3VEBA

Crystal structure of matp-mats
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
b'KYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrodomain Ter protein
molecule tags Dna binding protein/dna
source organism Yersinia pestis
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
total genus 48
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3vebA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3vebA01
2BJ3A 1MNTA 1QTGA 2CA9A 2JXIA 2BJ8A 2WVDA 3LGHA 3VEAA 2HZAA 2RBFA 1Q5VA 1NLAA 2KELA 4FXEA 2BNWA 2BA3A 3VEBA 1P94A 3OD2A 2CAXA 2K1OA 2BJ1A 3GXQA 2K5JA 1EA4A 3VW4A 2K29A 1PARA 1BDTA 1ARRA 2BSQE 2AY0A 1MYKA 2JXGA 1X93A 2CPGA 4HV0A 3QOQA 2CAJA 1B28A 2K6LA 1U9PA 2CADA 2WVFA 2BJ7A 4ME7E 2WVCA 1BDVA 1ARQA 3FT7A 2H1OE 2HZVA 1IRQA 2BNZA 2BJ9A 3FMTA 2WVEA 2WVBA 4D8JA 1B01A 2K9IA 1MYLA 3H87C 1BAZA 2GPEA 2JXHA
chains in the Genus database with same CATH superfamily
1QTGA 1YWMA 3DX3A 4AZ6A 2WINM 2BJ1A 4LRVA 3F7WA 1GNTA 5KBPA 3C7NA 4ME7E 3QWEA 4I1QA 1HWWA 3G5OA 2H3AA 2ND0A 2KOEA 2RAJA 3DX2A 4R5IA 2ND1A 2OW7A 2JXHA 1X04A 4EZTA 3CV5A 3VEAA 3I04A 1GNLA 3GI7A 3OHXM 2CAXA 2K5JA 4R5JA 2PMRA 4FZOA 3BVTA 1X93A 5TKYA 1E9VA 2YKTA 1SU6A 3I01A 4AKVA 3QNJA 3BVUA 4EZWA 4MJWA 3NO7A 2NCZA 1B01A 3CZSA 2X3WA 2EFLA 3H87C 4DCNC 2JXIA 4BNEA 2YLAA 4EZPA 1URUA 3HAHA 4EZYA 3UPFA 4E3CA 2RAIA 3DX4A 1SH2A 2K29A 1ARRA 4NRTA 4EZQA 2X3XA 2WVCA 2YI9A 4AAIA 4IW0A 4AZBA 1R5EA 1R34A 2MI7A 3EJQA 3L3OM 5E84A 1QWNA 3BSNA 4AZCB 3OD2A 3LJPA 3VW4A 4HR1A 2CPGA 3IR7A 4NPHA 3D51A 4AZHA 2YIVX 1Q16A 4G6QA 4EZVA 3I2WA 4JNFA 4EZSA 5C5BA 1SIWA 5FLEX 2OO2A 2V0OA 4O4RA 2HZAA 1NLAA 3BUPA 1I49A 4B9QA 3HAJA 1SH3A 1OHNA 2ZXQA 3PLTA 1WDZA 2JNSA 2GA9D 2UUTA 2CAJA 2QFFA 4AZCA 2X5CA 1TQSA 3QNIA 3QIDA 4JWCA 3ABHA 4FM3A 3KAVA 4KIKA 2EFKA 3ERCC 3EJSA 1Q5VA 2BNWA 3UR0A 3RPMA 1OA0A 5C5BB 4JNEA 1MYKA 2ADLA 3O3NB 4AZ5A 4UDYX 1ARQA 2OZNB 4PO2A 3D4ZA 4R5LA 3BUDA 4WPCA 3ER8C 3UITA 4EZOA 2Q13A 2WVDA 3DPPA 