3VEAA

Crystal structure of matp-mats23mer
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
MKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrodomain Ter protein
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3veaA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3veaA01
1IRQA 1MYKA 2CADA 3FT7A 2CAXA 2JXIA 2CPGA 3VW4A 1B28A 2BJ9A 4FXEA 2BA3A 2K6LA 3VEBA 3LGHA 2CA9A 3GXQA 2H1OE 2BJ8A 1NLAA 2WVDA 2WVEA 4D8JA 3QOQA 2JXGA 2GPEA 1B01A 1X93A 2WVFA 3VEAA 2K5JA 2KELA 2BNWA 2BJ7A 2JXHA 1ARQA 2HZAA 3OD2A 2HZVA 1ARRA 1P94A 2K9IA 1BDTA 2RBFA 4HV0A 2BJ3A 2CAJA 2WVCA 2BNZA 1BAZA 1EA4A 2BJ1A 2WVBA 1BDVA 1QTGA 1MNTA 1MYLA 3FMTA 4ME7E 2K1OA 2AY0A 1PARA 3H87C 2BSQE 2K29A 1U9PA 1Q5VA
chains in the Genus database with same CATH superfamily
3EJQA 3RPMA 4EZYA 3VW4A 3D2EA 2OO2A 2ALWA 4ATMA 1DKYA 2YKTA 1LQ7A 5C5BB 1ZYLA 3ER9B 2X3VA 4AZBA 3G5OA 3UQSA 4R5LA 3ABHA 3OK8A 3H87C 3D2FA 1Q5VA 3DX4A 1PS3A 3D50A 2JXIA 3O3OB 3ACOA 2BJ9A 4HR1B 3DX3A 3BSNA 1ZWWA 2Z0VA 1OA0A 4AZ6A 3T4AG 1TQUA 5TKYA 4DYLA 1YWMA 1MNTA 3Q84A 1PARA 2ELBA 3BVWA 2YL8A 2JXHA 2NCZA 4UDYX 4JWEA 4NQIA 1OA1A 3EJTA 2GA9D 4LQ3A 3LLLA 4IW0A 1E2UA 2BNZA 1GN9A 1BDVA 3UR0A 2F7OA 2B43A 4EZPA 2RAJA 2EX3B 2KHOA 2Z0OA 4JL9A 1B28A 1I4TA 4IWOA 2ND0A 2BJ8A 2FYVA 3O3NB 3CZSA 2K5JA 2KELA 2N3KA 1QWNA 1ARRA 2H3AA 2UUTA 3IR7A 3LMFA 3ERCC 2YI8A 2WINM 2F1BA 1R33A 4AZHA 4NRTA 3RV1A 4F01A 2YI9A 4AZ5A 3DPPA 2RAIA 2GAFD 1TQVA 3HAHA 2HZAA 1GNTA 3T49A 1QWUA 1BDTA 1I49A 3HAJA 4HV0A 1I4LA 3I2WA 3DX1A 2JNKA 4AZGA 3ER8C 2ADLA 2QKWA 4R5GA 3I04A 2CPGA 3C7NA 3BUQA 1GNLA 2WVDA 3D4YA 2YL6A 2BJ7A 1ARQA 3O3MB 3OD2A 2HZVA 3T46A 3I39X 4AVMA 1BAZA 1QTGA 3BUIA 2D4CA 2LXYA 4FM3A 3EJUA 3DYTA 3QWEA 3OHXM 2EFLA 4E81A 3BVXA 2WK4A 4QPXA 3BSOA 4JNEA 2OBLA 4EZOA 4DCNC 3VKHA 3D52A 2K1OA 3NAIA 2EFKA 2F7RA 1IRQA 1MYKA 4B9QA 3L3OM 2K6LA 1WDZA 1E1DA 1X93A 1SH2A 1I4DA 3EJSA 4JNFA 2BNWA 1O7DB 3BVUA 1P94A 3SYVA 4JWDA 3LVTA 