3VEAA

Crystal structure of matp-mats23mer
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
MKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
molecule keywords Macrodomain Ter protein
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3veaA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3veaA01
2BJ1A 2JXGA 1Q5VA 4ME7E 1ARRA 2K6LA 2HZVA 2K9IA 4D8JA 2GPEA 3QOQA 2H1OE 3LGHA 2HZAA 2BNWA 2CAXA 1BDTA 1MNTA 2WVDA 3H87C 1NLAA 3OD2A 2BNZA 2AY0A 1BDVA 2CPGA 3FMTA 2K29A 2WVCA 2CA9A 3VW4A 1ARQA 1P94A 2JXHA 3FT7A 1B01A 2BA3A 4HV0A 2RBFA 3VEBA 2BJ8A 1PARA 1MYKA 2JXIA 1IRQA 1X93A 2CAJA 2WVFA 3VEAA 1EA4A 2BJ7A 1MYLA 2CADA 2BJ3A 2K5JA 1B28A 2WVEA 3GXQA 2BJ9A 2BSQE 1QTGA 1BAZA 4FXEA 2K1OA 2WVBA 1U9PA 2KELA
chains in the Genus database with same CATH superfamily
3SYVA 4E81A 3SOGA 2H3AA 3F7WA 4D8JA 3QOQA 4HYBA 3LMFA 3FMTA 4G6QA 1TQSA 3HAJA 3BVVA 3D4ZA 3D4YA 4EZNA 3LVTA 4FM3A 1EA4A 2A2BA 2YL8A 2BJ9A 2X3WA 3B51X 5KBPA 3ZEDA 2OW6A 3DX4A 2H1OE 3ER8C 5FLEX 3QIDA 1NLAA 4JWCA 3A98A 3DDFA 2ELBA 3FT7A 1MJGA 2OO2A 4JNFA 2RAJA 4M0MA 3I04A 2EWFA 2O0I1 2WVFA 5C5BA 1MYLA 2WVEA 4EZOA 3SFGA 1GNLA 1BAZA 4FXEA 4EZYA 2WVBA 4AZGA 1B01A 2EFLA 4EZRA 2WINM 2EFKA 3B52X 4EZWA 1WDZA 2NCZA 2K29A 2QFFA 4AAIA 2BA3A 1TQVA 2JXIA 1X93A 3CZNA 1OA0A 3EJUA 3C7NA 3BUDA 1HWWA 2AN7A 1YWMA 1SH0A 3T49A 4LQ3A 3DPPA 2CAXA 2Z0NA 3BVXA 2BNZA 1I4LA 2PMRA 4NRUA 4WPEA 3PLTA 4EZUA 1MYKA 3BUQA 2Z8YA 1GN9A 3I2WA 2ND0A 3ER9B 2BJ1A 3UITA 4NSWA 3BSOA 2Q13A 4EZVA 1HTYA 3UQSA 3O3MB 4PO2A 3DX2A 1HXKA 3DPQA 1OAOA 1TQWA 3D2EA 1SU6A 3NNEA 3T48A 2F7OA 2BJ3A 2K5JA 4AZBA 4R5KA 4B9QA 1E1DA 3G5OA 3Q84A 2FICA 2OZNB 2Q12A 4IWOA 4JN4A 3BVTA 2LXYA 1TQUA 2YIAA 3BUPA 3M3WA 3VEBA 1ZWWA 3H5XA 5E84A 4AZCB 1E9VA 2RAKA 3D50A 2Z0OA 3KAVA 4KIKB 2K1OA 3EJPA 3BVUA 4NPHA 4LQ9A 2RAIA 1Q16A 2GA9D 2KHOA 4AZ6A 2YIVX 3LJPA 3VW4A 1SIWA 2RBFA 2X5CA 2WK4A 2YI8A 1IRQA 2YL5A 2D4CA 3NAHA 4EZSA 1QTGA 3UPFA 3D52A 4FZOA 