ER9B 4B9QA 4M0MA 2F7OA 4F00A 1EA4A 2AN7A 2Z0OA 4EZNA 1MYLA 4UDYX 3DX4A 1QWUA 2O0I1 2RT6A 3B51X 4E3CA 3FD9A 3BVXA 1SH3A 2EWFA 2H3AA 2UUTA 1W9MA 1I4TA 3RPMA 2Z0VA 4EZZA 2WK4A 1OG7A 2B43A 2KELA 2YI8A 1SU6A 4IM0A 3F7WA 4G6QA 5TKYA 3VEBA 1TQUA 3D4YA 2OZNB 2CADA 2ALWA 4AVMA 4EZYA 1O7DC 4EZVA 4NQIA 3D51A 3OHXM 2K5JA 2YIBA 1OAOA 2WVCA 1ARQA 1DKXA 2GPEA 1E2UA 1OA0A 3UPFA 1U00A 3OWGA 2Z8YA 4HR1B 2YL5A 2CPGA 3GXQA 3T48A 2X5CA 4AZGA 4KIKB 2PY6A 1WDZA 2Q2KA 4O4RA 4FZSA 2UUWA 4AAIA 2OW7A 3LVTA 4NSWA 3NAIA 3IR7A 2NCZA 2JNSA 2FYVA 4AZCA 4R5KA 3B52X 4NRUA 2ZXQA 4F01A 3ZEDA 2GAFD 2QXLA 4JL9A 3OD2A 3BLBA 5FLEX 1BDVA 4IWOA 2X3VA 3FT7A 3O3OB 2BJ9A 4IWPA 4R5JA 3HAJA 2WYIA 2K6LA 4DCNC 4WPEA 3QWEA 3CV5A 3D50A 5FIGA 2JBVA 3BUDA 1OHNA 4EZWA 1PARA 4IW0A 3RV1A 3UITA 3EJRA 2KOEA 4NRTA 4D8JA 2WINM 2BNWA 4R5IA 1O7DB 2WYHA 3BVTA 2HZAA 4AZ7A 2F1AA 2YLLA 3SOGA 2F7QA 1UPXA 1Y2OA 2BJ3A 2ELBA 3ABHA 3C7NA 3BVWA 3CKDA 1I4DA 4HY9A 2PMRA 3QNJA 4H6IA 2F7PA 1SIWA 4EZSA 1LQ7A 4AZBA 2BSQE 2GF4A 2HZVA 1E9VA 3VW4A 3DX0A 3QNIA 4AZIA 2YL8A 4IWQA 3QA8A 2RAIA 4JWDA 3EJTA 3FMTA 3H5XA 3SYVA 2C08A 4EZRA 3T4AG 2YL6A 2F7RA 4R5LA 2KKEA 3NO7A 4UDXX 3EJUA 3H87C 1QTGA 2EX3B 1SH2A 4MJWA 4HYBA 3BUQA 3O3NB 2BJ7A 4FZOA 1HTYA 5C5BB 1TQSA 1MJGA 3VEAA 2YLAA 2OO2A 3T47A 2OBMA 4HV0A 2KHOA 3LLLA 3ERCC 2D1LA 2JXHA 3KAVA 4R5GA 1Q5VA 3D2EA 3EJQA 3T46A 1DKYA 2Z0NA 1GN9A 3Q0KA 2BA3A 1ZWWA 1HXKA 2QKWA 3DYTA 2WVEA 1YWMA 3DX2A 2RBFA 2CAXA 4AZ6A 3EJSA 2BJ1A 4ME7E 3B53X 3OK8A 3KAWA 4KIKA 1URUA 4LQ3A 3BVVA 3ACOA 1MNTA 3L3OM 4FXEA 2MI7A 2V0OA 4QPXA 4FM3A 3M3WA 1QWNA 2K9IA 1GNTA 4H8SA 3DDGA 2K1OA 2H1OE 3BVUA 4AZ5A 3BSOA 1GNLA 1DKZA 3H5YA 3CZNA 2X3WA 4JN4A 1SUFA 4E81A 3I01A 2CAJA 3KDRA 4EZOA 3D52A 1PS3A 1TQWA 2WVBA 1R33A 4JWEA 3HAHA 5C5BA 3L3PA 1MYKA 3I39X 3CAZA 3ER8C 3A98A 3NAHA 3SFGA 1QX1A 1TQVA 2ND1A 3LMFA 3BUPA 3LJPA 1P94A 2JNKA 2YIVX 4LRVA 1ZYLA 4JLCA 3DX1A 1R34A 4PO2A 3QIDA 4I1QA 3I04A 4EZUA 1NLAA 2BNZA 2A2BA 1E1DA 4LQ9A 2D4CA 4NPHA 2JXIA 2LXYA 4WPCA 3O3MB 4JNEA 1I49A 1BAZA 4JWIA 3RV0A 4FZPA 2JXGA 2CA9A 4AZHA 4HR1A 2LM0A 4IM3A 2ADLA 3I2WA 3NNEA 1OA1A 3DPPA 2OBLA 2RAJA 1ARRA 1R5EA 2EFKA 2AY0A 