3SFUA 1TQWA 2YLLA 4E81A 2LXYA 4NRUA 2BJ7A 1DKYA 3D2FA 1QX1A 3SYVA 1IRQA 2GAFD 2WVBA 4IWOA 3BUBA 1SUFA 3KDRA 2Z8YA 4FZSA 2D1LA 3NAHA 4EZNA 1I4DA 3GXQA 1DKZA 4JWIA 4IM0A 2D4CA 4NSWA 1OG7A 1U9PA 3B53X 3LMFA 1SU7A 2BNZA 1I4TA 1E2UA 4LQ9A 4HY9A 2K9IA 2EX3B 2F18A 5FIGA 1OAOA 3CAZA 4JWEA 4LQ3A 3QA8A 1I4LA 4AZ7A 3BVXA 3RV0A 4JN4A 3VEBA 3ZEDA 4JL9A 4ATMA 1DKXA 3SFGA 4JLCA 3DX0A 3L3PA 1BDVA 3B51X 3DX1A 2YL8A 1MYLA 2PY6A 4WPEA 3LGHA 3BVVA 2FYVA 2K1OA 4M0MA 4HYBA 1BDTA 2ALWA 2F1AA 4EZZA 2YI8A 2K6LA 2F7RA 4IM3A 1MJGA 3BVWA 2ELBA 2O0I1 3CVRA 1HTYA 4JWDA 3H5YA 3BLBA 3LVTA 3DDFA 2KKEA 2A2BA 3T48A 2Z0NA 3BSOA 2KHOA 1EA4A 3SOGA 3NAIA 3O3MB 2B43A 1B28A 2WVFA 4IWPA 4DYLA 3FD9A 4IM2A 4IWQA 1PS3A 2QKWA 3ER9B 2WVEA 3D4YA 3D50A 1BAZA 1MNTA 4AVMA 2OBMA 2BJ8A 2RBFA 2YIAA 3Q84A 4EZUA 4FXEA 3EJUA 4NQIA 1HXKA 1TQTA 2X3VA 4H8SA 2F1BA 2JNKA 4FZPA 3OK8A 3BUIA 2CADA 1TQVA 3RV1A 4AZIA 2WK4A 3DYTA 3VKHA 1R33A 1Y2OA 3EJPA 1U00A 3D2EA 3UQSA 2GF4A 1W9MA 1UPXA 2QXLA 3H5XA 2YL5A 4H6IA 2F7OA 2KELA 1ZWWA 2AY0A 2RAKA 4AZGA 1ZYLA 2H1OE 3DPOA 3FMTA 2Q12A 3T47A 3CZNA 2UUWA 3CKDA 3LLLA 2BJ3A 2JBVA 3O3OB 4R5GA 1JQKA 1OA1A 2EWFA 1TQUA 1SH0A 2Z0VA 2JXGA 1QWUA 4EZXA 4EZRA 4HR1B 1LQ7A 2WYIA 2HZVA 4F00A 2BJ9A 2F7PA 4D8JA 2Q2KA 3A98A 1GN9A 2Z0OA 3QE6A 3ACOA 1X03A 3BUQA 3KAWA 2BA3A 3OWGA 2AN7A 2N3KA 3EJRA 4UDXX 2YL6A 3QOQA 1SU8A 2YIBA 3G9GA 3NNEA 2WYHA 1O7DB 4F01A 4H6HA 3EJTA 2OBLA 4R5KA 4QPXA 2GPEA 2OW6A 2CKWA 3DDGA 2CA9A 3I39X 4KIKB 2LM0A 3B52X 1P94A 3HAIA 2F7QA 3D52A 2BSQE 2C08A 3T4AG 1O7DC 1E1DA 4HV0A 3T46A 2YL9A 3FT7A 3M3WA 3T49A 3Q0KA 2RT6A 2FICA 3DPQA 1PARA
chains in the Genus database with same CATH topology
1OAOA 5FLEX 1UPXA 1QTGA 2QXLA 4JWEA 3QA8A 2HZAA 4H6IA 2WINM 1NLAA 2KELA 4JN4A 3RV0A 3VEBA 3ZEDA 4B9QA 2BJ1A 4JL9A 3F7WA 2AY0A 1GNTA 1DKXA 3C7NA 2JNSA 2GA9D 2CAJA 1ZYLA 4JLCA 2QFFA 4ME7E 1BDVA 3B51X 2H1OE 2X5CA 2ND0A 3FMTA 3DPOA 3T47A 4JWCA 4R5IA 2ND1A 4FM3A 1MYLA 3KAVA 2JXHA 2BJ3A 2PY6A 