4NQIA 1Y2OA 2D1LA 3D2FA 4R5IA 3HAHA 1UPXA 2GAFD 2F7RA 4ATMA 4IM0A 2N3KA 3DYTA 4HY9A 4JWEA 3EJTA 2F7QA 4JWDA 1SUFA 4IM2A 3OHXM 2QKWA 2C08A 1SH2A 2UUWA 4IWQA 4BNEA 3B53X 3FD9A 3QE6A 4AZ5A 3VEAA 4UDXX 4H6HA 4EZZA 4EZQA 3L3PA 2FYVA 2YL9A 1DKZA 3QNIA 1ARRA 3H5YA 3ABHA 2ALWA 2JNSA 3DPOA 3DX3A 2F1BA 1OG7A 1X03A 3L3OM 4EZTA 3T46A 3ERCC 3BUBA 3IR7A 1OA1A 4H6IA 3NAIA 1O7DB 2PY6A 4JL9A 2WYHA 2OBMA 3RPMA 2ADLA 2Q2KA 2RT6A 4LRVA 4QPXA 2K6LA 4NRTA 3LGHA 4AZCA 2CPGA 2QXLA 4EZPA 1SU8A 4FZSA 3GI7A 4AZHA 4H8SA 2YL6A 2UUTA 4AZIA 4R5GA 3O3OB 4ME7E 2KKEA 2GPEA 1PS3A 1URUA 2YLLA 1MNTA 1BDVA 3DX1A 2JXHA 3Q0KA 2BJ8A 2YLAA 2CAJA 3ACOA 1GNTA 2LM0A 2Z0VA 2WYIA 3VKHA 1OHNA 4HR1B 5TKYA 3UR0A 3RV0A 3D51A 4AKVA 2WVDA 3OD2A 2ZXQA 2KOEA 1QWUA 2JNKA 4HR1A 2CKWA 4KIKA 3OK8A 3T47A 4AZ7A 1DKYA 3BUIA 1U00A 1ZYLA 3NO7A 1X04A 3G9GA 3O3NB 4DCNC 3CAZA 1Q5VA 2HZVA 3I01A 3CKDA 3OWGA 2EX3B 2CA9A 4F00A 1O7DC 2OW7A 4HV0A 4R5JA 2X3VA 4O4RA 2BJ7A 1I4TA 3CV5A 1R5EA 3HAIA 3QWEA 3BVWA 1I4DA 3SFUA 2KELA 2YIBA 2X3XA 4JLCA 4R5LA 1BDTA 3QNJA 3H87C 5C5BB 2AY0A 2MI7A 2WVCA 4E3CA 1W9MA 2OBLA 2YI9A 1PARA 1I49A 4DYLA 1B28A 4UDYX 3GXQA 1SU7A 3KDRA 1U9PA 1R34A 3CZSA 3QA8A 2JXGA 3DX0A 4I1QA 4AVMA 4WPCA 2F1AA 2HZAA 5FIGA 4IWPA 4MJWA 3I39X 3EJSA 1ARQA 4JWIA 4JNEA 1DKXA 1JQKA 1R33A 3EJRA 2CADA 4IM3A 2JBVA 2GF4A 3BSNA 1E2UA 1QWNA 1TQTA 3BLBA 2V0OA 2K9IA 3KAWA 3LLLA 2BNWA 3DDGA 1SH3A 1LQ7A 2F18A 3CVRA 4FZPA 3RV1A 3T4AG 2ND1A 1P94A 2F7PA 1QX1A 2B43A 4IW0A 2YKTA 4EZXA 2BSQE 3EJQA 4F01A
chains in the Genus database with same CATH topology
2BJ1A 1Q5VA 2HZVA 1ARRA 4E81A 3UITA 3F7WA 4D8JA 2JNSA 3DPOA 3QOQA 4EZVA 4HYBA 3I01A 3L3OM 4EZTA 3T46A 3OWGA 2EX3B 3LMFA 3O3MB 4PO2A 3FMTA 4G6QA 3ERCC 3DPQA 2CA9A 1OAOA 4F00A 3D2EA 1OA1A 4HV0A 1SU6A 4R5JA 4EZNA 4H6IA 3T48A 2PY6A 4FM3A 1EA4A 2BJ7A 2BJ3A 2K5JA 4JL9A 4R5KA 2OBMA 2BJ9A 4B9QA 1E1DA 3B51X 2RT6A 2KELA 3ZEDA 2K6LA 2YIBA 4JLCA 2H1OE 4R5LA 3LGHA 3ER8C 4IWOA 