3VEBA

Crystal structure of matp-mats
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
KYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrodomain Ter protein
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
total genus 48
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3vebA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3vebA01
2BA3A 1X93A 2BJ3A 2CA9A 4FXEA 2RBFA 2K5JA 2BNWA 1ARRA 2JXGA 2WVEA 4HV0A 2BJ9A 2HZAA 1Q5VA 2BJ7A 2WVBA 3H87C 3QOQA 2JXHA 1MNTA 2CAJA 1MYLA 2WVDA 2BJ1A 3FMTA 2K29A 1P94A 1BAZA 3VEBA 1B01A 2HZVA 1IRQA 1PARA 2BSQE 1BDTA 4D8JA 1QTGA 2CADA 2GPEA 2K6LA 4ME7E 3VW4A 1ARQA 2CAXA 2WVCA 2AY0A 2BNZA 1U9PA 3FT7A 2JXIA 2CPGA 3LGHA 2KELA 2H1OE 2WVFA 1NLAA 3GXQA 1EA4A 1MYKA 1BDVA 2K9IA 2K1OA 2BJ8A 3VEAA 1B28A 3OD2A
chains in the Genus database with same CATH superfamily
4O4RA 3SYVA 2F7QA 3BUPA 1ARRA 2WVEA 1Q16A 1X04A 3ACOA 1R33A 4HYBA 4EZWA 1I49A 1W9MA 2LM0A 4WPEA 1SIWA 2D1LA 2WVFA 3T4AG 1QWUA 3UR0A 1OG7A 4F00A 3OD2A 1I4DA 1O7DB 2BJ3A 5TKYA 4AZCB 3H5XA 1E2UA 2KHOA 2CAJA 2WYHA 2YI8A 3FMTA 1TQVA 4JN4A 2V0OA 3ER9B 4FM3A 5FIGA 1HWWA 3O3MB 1X03A 3DDGA 3VEAA 1B28A 2Q13A 4FXEA 4AZCA 3G9GA 2A2BA 3DPOA 1SH3A 4BNEA 1WDZA 3H87C 3BVVA 2B43A 2JNSA 4AKVA 1P94A 4JWCA 3I04A 1HXKA 2LXYA 1OA1A 1TQWA 4EZVA 3DPQA 3VW4A 4H6IA 1E9VA 2GF4A 3UPFA 4QPXA 2FICA 1EA4A 2RAJA 2OO2A 1OA0A 2BNWA 4AZGA 4H8SA 4HV0A 4NRUA 4NPHA 3I39X 4JWDA 3O3OB 3BUDA 4ATMA 1B01A 3T47A 3LJPA 3L3OM 1TQSA 2O0I1 4G6QA 1U9PA 4M0MA 2JXIA 4FZPA 2Z0VA 1BDVA 2WYIA 4JWEA 2UUTA 5C5BB 2JXGA 2OW6A 3LVTA 3BSOA 3BVWA 4R5JA 3I01A 2K29A 3VEBA 4HY9A 1IRQA 3HAHA 1DKZA 4AZ5A 1SU7A 3SOGA 3C7NA 2H1OE 4IWQA 3EJRA 3A98A 4JWIA 3G5OA 1SU8A 1Y2OA 4JLCA 2F7OA 1GN9A 3VKHA 4EZUA 2OZNB 2EX3B 2ELBA 1URUA 3DX1A 2CKWA 1NLAA 3F7WA 1JQKA 3CKDA 3UQSA 2RT6A 3QE6A 3BLBA 2JXHA 2JNKA 2X3VA 3LMFA 3H5YA 2CADA 3SFGA 2ZXQA 1GNLA 2WVCA 2BNZA 3I2WA 1LQ7A 1YWMA 3EJUA 2EFKA 2KELA 3IR7A 2OBLA 2K9IA 1R5EA 2Z8YA 4EZXA 3BVUA 3ABHA 3QIDA 5FLEX 4MJWA 3Q84A 4DYLA 1TQUA 1BAZA 2PMRA 2BSQE 4EZPA 4EZQA 4JL9A 2Z0NA 3D51A 4EZZA 2MI7A 1QWNA 3T49A 3EJQA 4AVMA 2RBFA 3D4YA 3CZNA 2C08A 1TQTA 4NRTA 2F18A 2YKTA 4H6HA 3ZEDA 2YIBA 2BJ1A 4EZRA 1GNTA 4AZHA 3DYTA 4EZSA 2GPEA 4ME7E 4I1QA 1ARQA 4IW0A 2EWFA 2H3AA 3D4ZA 2F7RA 3CZSA 2GA9D 