3D4ZA 2BJ8A 4EZQA 1SU8A 3BUBA 1TQTA 3QE6A 4EZTA 2OW6A 1Q16A 3DX3A 2WVFA 1U9PA 4H6HA 3LGHA 2N3KA 3CZSA 3HAIA 2YL9A 3UQSA 4BNEA 5E84A 1JQKA 3DDFA 2F18A 4AKVA 3QOQA 4ATMA 2YIAA 3UR0A 2YKTA 1B01A 4EZPA 1X93A 3CVRA 2Q12A 3DPQA 4AZCB 3VKHA 2GA9D 2K29A 1HWWA 2CKWA 1SU7A 3G9GA 2QFFA 2WVDA 2X3XA 3DPOA 3G5OA 4EZXA 3D2FA 1X04A 3EJPA 2RAKA 1SH0A 3SFUA 1IRQA 2F1BA 1B28A
chains in the Genus database with same CATH topology
2NCZA 2JNSA 4JNFA 1MJGA 2YI9A 2YIVX 3VEAA 4IM2A 4R5KA 3GI7A 3B52X 1ZYLA 4JLCA 4JWCA 3T49A 3T47A 1BDTA 4F01A 2OBMA 4HV0A 2GAFD 2KHOA 2ND0A 2QXLA 4JL9A 3ZEDA 3OD2A 3ERCC 5FLEX 1BDVA 4IWOA 3ER9B 4PO2A 2JXHA 3KAVA 4R5GA 3FT7A 4B9QA 3I04A 3O3OB 1Q5VA 4EZUA 2BJ9A 4M0MA 1NLAA 2BNZA 4IWPA 3D2EA 1E1DA 4NPHA 3T46A 2JXIA 1DKYA 4R5JA 1GN9A 2BA3A 2K6LA 3O3MB 4F00A 4JNEA 1BAZA 2WVEA 4JWIA 1EA4A 3RV0A 2RBFA 5FIGA 2JXGA 2CAXA 2CA9A 4EZNA 1MYLA 4UDYX 4HR1A 1PARA 2LM0A 4IM3A 2BJ1A 4EZWA 4IW0A 3RV1A 3UITA 1OA1A 2RT6A 3B51X 4E3CA 3FD9A 4ME7E 3DPPA 3B53X 2OBLA 3KAWA 1ARRA 2EWFA 4KIKA 1MNTA 1W9MA 2AY0A 3L3OM 4D8JA 2WINM 2BJ8A 4FXEA 2BNWA 2BJ7A 1SU8A 4R5IA 4EZZA 4EZQA 2HZAA 4EZTA 4FM3A 2KELA 2YI8A 2WVFA 2K9IA 1GNTA 1SU6A 1U9PA 4IM0A 1UPXA 2K1OA 3F7WA 2BJ3A 4G6QA 2H1OE 4H6HA 5TKYA 3LGHA 2N3KA 3C7NA 3VEBA 4HY9A 3QNJA 4H6IA 1GNLA 1DKZA 4EZSA 2CADA 5E84A 1JQKA 4EZYA 4JN4A 2BSQE 4EZVA 2HZVA 1E9VA 3OHXM 2K5JA 3VW4A 1SUFA 3QOQA 1OAOA 2YIBA 4E81A 2WVCA 1B28A 2YIAA 1DKXA 2GPEA 3I01A 1B01A 4IWQA 4EZPA 2CAJA 3KDRA 1X93A 4EZOA 3DPQA 2WVBA 3QA8A 1E2UA 1OA0A 4JWEA 3VKHA 2GA9D 4JWDA 2K29A 1U00A 3OWGA 3FMTA 1MYKA 1SU7A 3I39X 2QFFA 3ER8C 2Z8YA 2WVDA 4HR1B 3A98A 4EZRA 2CPGA 3T4AG 3DPOA 3GXQA 3T48A 4EZXA 2X5CA 3D2FA 4R5LA 4KIKB 2PY6A 4UDXX 2ND1A 3LMFA 3H87C 1QTGA 2EX3B 4HYBA 3O3NB 1IRQA 1P94A 1ARQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA3 A;  2K6L A;  2CAJ A;  2HZA A;  1X93 A;  3VEA A;  2WVB A;  1BAZ A;  2KEL A;  2WVE A;  2WVF A;  2K9I A;  1EA4 A;  1U9P A;  2K29 A;  2JXG A;  2RBF A;  2CAX A;  3FMT A;  1MYK A;  2CA9 A;  2K1O A;  2BJ3 A;  1MYL A;  1BDT A;  2H1O E;  1PAR A;  4HV0 A;  2BJ1 A;  2WVD A;  3LGH A;  2CPG A;  3VEB A;  3OD2 A;  3GXQ A;  1BDV A;  4ME7 E;  2JXH A;  3FT7 A;  1ARR A;  2CAD A;  1Q5V A;  2BJ9 A;  1IRQ A;  1MNT A;  2BSQ E;  1NLA A;  2AY0 A;  3H87 C;  2BNZ A;  1QTG A;  2HZV A;  2K5J A;  3VW4 A;  4D8J A;  3QOQ A;  2JXI A;  2BJ8 A;  2WVC A;  4FXE A;  2BNW A;  1ARQ A;  2BJ7 A;  1B28 A;  2GPE A;  1P94 A;  1B01 A; 