4JN4A 5FLEX 1BDTA 3QNJA 3H87C 1NLAA 2AY0A 2CPGA 2QXLA 4JWCA 2YIAA 4EZPA 2WVCA 1SU8A 3A98A 3FT7A 1MJGA 3GI7A 1W9MA 4E3CA 2OBLA 2YI9A 4JNFA 3VEBA 4M0MA 1PARA 3I04A 2EWFA 2WVFA 1MYLA 1B28A 4UDYX 5E84A 2WVEA 4EZOA 1E9VA 3GXQA 3KAVA 1GNLA 1BAZA 4FXEA 1SU7A 2K1OA 2WVBA 3KDRA 4KIKB 4EZYA 4NPHA 1U9PA 1B01A 4R5GA 3O3OB 3QA8A 2JXGA 4ME7E 2WINM 4EZRA 3B52X 2GPEA 2GA9D 2HZAA 2KHOA 1MNTA 5FIGA 4EZWA 4IWPA 1BDVA 3I39X 2NCZA 2K29A 2QFFA 2YIVX 3VW4A 1ARQA 2JXHA 4JWIA 4JNEA 2BA3A 2RBFA 1DKXA 2BJ8A 2JXIA 2X5CA 2YI8A 1IRQA 1X93A 2CAJA 1JQKA 2CADA 1GNTA 4IM3A 1OA0A 2LM0A 3VKHA 3C7NA 4EZSA 1QTGA 1E2UA 4HR1B 5TKYA 3RV0A 3D2FA 3T49A 4R5IA 1UPXA 3DPPA 2K9IA 2GAFD 3KAWA 4IM0A 2N3KA 2BNWA 2CAXA 4HY9A 4JWEA 4JWDA 2WVDA 3OD2A 2BNZA 1SUFA 4IM2A 3OHXM 3RV1A 4HR1A 3T4AG 2ND1A 1P94A 4IWQA 4KIKA 3B53X 3FD9A 1MYKA 4EZUA 3VEAA 4UDXX 3T47A 1DKYA 1U00A 2Z8YA 4H6HA 1ZYLA 1GN9A 4IW0A 4EZXA 4EZZA 4EZQA 2ND0A 2BSQE 3O3NB 3ER9B 4F01A 1DKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ1 A;  2JXG A;  1Q5V A;  4ME7 E;  1ARR A;  2K6L A;  2HZV A;  2K9I A;  4D8J A;  2GPE A;  3QOQ A;  2H1O E;  3LGH A;  2HZA A;  2BNW A;  2CAX A;  1BDT A;  1MNT A;  2WVD A;  3H87 C;  1NLA A;  3OD2 A;  2BNZ A;  2AY0 A;  1BDV A;  2CPG A;  3FMT A;  2K29 A;  2WVC A;  2CA9 A;  3VW4 A;  1ARQ A;  1P94 A;  2JXH A;  3FT7 A;  1B01 A;  2BA3 A;  4HV0 A;  2RBF A;  3VEB A;  2BJ8 A;  1PAR A;  1MYK A;  2JXI A;  1IRQ A;  1X93 A;  2CAJ A;  2WVF A;  3VEA A;  1EA4 A;  2BJ7 A;  1MYL A;  2CAD A;  2BJ3 A;  2K5J A;  1B28 A;  2WVE A;  3GXQ A;  2BJ9 A;  2BSQ E;  1QTG A;  1BAZ A;  4FXE A;  2K1O A;  2WVB A;  1U9P A;  2KEL A; 
#chains in the Genus database with same CATH topology