4KIKA 4EZTA 3ERCC 3VEAA 3LGHA 1JQKA 3O3OB 4R5GA 3I04A 1GNLA 1Q5VA 2BNWA 1OA1A 2EWFA 3GI7A 1OA0A 3OHXM 2CAXA 2K1OA 4M0MA 4HYBA 2K5JA 4JNEA 4R5JA 1BDTA 1MYKA 2JXGA 3O3NB 1X93A 5TKYA 4EZZA 4EZXA 4EZRA 1E9VA 2YI8A 2K6LA 1SU6A 4HR1B 4IM3A 3I01A 1MJGA 4UDYX 1ARQA 4PO2A 3QNJA 2HZVA 4F00A 2BJ9A 4EZWA 4R5LA 2NCZA 4D8JA 1B01A 3ER8C 3H87C 4JWDA 3A98A 2JXIA 3UITA 4EZOA 1GN9A 4EZPA 2WVDA 3DPPA 3KAWA 2BA3A 3OWGA 3T48A 4EZYA 4E3CA 2N3KA 4E81A 2KHOA 1EA4A 2K29A 1ARRA 3O3MB 4UDXX 3QOQA 1SU8A 2YIBA 1B28A 2WVFA 4EZQA 2BJ7A 4IWPA 2WVCA 2YI9A 3FD9A 4IM2A 1DKYA 3D2FA 4F01A 1IRQA 2GAFD 4IWQA 4H6HA 3ER9B 2WVEA 2WVBA 2OBLA 4R5KA 4IWOA 1SUFA 3KDRA 2Z8YA 4IW0A 1BAZA 2GPEA 1MNTA 2CA9A 2OBMA 2BJ8A 3I39X 2RBFA 3L3OM 2YIAA 4KIKB 5E84A 4EZUA 4FXEA 2LM0A 4EZNA 3B52X 1P94A 3OD2A 3GXQA 1DKZA 3VW4A 4JWIA 2BSQE 4IM0A 3T4AG 4HR1A 1E1DA 2CPGA 4HV0A 3T46A 4NPHA 1U9PA 2CADA 3B53X 3LMFA 3RV1A 1SU7A 3VKHA 3FT7A 3T49A 2BNZA 1W9MA 2RT6A 2YIVX 1U00A 1E2UA 3D2EA 4G6QA 4HY9A 2K9IA 4EZVA 4JNFA 2EX3B 4EZSA 5FIGA 3DPQA 1PARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ3 A;  1MNT A;  1QTG A;  2CA9 A;  2JXI A;  2BJ8 A;  2WVD A;  3LGH A;  3VEA A;  2HZA A;  2RBF A;  1Q5V A;  1NLA A;  2KEL A;  4FXE A;  2BNW A;  2BA3 A;  3VEB A;  1P94 A;  3OD2 A;  2CAX A;  2K1O A;  2BJ1 A;  3GXQ A;  2K5J A;  1EA4 A;  3VW4 A;  2K29 A;  1PAR A;  1BDT A;  1ARR A;  2BSQ E;  2AY0 A;  1MYK A;  2JXG A;  1X93 A;  2CPG A;  4HV0 A;  3QOQ A;  2CAJ A;  1B28 A;  2K6L A;  1U9P A;  2CAD A;  2WVF A;  2BJ7 A;  4ME7 E;  2WVC A;  1BDV A;  1ARQ A;  3FT7 A;  2H1O E;  2HZV A;  1IRQ A;  2BNZ A;  2BJ9 A;  3FMT A;  2WVE A;  2WVB A;  4D8J A;  1B01 A;  2K9I A;  1MYL A;  3H87 C;  1BAZ A;  2GPE A;  2JXH A; 
#chains in the Genus database with same CATH topology