#chains in the Genus database with same CATH topology
 1X03 A;  3PLT A;  4JNF A;  2YI9 A;  2EFL A;  2Q13 A;  4IM2 A;  1I4L A;  3GI7 A;  3Q84 A;  3BSN A;  5KBP A;  4JWC A;  3T49 A;  1BDT A;  3BUI A;  4DYL A;  2ND0 A;  2FIC A;  3ER9 B;  4B9Q A;  4M0M A;  2F7O A;  4F00 A;  1EA4 A;  2AN7 A;  2Z0O A;  4EZN A;  1MYL A;  4UDY X;  3DX4 A;  1QWU A;  2O0I 1;  2RT6 A;  3B51 X;  4E3C A;  3FD9 A;  3BVX A;  1SH3 A;  2EWF A;  2H3A A;  2UUT A;  1W9M A;  1I4T A;  3RPM A;  2Z0V A;  4EZZ A;  2WK4 A;  1OG7 A;  2B43 A;  2KEL A;  2YI8 A;  1SU6 A;  4IM0 A;  3F7W A;  4G6Q A;  5TKY A;  3VEB A;  1TQU A;  3D4Y A;  2OZN B;  2CAD A;  2ALW A;  4AVM A;  4EZY A;  1O7D C;  4EZV A;  4NQI A;  3D51 A;  3OHX M;  2K5J A;  2YIB A;  1OAO A;  2WVC A;  1ARQ A;  1DKX A;  2GPE A;  1E2U A;  1OA0 A;  3UPF A;  1U00 A;  3OWG A;  2Z8Y A;  4HR1 B;  2YL5 A;  2CPG A;  3GXQ A;  3T48 A;  2X5C A;  4AZG A;  4KIK B;  2PY6 A;  1WDZ A;  2Q2K A;  4O4R A;  4FZS A;  2UUW A;  4AAI A;  2OW7 A;  3LVT A;  4NSW A;  3NAI A;  3IR7 A;  2NCZ A;  2JNS A;  2FYV A;  4AZC A;  4R5K A;  3B52 X;  4NRU A;  2ZXQ A;  4F01 A;  3ZED A;  2GAF D;  2QXL A;  4JL9 A;  3OD2 A;  3BLB A;  5FLE X;  1BDV A;  4IWO A;  2X3V A;  3FT7 A;  3O3O B;  2BJ9 A;  4IWP A;  4R5J A;  3HAJ A;  2WYI A;  2K6L A;  4DCN C;  4WPE A;  3QWE A;  3CV5 A;  3D50 A;  5FIG A;  2JBV A;  3BUD A;  1OHN A;  4EZW A;  1PAR A;  4IW0 A;  3RV1 A;  3UIT A;  3EJR A;  2KOE A;  4NRT A;  4D8J A;  2WIN M;  2BNW A;  4R5I A;  1O7D B;  2WYH A;  3BVT A;  2HZA A;  4AZ7 A;  2F1A A;  2YLL A;  3SOG A;  2F7Q A;  1UPX A;  1Y2O A;  2BJ3 A;  2ELB A;  3ABH A;  3C7N A;  3BVW A;  3CKD A;  1I4D A;  4HY9 A;  2PMR A;  3QNJ A;  4H6I A;  2F7P A;  1SIW A;  4EZS A;  1LQ7 A;  4AZB A;  2BSQ E;  2GF4 A;  2HZV A;  1E9V A;  3VW4 A;  3DX0 A;  3QNI A;  4AZI A;  2YL8 A;  4IWQ A;  3QA8 A;  2RAI