2WYHA 4JN4A 2A2BA 2JBVA 2MI7A 2YIAA 2K29A 1DKZA 2CADA 3FT7A 3NNEA 4IM2A 1E9VA 3BUBA 3KAVA 2F7QA 2RAKA 2JXGA 4F00A 1HXKA 3CAZA 3VEAA 4IM3A 2X3WA 3EJPA 4EZNA 4EZQA 2F1AA 4G6QA 3EJRA 3SFGA 4MJWA 2AY0A 2ZXQA 3CZNA 2CAXA 1SU7A 2JNSA 3LGHA 4M0MA 4WPCA 4NRUA 3G9GA 2FICA 3BUDA 1HTYA 3NO7A 3DPQA 3UITA 4WPEA 2O0I1 4I1QA 3FD9A 3H5XA 3NAHA 1EA4A 2Q12A 2QXLA 5FIGA 2WYIA 1W9MA 4JWCA 2BSQE 2Q13A 2F18A 4AZCA 3DPOA 4FXEA 4H6IA 4AZIA 2V0OA 2UUWA 2YLAA 4EZSA 3DDGA 3H5YA 4HY9A 3UPFA 4NPHA 3KAWA 3DDFA 4PO2A 2WVBA 1OAOA 2RT6A 3HAIA 1U9PA 1SUFA 1Q16A 3QE6A 3BLBA 3CV5A 4R5JA 4FZOA 4EZZA 2YL9A 3QIDA 3OWGA 4EZTA 1SH3A 3CKDA 2WVFA 3ZEDA 2BJ3A 2CAJA 2D1LA 2OZNB 1O7DC 2OBMA 4R5IA 3BVTA 4LQ9A 3Q0KA 1Y2OA 3L3PA 3LJPA 1TQTA 4EZUA 3SFUA 2OW6A 2BA3A 3I01A 2CA9A 1NLAA 2WVEA 4H6HA 3PLTA 5C5BA 4LRVA 1SU8A 2X5CA 4IWQA 1SH0A 2RBFA 2OW7A 1TQSA 3B51X 4AAIA 4FZSA 5KBPA 2Z0NA 1MYLA 1UPXA 4BNEA 1DKXA 3D51A 3F7WA 1QX1A 3QNIA 4EZXA 3BVVA 2KOEA 4EZVA 2Q2KA 4HR1A 3SOGA 4D8JA 5FLEX 4HYBA 2ND1A 4UDXX 3D4ZA 4EZWA 1TQWA 2F7PA 2YIBA 2K9IA 1MJGA 4NSWA 3T48A 4R5KA 2Z8YA 3DX2A 1OHNA 1URUA 4E3CA 4O4RA 2X3XA 4AZCB 2PMRA 2KKEA 1X03A 4IWPA 3CVRA 2CKWA 3VEBA 1U00A 4KIKB 3QA8A 2H1OE 1SU6A 4AKVA 3QOQA 3T47A 1B01A 2AN7A 3M3WA 4H8SA 4IM0A 4EZRA 1JQKA 2BJ1A 1HWWA 3FMTA 4AZ7A 3RV0A 2EWFA 3GI7A 2LM0A 3DX0A 3BUPA 3KDRA 3GXQA 2GF4A 2YL5A 4KIKA 2YLLA 3QNJA 2GPEA 1SIWA 2C08A 3A98A 3B52X 1OG7A 4FZPA 2PY6A 4JWIA 1R5EA 5E84A 2WVCA 1X04A 4ME7E 2QFFA 2YIVX 4JLCA 3B53X 1R34A
chains in the Genus database with same CATH topology
1DKZA 2WINM 2CADA 3FT7A 4IM2A 4EZUA 4EZYA 3VW4A 3D2EA 2BA3A 1E9VA 3RV1A 3I01A 2YI9A 4F01A 2CA9A 3KAVA 3DPPA 1NLAA 2WVEA 2JXGA 4F00A 4H6HA 2GAFD 1DKYA 1ZYLA 1SU8A 3ER9B 3VEAA 2X5CA 4IWQA 4IM3A 2HZAA 1GNTA 3T49A 4EZNA 1BDTA 2RBFA 4EZQA 4HV0A 3B51X 4G6QA 4R5LA 1MYLA 1UPXA 3ER8C 1DKXA 2AY0A 3H87C 3D2FA 1Q5VA 4R5GA 3F7WA 2CAXA 1SU7A 2JXIA 3I04A 3O3OB 2CPGA 2JNSA 3C7NA 4EZXA 2BJ9A 