 1QTG A;  1YWM A;  3DX3 A;  4AZ6 A;  2WIN M;  2BJ1 A;  4LRV A;  3F7W A;  1GNT A;  5KBP A;  3C7N A;  4ME7 E;  3QWE A;  4I1Q A;  1HWW A;  3G5O A;  2H3A A;  2ND0 A;  2KOE A;  2RAJ A;  3DX2 A;  4R5I A;  2ND1 A;  2OW7 A;  2JXH A;  1X04 A;  4EZT A;  3CV5 A;  3VEA A;  3I04 A;  1GNL A;  3GI7 A;  3OHX M;  2CAX A;  2K5J A;  4R5J A;  2PMR A;  4FZO A;  3BVT A;  1X93 A;  5TKY A;  1E9V A;  2YKT A;  1SU6 A;  3I01 A;  4AKV A;  3QNJ A;  3BVU A;  4EZW A;  4MJW A;  3NO7 A;  2NCZ A;  1B01 A;  3CZS A;  2X3W A;  2EFL A;  3H87 C;  4DCN C;  2JXI A;  4BNE A;  2YLA A;  4EZP A;  1URU A;  3HAH A;  4EZY A;  3UPF A;  4E3C A;  2RAI A;  3DX4 A;  1SH2 A;  2K29 A;  1ARR A;  4NRT A;  4EZQ A;  2X3X A;  2WVC A;  2YI9 A;  4AAI A;  4IW0 A;  4AZB A;  1R5E A;  1R34 A;  2MI7 A;  3EJQ A;  3L3O M;  5E84 A;  1QWN A;  3BSN A;  4AZC B;  3OD2 A;  3LJP A;  3VW4 A;  4HR1 A;  2CPG A;  3IR7 A;  4NPH A;  3D51 A;  4AZH A;  2YIV X;  1Q16 A;  4G6Q A;  4EZV A;  3I2W A;  4JNF A;  4EZS A;  5C5B A;  1SIW A;  5FLE X;  2OO2 A;  2V0O A;  4O4R A;  2HZA A;  1NLA A;  3BUP A;  1I49 A;  4B9Q A;  3HAJ A;  1SH3 A;  1OHN A;  2ZXQ A;  3PLT A;  1WDZ A;  2JNS A;  2GA9 D;  2UUT A;  2CAJ A;  2QFF A;  4AZC A;  2X5C A;  1TQS A;  3QNI A;  3QID A;  4JWC A;  3ABH A;  4FM3 A;  3KAV A;  4KIK A;  2EFK A;  3ERC C;  3EJS A;  1Q5V A;  2BNW A;  3UR0 A;  3RPM A;  1OA0 A;  5C5B B;  4JNE A;  1MYK A;  2ADL A;  3O3N B;  4AZ5 A;  4UDY X;  1ARQ A;  2OZN B;  4PO2 A;  3D4Z A;  4R5L A;  3BUD A;  4WPC A;  3ER8 C;  3UIT A;  4EZO A;  2Q13 A;  2WVD A;  3DPP A;  3SFU A;  1TQW A;  2YLL A;  4E81 A;  2LXY A;  4NRU A;  2BJ7 A;  1DKY A;  3D2F A;  1QX1 A;  3SYV A;  1IRQ A;  2GAF D;  2WVB A;  4IWO A;  3BUB A;  1SUF A;  3KDR A;  2Z8Y A;  4FZS A;  2D1L A;  3NAH A;  4EZN A;  1I4D A;  3GXQ A;  1DKZ A;  4JWI A;  4IM0 A;  2D4C A;  4NSW A;  1OG7 A;  1U9P A;  3B53 X;  3LMF A;  1SU7 A;  2BNZ A;  1I4T A;  1E2U A;  4LQ9 A;  4HY9 A;  2K9I A;  2EX3 B;  2F18 A;  5FIG A;  1OAO A;  3CAZ A;  4JWE A;  4LQ3 A;  3QA8 A;  1I4L A;  4AZ7 A;  3BVX A;  3RV0 A;  4JN4 A;  3VEB A;  3ZED A;  4JL9 A;  4ATM A;  1DKX A;  3SFG A;  4JLC A;  3DX0 A;  3L3P A;  1BDV