A;  4JWD A;  3EJT A;  3FMT A;  3H5X A;  3SYV A;  2C08 A;  4EZR A;  3T4A G;  2YL6 A;  2F7R A;  4R5L A;  2KKE A;  3NO7 A;  4UDX X;  3EJU A;  3H87 C;  1QTG A;  2EX3 B;  1SH2 A;  4MJW A;  4HYB A;  3BUQ A;  3O3N B;  2BJ7 A;  4FZO A;  1HTY A;  5C5B B;  1TQS A;  1MJG A;  3VEA A;  2YLA A;  2OO2 A;  3T47 A;  2OBM A;  4HV0 A;  2KHO A;  3LLL A;  3ERC C;  2D1L A;  2JXH A;  3KAV A;  4R5G A;  1Q5V A;  3D2E A;  3EJQ A;  3T46 A;  1DKY A;  2Z0N A;  1GN9 A;  3Q0K A;  2BA3 A;  1ZWW A;  1HXK A;  2QKW A;  3DYT A;  2WVE A;  1YWM A;  3DX2 A;  2RBF A;  2CAX A;  4AZ6 A;  3EJS A;  2BJ1 A;  4ME7 E;  3B53 X;  3OK8 A;  3KAW A;  4KIK A;  1URU A;  4LQ3 A;  3BVV A;  3ACO A;  1MNT A;  3L3O M;  4FXE A;  2MI7 A;  2V0O A;  4QPX A;  4FM3 A;  3M3W A;  1QWN A;  2K9I A;  1GNT A;  4H8S A;  3DDG A;  2K1O A;  2H1O E;  3BVU A;  4AZ5 A;  3BSO A;  1GNL A;  1DKZ A;  3H5Y A;  3CZN A;  2X3W A;  4JN4 A;  1SUF A;  4E81 A;  3I01 A;  2CAJ A;  3KDR A;  4EZO A;  3D52 A;  1PS3 A;  1TQW A;  2WVB A;  1R33 A;  4JWE A;  3HAH A;  5C5B A;  3L3P A;  1MYK A;  3I39 X;  3CAZ A;  3ER8 C;  3A98 A;  3NAH A;  3SFG A;  1QX1 A;  1TQV A;  2ND1 A;  3LMF A;  3BUP A;  3LJP A;  1P94 A;  2JNK A;  2YIV X;  4LRV A;  1ZYL A;  4JLC A;  3DX1 A;  1R34 A;  4PO2 A;  3QID A;  4I1Q A;  3I04 A;  4EZU A;  1NLA A;  2BNZ A;  2A2B A;  1E1D A;  4LQ9 A;  2D4C A;  4NPH A;  2JXI A;  2LXY A;  4WPC A;  3O3M B;  4JNE A;  1I49 A;  1BAZ A;  4JWI A;  3RV0 A;  4FZP A;  2JXG A;  2CA9 A;  4AZH A;  4HR1 A;  2LM0 A;  4IM3 A;  2ADL A;  3I2W A;  3NNE A;  1OA1 A;  3DPP A;  2OBL A;  2RAJ A;  1ARR A;  1R5E A;  2EFK A;  2AY0 A;  3D4Z A;  2BJ8 A;  4EZQ A;  1SU8 A;  3BUB A;  1TQT A;  3QE6 A;  4EZT A;  2OW6 A;  1Q16 A;  3DX3 A;  2WVF A;  1U9P A;  4H6H A;  3LGH A;  2N3K A;  3CZS A;  3HAI A;  2YL9 A;  3UQS A;  4BNE A;  5E84 A;  1JQK A;  3DDF A;  2F18 A;  4AKV A;  3QOQ A;  4ATM A;  2YIA A;  3UR0 A;  2YKT A;  1B01 A;  4EZP A;  1X93 A;  3CVR A;  2Q12 A;  3DPQ A;  4AZC B;  3VKH A;  2GA9 D;  2K29 A;  1HWW A;  2CKW A;  1SU7 A;  3G9G A;  2QFF A;  2WVD A;  2X3X A;  3DPO A;  3G5O A;  4EZX A;  3D2F A;  1X04 A;  3EJP A;  2RAK A;  1SH0 A;  3SFU A;  1IRQ A;  2F1B A;  1B28 A; 