1UPXA 3BUQA 3UITA 2X3WA 1DKYA 3M3WA 5E84A 2HZAA 2YIAA 4NSWA 3D50A 3L3PA 1I4LA 3HAIA 3D52A 3CAZA 3T48A 4F01A 3RV1A 2Q12A 4DCNC 3O3NB 2K6LA 4R5KA 3B51X 2QFFA 3HAJA 4LQ9A 4HR1B 3NO7A 3NNEA 3GI7A 2BJ8A 3KAWA 5C5BA 3NAIA 1X93A 2K5JA 3OWGA 3BUBA 4AZIA 2YIVX 2AN7A 2WVBA 4R5GA 2F7PA 2RAIA 3DDFA 2Z0OA 2OBMA 1PARA 4HR1A 2WK4A 2WINM 3OK8A 3EJTA 1QX1A 2YL5A 1HTYA 4AZ6A 3ERCC 3B52X 3DX2A 2BJ9A 1Q5VA 2BJ7A 2X3XA 3QNJA 2FYVA 4WPCA 1MYLA 3BVXA 4UDXX 3BSNA 1E1DA 2F1BA 3RPMA 1I4TA 4B9QA 2YLAA 3SFUA 2GAFD 4LRVA 3DPPA 2KKEA 2BA3A 2N3KA 3BVTA 4EZYA 2YI9A 2RAKA 2X5CA 2ND0A 1MNTA 2OW7A 4JNFA 1ZWWA 1BDTA 3DX3A 1QTGA 2KOEA 3KDRA 2YLLA 3QA8A 2AY0A 1SU6A 2F1AA 3DX0A 3EJSA 3FT7A 4AZ7A 2CPGA 3LGHA 3GXQA 4EZOA 2QXLA 4JNEA 2YL6A 1PS3A 1O7DC 3LLLA 3DX4A 4IM0A 2JBVA 3RV0A 3EJPA 2ADLA 1R34A 4PO2A 1OHNA 2WVDA 3KAVA 4E3CA 3NAHA 4AAIA 3D2FA 3B53X 1SH2A 3CVRA 2UUWA 1ZYLA 2CA9A 1DKXA 4FZOA 4AZBA 2ALWA 4R5IA 2ND1A 1OAOA 2D4CA 3QOQA 3FD9A 3ER8C 4FZSA 4D8JA 4EZTA 1SH0A 3Q0KA 3D2EA 2CAXA 4UDYX 4LQ3A 4IWPA 4IM2A 4E81A 1MYKA 3CV5A 3OHXM 4NQIA 3QNIA 4IWOA 4KIKB 1U00A 1MJGA 2NCZA 2YL9A 2PY6A 4IM3A 2EFLA 3BUIA 4R5LA 3PLTA 1SUFA 2QKWA 3QWEA 4EZNA 2HZVA 2YL8A 3T46A 5KBPA 2Q2KA 4KIKA 2K1OA
chains in the Genus database with same CATH topology
2BA3A 2N3KA 2RBFA 4EZYA 2YI9A 1ARRA 2JXGA 2WVEA 2X5CA 4H6HA 3ZEDA 2YIBA 2ND0A 1MNTA 4R5JA 4HYBA 2BJ1A 3I01A 2K29A 3VEBA 4EZWA 4EZRA 4HY9A 1W9MA 1IRQA 4JNFA 1DKZA 1GNTA 1BDTA 2LM0A 1QTGA 4EZSA 1SU7A 3C7NA 3KDRA 2GPEA 4ME7E 1ARQA 3QA8A 2AY0A 1SU6A 3FT7A 4IW0A 2EWFA 2CPGA 3LGHA 2H1OE 4IWQA 2WVFA 3GXQA 3T4AG 3A98A 2QXLA 4EZOA 4JWIA 4F00A 4JNEA 3OD2A 1SU8A 2BJ3A 2GA9D 1UPXA 3UITA 4IM0A 3RV0A 1DKYA 5E84A 5TKYA 2HZAA 2YIAA 4JLCA 4PO2A 1E2UA 1GN9A 2KHOA 2CAJA 2WVDA 3T48A 2YI8A 3FMTA 3KAVA 3RV1A 4F01A 4E3CA 4JN4A 3D2FA 3VKHA 4EZUA 3ER9B 2EX3B 3B53X 3O3NB 2K6LA 4R5KA 4FM3A 5FIGA 3B51X 2QFFA 3O3MB 4HR1B 1NLAA 3F7WA 3GI7A 2BJ8A 3VEAA 1B28A 3KAWA 1JQKA 1ZYLA 1X93A 2CA9A 1DKXA 4FXEA 2K5JA 3OWGA 2YIVX 3DPOA 2RT6A 4R5IA 2WVBA 2ND1A 3H87C 1OAOA 4R5GA 3QOQA 2JXHA 2JNSA 1P94A 4JWCA 3I04A 2OBMA 1PARA 3FD9A 3ER8C 1OA1A 4D8JA 3LMFA 4EZTA 2CADA 4EZVA 3VW4A 3DPQA 4HR1A 3D2EA 2CAXA 1GNLA 2WVCA 1E9VA 2BNZA 4H6IA 4UDYX 2WINM 4IWPA 4IM2A 2KELA 4E81A 1EA4A 1MYKA 3OHXM 2OBLA 2K9IA 1OA0A 4IWOA 