A;  3B51 X;  3DX1 A;  2YL8 A;  1MYL A;  2PY6 A;  4WPE A;  3LGH A;  3BVV A;  2FYV A;  2K1O A;  4M0M A;  4HYB A;  1BDT A;  2ALW A;  2F1A A;  4EZZ A;  2YI8 A;  2K6L A;  2F7R A;  4IM3 A;  1MJG A;  3BVW A;  2ELB A;  2O0I 1;  3CVR A;  1HTY A;  4JWD A;  3H5Y A;  3BLB A;  3LVT A;  3DDF A;  2KKE A;  2A2B A;  3T48 A;  2Z0N A;  3BSO A;  2KHO A;  1EA4 A;  3SOG A;  3NAI A;  3O3M B;  2B43 A;  1B28 A;  2WVF A;  4IWP A;  4DYL A;  3FD9 A;  4IM2 A;  4IWQ A;  1PS3 A;  2QKW A;  3ER9 B;  2WVE A;  3D4Y A;  3D50 A;  1BAZ A;  1MNT A;  4AVM A;  2OBM A;  2BJ8 A;  2RBF A;  2YIA A;  3Q84 A;  4EZU A;  4FXE A;  3EJU A;  4NQI A;  1HXK A;  1TQT A;  2X3V A;  4H8S A;  2F1B A;  2JNK A;  4FZP A;  3OK8 A;  3BUI A;  2CAD A;  1TQV A;  3RV1 A;  4AZI A;  2WK4 A;  3DYT A;  3VKH A;  1R33 A;  1Y2O A;  3EJP A;  1U00 A;  3D2E A;  3UQS A;  2GF4 A;  1W9M A;  1UPX A;  2QXL A;  3H5X A;  2YL5 A;  4H6I A;  2F7O A;  2KEL A;  1ZWW A;  2AY0 A;  2RAK A;  4AZG A;  1ZYL A;  2H1O E;  3DPO A;  3FMT A;  2Q12 A;  3T47 A;  3CZN A;  2UUW A;  3CKD A;  3LLL A;  2BJ3 A;  2JBV A;  3O3O B;  4R5G A;  1JQK A;  1OA1 A;  2EWF A;  1TQU A;  1SH0 A;  2Z0V A;  2JXG A;  1QWU A;  4EZX A;  4EZR A;  4HR1 B;  1LQ7 A;  2WYI A;  2HZV A;  4F00 A;  2BJ9 A;  2F7P A;  4D8J A;  2Q2K A;  3A98 A;  1GN9 A;  2Z0O A;  3QE6 A;  3ACO A;  1X03 A;  3BUQ A;  3KAW A;  2BA3 A;  3OWG A;  2AN7 A;  2N3K A;  3EJR A;  4UDX X;  2YL6 A;  3QOQ A;  1SU8 A;  2YIB A;  3G9G A;  3NNE A;  2WYH A;  1O7D B;  4F01 A;  4H6H A;  3EJT A;  2OBL A;  4R5K A;  4QPX A;  2GPE A;  2OW6 A;  2CKW A;  3DDG A;  2CA9 A;  3I39 X;  4KIK B;  2LM0 A;  3B52 X;  1P94 A;  3HAI A;  2F7Q A;  3D52 A;  2BSQ E;  2C08 A;  3T4A G;  1O7D C;  1E1D A;  4HV0 A;  3T46 A;  2YL9 A;  3FT7 A;  3M3W A;  3T49 A;  3Q0K A;  2RT6 A;  2FIC A;  3DPQ A;  1PAR A; 
#chains in the Genus database with same CATH homology
