The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
60
|
structure length |
60
|
Chain Sequence |
VKMTVTVGEERRARLRTAYTLTHLQEGHRTFSGFIAAALDAEVQRLEQRYNEGRRFENAE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure and centromere binding of the plasmid segregation protein ParB from pCXC100
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
source organism |
Leifsonia xyli subsp. cynodontis
|
molecule keywords |
Putative plasmid related protein
|
total genus |
19
|
structure length |
60
|
sequence length |
60
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-06-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF18064 | ParB_C | Centromere-binding protein ParB C-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant | Arc Repressor Mutant |
#chains in the Genus database with same CATH superfamily 3NO7 A; #chains in the Genus database with same CATH topology 1ARR A; 2UUT A; 1MYL A; 1MNT A; 3BSN A; 4O4R A; 3VW4 A; 2HZA A; 2CAJ A; 1SH2 A; 2BJ8 A; 2WVF A; 3UQS A; 2B43 A; 2WVB A; 2KKE A; 2H1O E; 1OG7 A; 1BAZ A; 3FMT A; 1SH0 A; 4FXE A; 2K29 A; 3NO7 A; 2K1O A; 2BA3 A; 2CA9 A; 3QOQ A; 3IR7 A; 1ARQ A; 3VEA A; 2CPG A; 3G5O A; 3SFG A; 2WVD A; 2H3A A; 3NAH A; 3VEB A; 1X93 A; 1PAR A; 3H5X A; 3H87 C; 3GXQ A; 4NRT A; 2CKW A; 2BSQ E; 2WVE A; 4HV0 A; 1EA4 A; 2HZV A; 2A2B A; 2BJ1 A; 2KEL A; 2BJ3 A; 1OHN A; 2BJ9 A; 2AN7 A; 2CAD A; 1BDV A; 1Q5V A; 3LJP A; 1QTG A; 2BNZ A; 2WVC A; 2K9I A; 4LQ9 A; 1SH3 A; 2JXI A; 3SFU A; 4D8J A; 4NRU A; 2Q2K A; 2AY0 A; 2KOE A; 3H5Y A; 2WK4 A; 4AAI A; 3NAI A; 2BNW A; 2JBV A; 3QID A; 3BSO A; 2JXH A; 2K5J A; 2UUW A; 3LGH A; 4ME7 E; 2JXG A; 1BDT A; 1NLA A; 3UPF A; 3FT7 A; 4LQ3 A; 3OD2 A; 4QPX A; 2GPE A; 1P94 A; 1B01 A; 4LRV A; 3UR0 A; 4MJW A; 1MYK A; 1U9P A; 2CAX A; 1Q16 A; 2RBF A; 2ADL A; 1IRQ A; 2K6L A; 1B28 A; 1SIW A; 3NNE A; 2BJ7 A; #chains in the Genus database with same CATH homology 4LQ3 A; 4QPX A; 2UUT A; 3G5O A; 1SH3 A; 4LQ9 A; 3SFG A; 3BSN A; 3SFU A; 2H3A A; 4NRU A; 4O4R A; 2Q2K A; 3NAH A; 3H5X A; 4LRV A; 4NRT A; 3UR0 A; 2KOE A; 2CKW A; 2WK4 A; 4MJW A; 3H5Y A; 1SH2 A; 3UQS A; 4AAI A; 3NAI A; 2B43 A; 1Q16 A; 2KKE A; 1OG7 A; 2A2B A; 1SH0 A; 2JBV A; 3QID A; 3BSO A; 2ADL A; 1OHN A; 2UUW A; 2AN7 A; 3NO7 A; 3LJP A; 1SIW A; 3NNE A; 3UPF A; 3IR7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...