 3SYV A;  4E81 A;  3SOG A;  2H3A A;  3F7W A;  4D8J A;  3QOQ A;  4HYB A;  3LMF A;  3FMT A;  4G6Q A;  1TQS A;  3HAJ A;  3BVV A;  3D4Z A;  3D4Y A;  4EZN A;  3LVT A;  4FM3 A;  1EA4 A;  2A2B A;  2YL8 A;  2BJ9 A;  2X3W A;  3B51 X;  5KBP A;  3ZED A;  2OW6 A;  3DX4 A;  2H1O E;  3ER8 C;  5FLE X;  3QID A;  1NLA A;  4JWC A;  3A98 A;  3DDF A;  2ELB A;  3FT7 A;  1MJG A;  2OO2 A;  4JNF A;  2RAJ A;  4M0M A;  3I04 A;  2EWF A;  2O0I 1;  2WVF A;  5C5B A;  1MYL A;  2WVE A;  4EZO A;  3SFG A;  1GNL A;  1BAZ A;  4FXE A;  4EZY A;  2WVB A;  4AZG A;  1B01 A;  2EFL A;  4EZR A;  2WIN M;  2EFK A;  3B52 X;  4EZW A;  1WDZ A;  2NCZ A;  2K29 A;  2QFF A;  4AAI A;  2BA3 A;  1TQV A;  2JXI A;  1X93 A;  3CZN A;  1OA0 A;  3EJU A;  3C7N A;  3BUD A;  1HWW A;  2AN7 A;  1YWM A;  1SH0 A;  3T49 A;  4LQ3 A;  3DPP A;  2CAX A;  2Z0N A;  3BVX A;  2BNZ A;  1I4L A;  2PMR A;  4NRU A;  4WPE A;  3PLT A;  4EZU A;  1MYK A;  3BUQ A;  2Z8Y A;  1GN9 A;  3I2W A;  2ND0 A;  3ER9 B;  2BJ1 A;  3UIT A;  4NSW A;  3BSO A;  2Q13 A;  4EZV A;  1HTY A;  3UQS A;  3O3M B;  4PO2 A;  3DX2 A;  1HXK A;  3DPQ A;  1OAO A;  1TQW A;  3D2E A;  1SU6 A;  3NNE A;  3T48 A;  2F7O A;  2BJ3 A;  2K5J A;  4AZB A;  4R5K A;  4B9Q A;  1E1D A;  3G5O A;  3Q84 A;  2FIC A;  2OZN B;  2Q12 A;  4IWO A;  4JN4 A;  3BVT A;  2LXY A;  1TQU A;  2YIA A;  3BUP A;  3M3W A;  3VEB A;  1ZWW A;  3H5X A;  5E84 A;  4AZC B;  1E9V A;  2RAK A;  3D50 A;  2Z0O A;  3KAV A;  4KIK B;  2K1O A;  3EJP A;  3BVU A;  4NPH A;  4LQ9 A;  2RAI A;  1Q16 A;  2GA9 D;  2KHO A;  4AZ6 A;  2YIV X;  3LJP A;  3VW4 A;  1SIW A;  2RBF A;  2X5C A;  2WK4 A;  2YI8 A;  1IRQ A;  2YL5 A;  2D4C A;  3NAH A;  4EZS A;  1QTG A;  3UPF A;  3D52 A;  4FZO A;  4NQI A;  1Y2O A;  2D1L A;  3D2F A;  4R5I A;  3HAH A;  1UPX A;  2GAF D;  2F7R A;  4ATM A;  4IM0 A;  2N3K A;  3DYT A;  4HY9 A;  4JWE A;  3EJT A;  2F7Q A;  4JWD A;  1SUF A;  4IM2 A;  3OHX M;  2QKW A;  2C08 A;  1SH2 A;  2UUW A;  4IWQ A;  4BNE A;  3B53 X;  3FD9 A;  3QE6 A;  4AZ5 A;  3VEA A;  4UDX X;  4H6H A;  4EZZ A;  4EZQ A;  3L3P A;  2FYV A;  2YL9 A;  1DKZ A;  3QNI A;  1ARR A;  3H5Y A;  3ABH A;  2ALW A;  2JNS A;  3DPO A;  3DX3 A;  2F1B A;  1OG7 A;  1X03 A;  3L3O M;  