4EZVA 4HR1B 4HR1A 3LGHA 4M0MA 1GNLA 2WVDA 4D8JA 5FLEX 4HYBA 2ND1A 1OA0A 2BJ7A 1ARQA 3O3MB 4UDXX 4EZWA 3OD2A 2HZVA 3DPQA 3UITA 2YIBA 2K9IA 3T46A 3T4AG 1MJGA 3I39X 5TKYA 3T48A 4R5KA 3FD9A 5FIGA 1BAZA 1EA4A 2QXLA 2Z8YA 1W9MA 1QTGA 1MNTA 4JWCA 4FM3A 1PARA 2BSQE 4E3CA 2JXHA 2NCZA 4UDYX 3DPOA 4JWEA 1OA1A 4IWPA 4FXEA 4H6IA 3VEBA 1U00A 4KIKB 3QA8A 2H1OE 1SU6A 3QOQA 3OHXM 4EZSA 3T47A 1B01A 2GA9D 4E81A 4IW0A 4HY9A 4NPHA 4JNEA 3KAWA 4IM0A 1E2UA 4EZRA 4PO2A 2BNZA 1JQKA 2BJ1A 1GN9A 2OBLA 2WVBA 1BDVA 4EZOA 3VKHA 1OAOA 3FMTA 3ERCC 3RV0A 2K1OA 2RT6A 1U9PA 2EWFA 3GI7A 1SUFA 2LM0A 4EZPA 1IRQA 1MYKA 2EX3B 2KHOA 4JL9A 4B9QA 1B28A 3L3OM 2K6LA 4IWOA 4R5JA 4EZZA 3KDRA 3GXQA 2ND0A 2BJ8A 4KIKA 3OWGA 2GPEA 3QNJA 3A98A 3B52X 1E1DA 4EZTA 1X93A 2WVFA 3O3NB 4JNFA 2K5JA 2KELA 2BNWA 2N3KA 2PY6A 4JWIA 1ARRA 1P94A 4JWDA 3ZEDA 5E84A 2BJ3A 2CAJA 2WVCA 4JN4A 3LMFA 2YIAA 4ME7E 2OBMA 2QFFA 4R5IA 2YIVX 4JLCA 3B53X 2K29A 2YI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRQ A;  1MYK A;  2CAD A;  3FT7 A;  2CAX A;  2JXI A;  2CPG A;  3VW4 A;  1B28 A;  2BJ9 A;  4FXE A;  2BA3 A;  2K6L A;  3VEB A;  3LGH A;  2CA9 A;  3GXQ A;  2H1O E;  2BJ8 A;  1NLA A;  2WVD A;  2WVE A;  4D8J A;  3QOQ A;  2JXG A;  2GPE A;  1B01 A;  1X93 A;  2WVF A;  3VEA A;  2K5J A;  2KEL A;  2BNW A;  2BJ7 A;  2JXH A;  1ARQ A;  2HZA A;  3OD2 A;  2HZV A;  1ARR A;  1P94 A;  2K9I A;  1BDT A;  2RBF A;  4HV0 A;  2BJ3 A;  2CAJ A;  2WVC A;  2BNZ A;  1BAZ A;  1EA4 A;  2BJ1 A;  2WVB A;  1BDV A;  1QTG A;  1MNT A;  1MYL A;  3FMT A;  4ME7 E;  2K1O A;  2AY0 A;  1PAR A;  3H87 C;  2BSQ E;  2K29 A;  1U9P A;  1Q5V A; 
#chains in the Genus database with same CATH topology