4KIKB 3ERCC 1U00A 1MJGA 2BNWA 2NCZA 2Z8YA 4EZXA 3B52X 2PY6A 4HV0A 4IM3A 5FLEX 4NPHA 2BJ9A 4R5LA 1Q5VA 2BJ7A 3I39X 3QNJA 3O3OB 4JWDA 1SUFA 1MYLA 1BAZA 1B01A 2HZVA 3T47A 4EZNA 2BSQE 4EZPA 3T46A 3L3OM 4EZQA 4UDXX 4JL9A 4G6QA 1E1DA 1U9PA 4M0MA 2JXIA 4EZZA 4B9QA 4KIKA 1BDVA 2K1OA 2GAFD 3T49A 3DPPA 4JWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA3 A;  1X93 A;  2BJ3 A;  2CA9 A;  4FXE A;  2RBF A;  2K5J A;  2BNW A;  1ARR A;  2JXG A;  2WVE A;  4HV0 A;  2BJ9 A;  2HZA A;  1Q5V A;  2BJ7 A;  2WVB A;  3H87 C;  3QOQ A;  2JXH A;  1MNT A;  2CAJ A;  1MYL A;  2WVD A;  2BJ1 A;  3FMT A;  2K29 A;  1P94 A;  1BAZ A;  3VEB A;  1B01 A;  2HZV A;  1IRQ A;  1PAR A;  2BSQ E;  1BDT A;  4D8J A;  1QTG A;  2CAD A;  2GPE A;  2K6L A;  4ME7 E;  3VW4 A;  1ARQ A;  2CAX A;  2WVC A;  2AY0 A;  2BNZ A;  1U9P A;  3FT7 A;  2JXI A;  2CPG A;  3LGH A;  2KEL A;  2H1O E;  2WVF A;  1NLA A;  3GXQ A;  1EA4 A;  1MYK A;  1BDV A;  2K9I A;  2K1O A;  2BJ8 A;  3VEA A;  1B28 A;  3OD2 A; 
#chains in the Genus database with same CATH topology
 4O4R A;  3SYV A;  2F7Q A;  3BUP A;  1ARR A;  2WVE A;  1Q16 A;  1X04 A;  3ACO A;  1R33 A;  4HYB A;  4EZW A;  1I49 A;  1W9M A;  2LM0 A;  4WPE A;  1SIW A;  2D1L A;  2WVF A;  3T4A G;  1QWU A;  3UR0 A;  1OG7 A;  4F00 A;  3OD2 A;  1I4D A;  1O7D B;  2BJ3 A;  5TKY A;  4AZC B;  3H5X A;  1E2U A;  2KHO A;  2CAJ A;  2WYH A;  2YI8 A;  3FMT A;  1TQV A;  4JN4 A;  2V0O A;  3ER9 B;  4FM3 A;  5FIG A;  1HWW A;  3O3M B;  1X03 A;  3DDG A;  3VEA A;  1B28 A;  2Q13 A;  4FXE A;  4AZC A;  3G9G A;  2A2B A;  3DPO A;  1SH3 A;  4BNE A;  1WDZ A;  3H87 C;  3BVV A;  2B43 A;  2JNS A;  4AKV A;  1P94 A;  4JWC A;  3I04 A;  1HXK A;  2LXY A;  1OA1 A;  1TQW A;  4EZV A;  3DPQ A;  3VW4 A;  4H6I A;  1E9V A;  2GF4 A;  3UPF A;  4QPX A;  2FIC A;  1EA4 A;  2RAJ A;  2OO2 A;  1OA0 A;  2BNW A;  4AZG A;  4H8S A;  4HV0 A;  4NRU A;  4NPH A;  3I39 X;  4JWD A;  3O3O B;  3BUD A;  4ATM A;  1B01 A;  3T47 A;  3LJP A;  3L3O M;  1TQS A;  2O0I 1;  4G6Q A;  1U9P A;  4M0M A;  2JXI A;  4FZP A;  2Z0V A;  1BDV A;  2WYI A;  4JWE A;  2UUT A;  5C5B B;  2JXG A;  2OW6 A;  3LVT A;  3BSO A;  3BVW A;  4R5J A;  3I01 A;  2K29 A;  3VEB A;  4HY9 A;  1IRQ A;  3HAH A;  1DKZ A;  4AZ5 A;  1SU7 A;  3SOG A;  3C7N A;  2H1O E;  4IWQ A;  3EJR A;  