4EZT A;  3T46 A;  3ERC C;  3BUB A;  3IR7 A;  1OA1 A;  4H6I A;  3NAI A;  1O7D B;  2PY6 A;  4JL9 A;  2WYH A;  2OBM A;  3RPM A;  2ADL A;  2Q2K A;  2RT6 A;  4LRV A;  4QPX A;  2K6L A;  4NRT A;  3LGH A;  4AZC A;  2CPG A;  2QXL A;  4EZP A;  1SU8 A;  4FZS A;  3GI7 A;  4AZH A;  4H8S A;  2YL6 A;  2UUT A;  4AZI A;  4R5G A;  3O3O B;  4ME7 E;  2KKE A;  2GPE A;  1PS3 A;  1URU A;  2YLL A;  1MNT A;  1BDV A;  3DX1 A;  2JXH A;  3Q0K A;  2BJ8 A;  2YLA A;  2CAJ A;  3ACO A;  1GNT A;  2LM0 A;  2Z0V A;  2WYI A;  3VKH A;  1OHN A;  4HR1 B;  5TKY A;  3UR0 A;  3RV0 A;  3D51 A;  4AKV A;  2WVD A;  3OD2 A;  2ZXQ A;  2KOE A;  1QWU A;  2JNK A;  4HR1 A;  2CKW A;  4KIK A;  3OK8 A;  3T47 A;  4AZ7 A;  1DKY A;  3BUI A;  1U00 A;  1ZYL A;  3NO7 A;  1X04 A;  3G9G A;  3O3N B;  4DCN C;  3CAZ A;  1Q5V A;  2HZV A;  3I01 A;  3CKD A;  3OWG A;  2EX3 B;  2CA9 A;  4F00 A;  1O7D C;  2OW7 A;  4HV0 A;  4R5J A;  2X3V A;  4O4R A;  2BJ7 A;  1I4T A;  3CV5 A;  1R5E A;  3HAI A;  3QWE A;  3BVW A;  1I4D A;  3SFU A;  2KEL A;  2YIB A;  2X3X A;  4JLC A;  4R5L A;  1BDT A;  3QNJ A;  3H87 C;  5C5B B;  2AY0 A;  2MI7 A;  2WVC A;  4E3C A;  1W9M A;  2OBL A;  2YI9 A;  1PAR A;  1I49 A;  4DYL A;  1B28 A;  4UDY X;  3GXQ A;  1SU7 A;  3KDR A;  1U9P A;  1R34 A;  3CZS A;  3QA8 A;  2JXG A;  3DX0 A;  4I1Q A;  4AVM A;  4WPC A;  2F1A A;  2HZA A;  5FIG A;  4IWP A;  4MJW A;  3I39 X;  3EJS A;  1ARQ A;  4JWI A;  4JNE A;  1DKX A;  1JQK A;  1R33 A;  3EJR A;  2CAD A;  4IM3 A;  2JBV A;  2GF4 A;  3BSN A;  1E2U A;  1QWN A;  1TQT A;  3BLB A;  2V0O A;  2K9I A;  3KAW A;  3LLL A;  2BNW A;  3DDG A;  1SH3 A;  1LQ7 A;  2F18 A;  3CVR A;  4FZP A;  3RV1 A;  3T4A G;  2ND1 A;  1P94 A;  2F7P A;  1QX1 A;  2B43 A;  4IW0 A;  2YKT A;  4EZX A;  2BSQ E;  3EJQ A;  4F01 A; 
#chains in the Genus database with same CATH homology