 3EJQ A;  3RPM A;  4EZY A;  3VW4 A;  3D2E A;  2OO2 A;  2ALW A;  4ATM A;  1DKY A;  2YKT A;  1LQ7 A;  5C5B B;  1ZYL A;  3ER9 B;  2X3V A;  4AZB A;  3G5O A;  3UQS A;  4R5L A;  3ABH A;  3OK8 A;  3H87 C;  3D2F A;  1Q5V A;  3DX4 A;  1PS3 A;  3D50 A;  2JXI A;  3O3O B;  3ACO A;  2BJ9 A;  4HR1 B;  3DX3 A;  3BSN A;  1ZWW A;  2Z0V A;  1OA0 A;  4AZ6 A;  3T4A G;  1TQU A;  5TKY A;  4DYL A;  1YWM A;  1MNT A;  3Q84 A;  1PAR A;  2ELB A;  3BVW A;  2YL8 A;  2JXH A;  2NCZ A;  4UDY X;  4JWE A;  4NQI A;  1OA1 A;  3EJT A;  2GA9 D;  4LQ3 A;  3LLL A;  4IW0 A;  1E2U A;  2BNZ A;  1GN9 A;  1BDV A;  3UR0 A;  2F7O A;  2B43 A;  4EZP A;  2RAJ A;  2EX3 B;  2KHO A;  2Z0O A;  4JL9 A;  1B28 A;  1I4T A;  4IWO A;  2ND0 A;  2BJ8 A;  2FYV A;  3O3N B;  3CZS A;  2K5J A;  2KEL A;  2N3K A;  1QWN A;  1ARR A;  2H3A A;  2UUT A;  3IR7 A;  3LMF A;  3ERC C;  2YI8 A;  2WIN M;  2F1B A;  1R33 A;  4AZH A;  4NRT A;  3RV1 A;  4F01 A;  2YI9 A;  4AZ5 A;  3DPP A;  2RAI A;  2GAF D;  1TQV A;  3HAH A;  2HZA A;  1GNT A;  3T49 A;  1QWU A;  1BDT A;  1I49 A;  3HAJ A;  4HV0 A;  1I4L A;  3I2W A;  3DX1 A;  2JNK A;  4AZG A;  3ER8 C;  2ADL A;  2QKW A;  4R5G A;  3I04 A;  2CPG A;  3C7N A;  3BUQ A;  1GNL A;  2WVD A;  3D4Y A;  2YL6 A;  2BJ7 A;  1ARQ A;  3O3M B;  3OD2 A;  2HZV A;  3T46 A;  3I39 X;  4AVM A;  1BAZ A;  1QTG A;  3BUI A;  2D4C A;  2LXY A;  4FM3 A;  3EJU A;  3DYT A;  3QWE A;  3OHX M;  2EFL A;  4E81 A;  3BVX A;  2WK4 A;  4QPX A;  3BSO A;  4JNE A;  2OBL A;  4EZO A;  4DCN C;  3VKH A;  3D52 A;  2K1O A;  3NAI A;  2EFK A;  2F7R A;  1IRQ A;  1MYK A;  4B9Q A;  3L3O M;  2K6L A;  1WDZ A;  1E1D A;  1X93 A;  1SH2 A;  1I4D A;  3EJS A;  4JNF A;  2BNW A;  1O7D B;  3BVU A;  1P94 A;  3SYV A;  4JWD A;  3LVT A;  2WYH A;  4JN4 A;  2A2B A;  2JBV A;  2MI7 A;  2YIA A;  2K29 A;  1DKZ A;  2CAD A;  3FT7 A;  3NNE A;  4IM2 A;  1E9V A;  3BUB A;  3KAV A;  2F7Q A;  2RAK A;  2JXG A;  4F00 A;  1HXK A;  3CAZ A;  3VEA A;  4IM3 A;  2X3W A;  3EJP A;  4EZN A;  4EZQ A;  2F1A A;  4G6Q A;  3EJR A;  3SFG A;  4MJW A;  2AY0 A;  2ZXQ A;  3CZN A;  2CAX A;  1SU7 A;  2JNS A;  3LGH A;  4M0M A;  4WPC A;  4NRU A;  3G9G A;  2FIC A;  3BUD A;  1HTY A;  3NO7 A;  3DPQ A;  3UIT A;  4WPE