#chains in the Genus database with same CATH homology
 2NCZ A;  2JNS A;  4JNF A;  1MJG A;  2YI9 A;  2YIV X;  3VEA A;  4IM2 A;  4R5K A;  3GI7 A;  3B52 X;  1ZYL A;  4JLC A;  4JWC A;  3T49 A;  3T47 A;  1BDT A;  4F01 A;  2OBM A;  4HV0 A;  2GAF D;  2KHO A;  2ND0 A;  2QXL A;  4JL9 A;  3ZED A;  3OD2 A;  3ERC C;  5FLE X;  1BDV A;  4IWO A;  3ER9 B;  4PO2 A;  2JXH A;  3KAV A;  4R5G A;  3FT7 A;  4B9Q A;  3I04 A;  3O3O B;  1Q5V A;  4EZU A;  2BJ9 A;  4M0M A;  1NLA A;  2BNZ A;  4IWP A;  3D2E A;  1E1D A;  4NPH A;  3T46 A;  2JXI A;  1DKY A;  4R5J A;  1GN9 A;  2BA3 A;  2K6L A;  3O3M B;  4F00 A;  4JNE A;  1BAZ A;  2WVE A;  4JWI A;  1EA4 A;  3RV0 A;  2RBF A;  5FIG A;  2JXG A;  2CAX A;  2CA9 A;  4EZN A;  1MYL A;  4UDY X;  4HR1 A;  1PAR A;  2LM0 A;  4IM3 A;  2BJ1 A;  4EZW A;  4IW0 A;  3RV1 A;  3UIT A;  1OA1 A;  2RT6 A;  3B51 X;  4E3C A;  3FD9 A;  4ME7 E;  3DPP A;  3B53 X;  2OBL A;  3KAW A;  1ARR A;  2EWF A;  4KIK A;  1MNT A;  1W9M A;  2AY0 A;  3L3O M;  4D8J A;  2WIN M;  2BJ8 A;  4FXE A;  2BNW A;  2BJ7 A;  1SU8 A;  4R5I A;  4EZZ A;  4EZQ A;  2HZA A;  4EZT A;  4FM3 A;  2KEL A;  2YI8 A;  2WVF A;  2K9I A;  1GNT A;  1SU6 A;  1U9P A;  4IM0 A;  1UPX A;  2K1O A;  3F7W A;  2BJ3 A;  4G6Q A;  2H1O E;  4H6H A;  5TKY A;  3LGH A;  2N3K A;  3C7N A;  3VEB A;  4HY9 A;  3QNJ A;  4H6I A;  1GNL A;  1DKZ A;  4EZS A;  2CAD A;  5E84 A;  1JQK A;  4EZY A;  4JN4 A;  2BSQ E;  4EZV A;  2HZV A;  1E9V A;  3OHX M;  2K5J A;  3VW4 A;  1SUF A;  3QOQ A;  1OAO A;  2YIB A;  4E81 A;  2WVC A;  1B28 A;  2YIA A;  1DKX A;  2GPE A;  3I01 A;  1B01 A;  4IWQ A;  4EZP A;  2CAJ A;  3KDR A;  1X93 A;  4EZO A;  3DPQ A;  2WVB A;  3QA8 A;  1E2U A;  1OA0 A;  4JWE A;  3VKH A;  2GA9 D;  4JWD A;  2K29 A;  1U00 A;  3OWG A;  3FMT A;  1MYK A;  1SU7 A;  3I39 X;  2QFF A;  3ER8 C;  2Z8Y A;  2WVD A;  4HR1 B;  3A98 A;  4EZR A;  2CPG A;  3T4A G;  3DPO A;  3GXQ A;  3T48 A;  4EZX A;  2X5C A;  3D2F A;  4R5L A;  4KIK B;  2PY6 A;  4UDX X;  2ND1 A;  3LMF A;  3H87 C;  1QTG A;  2EX3 B;  4HYB A;  3O3N B;  1IRQ A;  1P94 A;  1ARQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...