 2BJ1 A;  1Q5V A;  2HZV A;  1ARR A;  4E81 A;  3UIT A;  3F7W A;  4D8J A;  2JNS A;  3DPO A;  3QOQ A;  4EZV A;  4HYB A;  3I01 A;  3L3O M;  4EZT A;  3T46 A;  3OWG A;  2EX3 B;  3LMF A;  3O3M B;  4PO2 A;  3FMT A;  4G6Q A;  3ERC C;  3DPQ A;  2CA9 A;  1OAO A;  4F00 A;  3D2E A;  1OA1 A;  4HV0 A;  1SU6 A;  4R5J A;  4EZN A;  4H6I A;  3T48 A;  2PY6 A;  4FM3 A;  1EA4 A;  2BJ7 A;  2BJ3 A;  2K5J A;  4JL9 A;  4R5K A;  2OBM A;  2BJ9 A;  4B9Q A;  1E1D A;  3B51 X;  2RT6 A;  2KEL A;  3ZED A;  2K6L A;  2YIB A;  4JLC A;  2H1O E;  4R5L A;  3LGH A;  3ER8 C;  4IWO A;  4JN4 A;  5FLE X;  1BDT A;  3QNJ A;  3H87 C;  1NLA A;  2AY0 A;  2CPG A;  2QXL A;  4JWC A;  2YIA A;  4EZP A;  2WVC A;  1SU8 A;  3A98 A;  3FT7 A;  1MJG A;  3GI7 A;  1W9M A;  4E3C A;  2OBL A;  2YI9 A;  4JNF A;  3VEB A;  4M0M A;  1PAR A;  3I04 A;  2EWF A;  2WVF A;  1MYL A;  1B28 A;  4UDY X;  5E84 A;  2WVE A;  4EZO A;  1E9V A;  3GXQ A;  3KAV A;  1GNL A;  1BAZ A;  4FXE A;  1SU7 A;  2K1O A;  2WVB A;  3KDR A;  4KIK B;  4EZY A;  4NPH A;  1U9P A;  1B01 A;  4R5G A;  3O3O B;  3QA8 A;  2JXG A;  4ME7 E;  2WIN M;  4EZR A;  3B52 X;  2GPE A;  2GA9 D;  2HZA A;  2KHO A;  1MNT A;  5FIG A;  4EZW A;  4IWP A;  1BDV A;  3I39 X;  2NCZ A;  2K29 A;  2QFF A;  2YIV X;  3VW4 A;  1ARQ A;  2JXH A;  4JWI A;  4JNE A;  2BA3 A;  2RBF A;  1DKX A;  2BJ8 A;  2JXI A;  2X5C A;  2YI8 A;  1IRQ A;  1X93 A;  2CAJ A;  1JQK A;  2CAD A;  1GNT A;  4IM3 A;  1OA0 A;  2LM0 A;  3VKH A;  3C7N A;  4EZS A;  1QTG A;  1E2U A;  4HR1 B;  5TKY A;  3RV0 A;  3D2F A;  3T49 A;  4R5I A;  1UPX A;  3DPP A;  2K9I A;  2GAF D;  3KAW A;  4IM0 A;  2N3K A;  2BNW A;  2CAX A;  4HY9 A;  4JWE A;  4JWD A;  2WVD A;  3OD2 A;  2BNZ A;  1SUF A;  4IM2 A;  3OHX M;  3RV1 A;  4HR1 A;  3T4A G;  2ND1 A;  1P94 A;  4IWQ A;  4KIK A;  3B53 X;  3FD9 A;  1MYK A;  4EZU A;  3VEA A;  4UDX X;  3T47 A;  1DKY A;  1U00 A;  2Z8Y A;  4H6H A;  1ZYL A;  1GN9 A;  4IW0 A;  4EZX A;  4EZZ A;  4EZQ A;  2ND0 A;  2BSQ E;  3O3N B;  3ER9 B;  4F01 A;  1DKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...