 1OAO A;  5FLE X;  1UPX A;  1QTG A;  2QXL A;  4JWE A;  3QA8 A;  2HZA A;  4H6I A;  2WIN M;  1NLA A;  2KEL A;  4JN4 A;  3RV0 A;  3VEB A;  3ZED A;  4B9Q A;  2BJ1 A;  4JL9 A;  3F7W A;  2AY0 A;  1GNT A;  1DKX A;  3C7N A;  2JNS A;  2GA9 D;  2CAJ A;  1ZYL A;  4JLC A;  2QFF A;  4ME7 E;  1BDV A;  3B51 X;  2H1O E;  2X5C A;  2ND0 A;  3FMT A;  3DPO A;  3T47 A;  4JWC A;  4R5I A;  2ND1 A;  4FM3 A;  1MYL A;  3KAV A;  2JXH A;  2BJ3 A;  2PY6 A;  4KIK A;  4EZT A;  3ERC C;  3VEA A;  3LGH A;  1JQK A;  3O3O B;  4R5G A;  3I04 A;  1GNL A;  1Q5V A;  2BNW A;  1OA1 A;  2EWF A;  3GI7 A;  1OA0 A;  3OHX M;  2CAX A;  2K1O A;  4M0M A;  4HYB A;  2K5J A;  4JNE A;  4R5J A;  1BDT A;  1MYK A;  2JXG A;  3O3N B;  1X93 A;  5TKY A;  4EZZ A;  4EZX A;  4EZR A;  1E9V A;  2YI8 A;  2K6L A;  1SU6 A;  4HR1 B;  4IM3 A;  3I01 A;  1MJG A;  4UDY X;  1ARQ A;  4PO2 A;  3QNJ A;  2HZV A;  4F00 A;  2BJ9 A;  4EZW A;  4R5L A;  2NCZ A;  4D8J A;  1B01 A;  3ER8 C;  3H87 C;  4JWD A;  3A98 A;  2JXI A;  3UIT A;  4EZO A;  1GN9 A;  4EZP A;  2WVD A;  3DPP A;  3KAW A;  2BA3 A;  3OWG A;  3T48 A;  4EZY A;  4E3C A;  2N3K A;  4E81 A;  2KHO A;  1EA4 A;  2K29 A;  1ARR A;  3O3M B;  4UDX X;  3QOQ A;  1SU8 A;  2YIB A;  1B28 A;  2WVF A;  4EZQ A;  2BJ7 A;  4IWP A;  2WVC A;  2YI9 A;  3FD9 A;  4IM2 A;  1DKY A;  3D2F A;  4F01 A;  1IRQ A;  2GAF D;  4IWQ A;  4H6H A;  3ER9 B;  2WVE A;  2WVB A;  2OBL A;  4R5K A;  4IWO A;  1SUF A;  3KDR A;  2Z8Y A;  4IW0 A;  1BAZ A;  2GPE A;  1MNT A;  2CA9 A;  2OBM A;  2BJ8 A;  3I39 X;  2RBF A;  3L3O M;  2YIA A;  4KIK B;  5E84 A;  4EZU A;  4FXE A;  2LM0 A;  4EZN A;  3B52 X;  1P94 A;  3OD2 A;  3GXQ A;  1DKZ A;  3VW4 A;  4JWI A;  2BSQ E;  4IM0 A;  3T4A G;  4HR1 A;  1E1D A;  2CPG A;  4HV0 A;  3T46 A;  4NPH A;  1U9P A;  2CAD A;  3B53 X;  3LMF A;  3RV1 A;  1SU7 A;  3VKH A;  3FT7 A;  3T49 A;  2BNZ A;  1W9M A;  2RT6 A;  2YIV X;  1U00 A;  1E2U A;  3D2E A;  4G6Q A;  4HY9 A;  2K9I A;  4EZV A;  4JNF A;  2EX3 B;  4EZS A;  5FIG A;  3DPQ A;  1PAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...