3NO7A

Crystal structure of the centromere-binding protein parb from plasmid pcxc100
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
60
structure length
60
Chain Sequence
VKMTVTVGEERRARLRTAYTLTHLQEGHRTFSGFIAAALDAEVQRLEQRYNEGRRFENAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and centromere binding of the plasmid segregation protein ParB from pCXC100
pubmed doi rcsb
source organism Leifsonia xyli subsp. cynodontis
molecule tags Dna binding protein
molecule keywords Putative plasmid related protein
total genus 19
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18064 ParB_C Centromere-binding protein ParB C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3no7A00
3NO7A
chains in the Genus database with same CATH superfamily
3GXQA 3G5OA 2K29A 4LQ3A 3LJPA 2HZVA 2CAJA 2BJ7A 1P94A 4MJWA 3H87C 1OHNA 2BSQE 1IRQA 3OD2A 3BSNA 2UUWA 3UQSA 2WVFA 2JXHA 2A2BA 2JXIA 2UUTA 2JBVA 3NAHA 1ARRA 2ADLA 1U9PA 1MYLA 1B01A 2B43A 2BNWA 3QIDA 1EA4A 4NRTA 2BNZA 4LQ9A 2CAXA 4FXEA 2H1OE 2CA9A 2WVBA 2CADA 2K5JA 4LRVA 2WK4A 3LGHA 2AN7A 3BSOA 2CPGA 4AAIA 2RBFA 1B28A 3H5XA 2BJ8A 1NLAA 4HV0A 4O4RA 2BJ3A 3FMTA 1BDTA 1PARA 1QTGA 3UR0A 3VW4A 1OG7A 2GPEA 2BJ1A 1SH2A 2WVDA 2WVEA 3VEAA 2K6LA 3IR7A 2HZAA 3QOQA 1SH3A 1Q5VA 4ME7E 1Q16A 1BDVA 2AY0A 2KOEA 2BA3A 4QPXA 2K9IA 1SH0A 3NO7A 3NAIA 3NNEA 2KELA 2Q2KA 3UPFA 2CKWA 4D8JA 3SFUA 3H5YA 1MNTA 1MYKA 2WVCA 1ARQA 2KKEA 1X93A 2JXGA 3SFGA 2H3AA 1SIWA 4NRUA 3VEBA 3FT7A 2BJ9A 2K1OA 1BAZA
chains in the Genus database with same CATH topology
1SH0A 3NO7A 3NAIA 1SH2A 3NNEA 3QIDA 3G5OA 4LQ3A 3LJPA 4NRTA 4LQ9A 1OG7A 3IR7A 2Q2KA 3UPFA 2CKWA 1SH3A 3SFUA 3H5YA 4LRVA 4MJWA 2WK4A 2AN7A 1Q16A 1OHNA 2KKEA 3BSOA 3BSNA 2UUWA 3SFGA 3UQSA 4AAIA 2H3AA 3H5XA 1SIWA 4NRUA 2A2BA 4O4RA 2UUTA 2KOEA 2JBVA 3NAHA 2ADLA 4QPXA 3UR0A 2B43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NO7 A; 
#chains in the Genus database with same CATH topology
 3GXQ A;  3G5O A;  2K29 A;  4LQ3 A;  3LJP A;  2HZV A;  2CAJ A;  2BJ7 A;  1P94 A;  4MJW A;  3H87 C;  1OHN A;  2BSQ E;  1IRQ A;  3OD2 A;  3BSN A;  2UUW A;  3UQS A;  2WVF A;  2JXH A;  2A2B A;  2JXI A;  2UUT A;  2JBV A;  3NAH A;  1ARR A;  2ADL A;  1U9P A;  1MYL A;  1B01 A;  2B43 A;  2BNW A;  3QID A;  1EA4 A;  4NRT A;  2BNZ A;  4LQ9 A;  2CAX A;  4FXE A;  2H1O E;  2CA9 A;  2WVB A;  2CAD A;  2K5J A;  4LRV A;  2WK4 A;  3LGH A;  2AN7 A;  3BSO A;  2CPG A;  4AAI A;  2RBF A;  1B28 A;  3H5X A;  2BJ8 A;  1NLA A;  4HV0 A;  4O4R A;  2BJ3 A;  3FMT A;  1BDT A;  1PAR A;  1QTG A;  3UR0 A;  3VW4 A;  1OG7 A;  2GPE A;  2BJ1 A;  1SH2 A;  2WVD A;  2WVE A;  3VEA A;  2K6L A;  3IR7 A;  2HZA A;  3QOQ A;  1SH3 A;  1Q5V A;  4ME7 E;  1Q16 A;  1BDV A;  2AY0 A;  2KOE A;  2BA3 A;  4QPX A;  2K9I A;  1SH0 A;  3NO7 A;  3NAI A;  3NNE A;  2KEL A;  2Q2K A;  3UPF A;  2CKW A;  4D8J A;  3SFU A;  3H5Y A;  1MNT A;  1MYK A;  2WVC A;  1ARQ A;  2KKE A;  1X93 A;  2JXG A;  3SFG A;  2H3A A;  1SIW A;  4NRU A;  3VEB A;  3FT7 A;  2BJ9 A;  2K1O A;  1BAZ A; 
#chains in the Genus database with same CATH homology
 1SH0 A;  3NO7 A;  3NAI A;  1SH2 A;  3NNE A;  3QID A;  3G5O A;  4LQ3 A;  3LJP A;  4NRT A;  4LQ9 A;  1OG7 A;  3IR7 A;  2Q2K A;  3UPF A;  2CKW A;  1SH3 A;  3SFU A;  3H5Y A;  4LRV A;  4MJW A;  2WK4 A;  2AN7 A;  1Q16 A;  1OHN A;  2KKE A;  3BSO A;  3BSN A;  2UUW A;  3SFG A;  3UQS A;  4AAI A;  2H3A A;  3H5X A;  1SIW A;  4NRU A;  2A2B A;  4O4R A;  2UUT A;  2KOE A;  2JBV A;  3NAH A;  2ADL A;  4QPX A;  3UR0 A;  2B43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...