A;  2O0I 1;  4I1Q A;  3FD9 A;  3H5X A;  3NAH A;  1EA4 A;  2Q12 A;  2QXL A;  5FIG A;  2WYI A;  1W9M A;  4JWC A;  2BSQ E;  2Q13 A;  2F18 A;  4AZC A;  3DPO A;  4FXE A;  4H6I A;  4AZI A;  2V0O A;  2UUW A;  2YLA A;  4EZS A;  3DDG A;  3H5Y A;  4HY9 A;  3UPF A;  4NPH A;  3KAW A;  3DDF A;  4PO2 A;  2WVB A;  1OAO A;  2RT6 A;  3HAI A;  1U9P A;  1SUF A;  1Q16 A;  3QE6 A;  3BLB A;  3CV5 A;  4R5J A;  4FZO A;  4EZZ A;  2YL9 A;  3QID A;  3OWG A;  4EZT A;  1SH3 A;  3CKD A;  2WVF A;  3ZED A;  2BJ3 A;  2CAJ A;  2D1L A;  2OZN B;  1O7D C;  2OBM A;  4R5I A;  3BVT A;  4LQ9 A;  3Q0K A;  1Y2O A;  3L3P A;  3LJP A;  1TQT A;  4EZU A;  3SFU A;  2OW6 A;  2BA3 A;  3I01 A;  2CA9 A;  1NLA A;  2WVE A;  4H6H A;  3PLT A;  5C5B A;  4LRV A;  1SU8 A;  2X5C A;  4IWQ A;  1SH0 A;  2RBF A;  2OW7 A;  1TQS A;  3B51 X;  4AAI A;  4FZS A;  5KBP A;  2Z0N A;  1MYL A;  1UPX A;  4BNE A;  1DKX A;  3D51 A;  3F7W A;  1QX1 A;  3QNI A;  4EZX A;  3BVV A;  2KOE A;  4EZV A;  2Q2K A;  4HR1 A;  3SOG A;  4D8J A;  5FLE X;  4HYB A;  2ND1 A;  4UDX X;  3D4Z A;  4EZW A;  1TQW A;  2F7P A;  2YIB A;  2K9I A;  1MJG A;  4NSW A;  3T48 A;  4R5K A;  2Z8Y A;  3DX2 A;  1OHN A;  1URU A;  4E3C A;  4O4R A;  2X3X A;  4AZC B;  2PMR A;  2KKE A;  1X03 A;  4IWP A;  3CVR A;  2CKW A;  3VEB A;  1U00 A;  4KIK B;  3QA8 A;  2H1O E;  1SU6 A;  4AKV A;  3QOQ A;  3T47 A;  1B01 A;  2AN7 A;  3M3W A;  4H8S A;  4IM0 A;  4EZR A;  1JQK A;  2BJ1 A;  1HWW A;  3FMT A;  4AZ7 A;  3RV0 A;  2EWF A;  3GI7 A;  2LM0 A;  3DX0 A;  3BUP A;  3KDR A;  3GXQ A;  2GF4 A;  2YL5 A;  4KIK A;  2YLL A;  3QNJ A;  2GPE A;  1SIW A;  2C08 A;  3A98 A;  3B52 X;  1OG7 A;  4FZP A;  2PY6 A;  4JWI A;  1R5E A;  5E84 A;  2WVC A;  1X04 A;  4ME7 E;  2QFF A;  2YIV X;  4JLC A;  3B53 X;  1R34 A; 
#chains in the Genus database with same CATH homology
 1DKZ A;  2WIN M;  2CAD A;  3FT7 A;  4IM2 A;  4EZU A;  4EZY A;  3VW4 A;  3D2E A;  2BA3 A;  1E9V A;  3RV1 A;  3I01 A;  2YI9 A;  4F01 A;  2CA9 A;  3KAV A;  3DPP A;  1NLA A;  2WVE A;  2JXG A;  4F00 A;  4H6H A;  2GAF D;  1DKY A;  1ZYL A;  1SU8 A;  3ER9 B;  3VEA A;  2X5C A;  4IWQ A;  4IM3 A;  2HZA A;  1GNT A;  3T49 A;  4EZN A;  1BDT A;  2RBF A;  4EZQ A;  4HV0 A;  3B51 X;  4G6Q A;  4R5L A;  1MYL A;  1UPX A;  3ER8 C;  1DKX A;  2AY0 A;  3H87 C;  3D2F A;  1Q5V A;  4R5G A;  3F7W A;  2CAX A;  1SU7 A;  2JXI A;  3I04 A;  3O3O B;  2CPG A;  2JNS A;  3C7N A;  4EZX A;  2BJ9 A;  4EZV A;  4HR1 B;  4HR1 A;  3LGH A;  4M0M A;  1GNL A;  2WVD A;  4D8J A;  5FLE X;  4HYB A;  2ND1 A;  1OA0 A;  2BJ7 A;  1ARQ A;  3O3M B;  4UDX X;  4EZW A;  3OD2 A;  2HZV A;  3DPQ A;  3UIT A;  2YIB A;  2K9I A;  3T46 A;  3T4A G;  1MJG A;  3I39 X;  5TKY A;  3T48 A;  4R5K A;  3FD9 A;  5FIG A;  1BAZ A;  1EA4 A;  2QXL A;  2Z8Y A;  1W9M A;  1QTG A;  1MNT A;  4JWC A;  4FM3 A;  1PAR A;  2BSQ E;  4E3C A;  2JXH A;  2NCZ A;  4UDY X;  3DPO A;  4JWE A;  1OA1 A;  4IWP A;  4FXE A;  4H6I A;  3VEB A;  1U00 A;  4KIK B;  3QA8 A;  2H1O E;  1SU6 A;  3QOQ A;  3OHX M;  4EZS A;  3T47 A;  1B01 A;  2GA9 D;  4E81 A;  4IW0 A;  4HY9 A;  4NPH A;  4JNE A;  3KAW A;  4IM0 A;  1E2U A;  4EZR A;  4PO2 A;  2BNZ A;  1JQK A;  2BJ1 A;  1GN9 A;  2OBL A;  2WVB A;  1BDV A;  4EZO A;  3VKH A;  1OAO A;  3FMT A;  3ERC C;  3RV0 A;  2K1O A;  2RT6 A;  1U9P A;  2EWF A;  3GI7 A;  1SUF A;  2LM0 A;  4EZP A;  1IRQ A;  1MYK A;  2EX3 B;  2KHO A;  4JL9 A;  4B9Q A;  1B28 A;  3L3O M;  2K6L A;  4IWO A;  4R5J A;  4EZZ A;  3KDR A;  3GXQ A;  2ND0 A;  2BJ8 A;  4KIK A;  3OWG A;  2GPE A;  3QNJ A;  3A98 A;  3B52 X;  1E1D A;  4EZT A;  1X93 A;  2WVF A;  3O3N B;  4JNF A;  2K5J A;  2KEL A;  2BNW A;  2N3K A;  2PY6 A;  4JWI A;  1ARR A;  1P94 A;  4JWD A;  3ZED A;  5E84 A;  2BJ3 A;  2CAJ A;  2WVC A;  4JN4 A;  3LMF A;  2YIA A;  4ME7 E;  2OBM A;  2QFF A;  4R5I A;  2YIV X;  4JLC A;  3B53 X;  2K29 A;  2YI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...