3A98 A;  4JWI A;  3G5O A;  1SU8 A;  1Y2O A;  4JLC A;  2F7O A;  1GN9 A;  3VKH A;  4EZU A;  2OZN B;  2EX3 B;  2ELB A;  1URU A;  3DX1 A;  2CKW A;  1NLA A;  3F7W A;  1JQK A;  3CKD A;  3UQS A;  2RT6 A;  3QE6 A;  3BLB A;  2JXH A;  2JNK A;  2X3V A;  3LMF A;  3H5Y A;  2CAD A;  3SFG A;  2ZXQ A;  1GNL A;  2WVC A;  2BNZ A;  3I2W A;  1LQ7 A;  1YWM A;  3EJU A;  2EFK A;  2KEL A;  3IR7 A;  2OBL A;  2K9I A;  1R5E A;  2Z8Y A;  4EZX A;  3BVU A;  3ABH A;  3QID A;  5FLE X;  4MJW A;  3Q84 A;  4DYL A;  1TQU A;  1BAZ A;  2PMR A;  2BSQ E;  4EZP A;  4EZQ A;  4JL9 A;  2Z0N A;  3D51 A;  4EZZ A;  2MI7 A;  1QWN A;  3T49 A;  3EJQ A;  4AVM A;  2RBF A;  3D4Y A;  3CZN A;  2C08 A;  1TQT A;  4NRT A;  2F18 A;  2YKT A;  4H6H A;  3ZED A;  2YIB A;  2BJ1 A;  4EZR A;  1GNT A;  4AZH A;  3DYT A;  4EZS A;  2GPE A;  4ME7 E;  4I1Q A;  1ARQ A;  4IW0 A;  2EWF A;  2H3A A;  3D4Z A;  2F7R A;  3CZS A;  2GA9 D;  1UPX A;  3BUQ A;  3UIT A;  2X3W A;  1DKY A;  3M3W A;  5E84 A;  2HZA A;  2YIA A;  4NSW A;  3D50 A;  3L3P A;  1I4L A;  3HAI A;  3D52 A;  3CAZ A;  3T48 A;  4F01 A;  3RV1 A;  2Q12 A;  4DCN C;  3O3N B;  2K6L A;  4R5K A;  3B51 X;  2QFF A;  3HAJ A;  4LQ9 A;  4HR1 B;  3NO7 A;  3NNE A;  3GI7 A;  2BJ8 A;  3KAW A;  5C5B A;  3NAI A;  1X93 A;  2K5J A;  3OWG A;  3BUB A;  4AZI A;  2YIV X;  2AN7 A;  2WVB A;  4R5G A;  2F7P A;  2RAI A;  3DDF A;  2Z0O A;  2OBM A;  1PAR A;  4HR1 A;  2WK4 A;  2WIN M;  3OK8 A;  3EJT A;  1QX1 A;  2YL5 A;  1HTY A;  4AZ6 A;  3ERC C;  3B52 X;  3DX2 A;  2BJ9 A;  1Q5V A;  2BJ7 A;  2X3X A;  3QNJ A;  2FYV A;  4WPC A;  1MYL A;  3BVX A;  4UDX X;  3BSN A;  1E1D A;  2F1B A;  3RPM A;  1I4T A;  4B9Q A;  2YLA A;  3SFU A;  2GAF D;  4LRV A;  3DPP A;  2KKE A;  2BA3 A;  2N3K A;  3BVT A;  4EZY A;  2YI9 A;  2RAK A;  2X5C A;  2ND0 A;  1MNT A;  2OW7 A;  4JNF A;  1ZWW A;  1BDT A;  3DX3 A;  1QTG A;  2KOE A;  3KDR A;  2YLL A;  3QA8 A;  2AY0 A;  1SU6 A;  2F1A A;  3DX0 A;  3EJS A;  3FT7 A;  4AZ7 A;  2CPG A;  3LGH A;  3GXQ A;  4EZO A;  2QXL A;  4JNE A;  2YL6 A;  1PS3 A;  1O7D C;  3LLL A;  3DX4 A;  4IM0 A;  2JBV A;  3RV0 A;  3EJP A;  2ADL A;  1R34 A;  4PO2 A;  1OHN A;  2WVD A;  3KAV A;  4E3C A;  3NAH A;  4AAI A;  3D2F A;  3B53 X;  1SH2 A;  3CVR A;  2UUW A;  1ZYL A;  2CA9 A;  1DKX A;  4FZO A;  4AZB A;  2ALW A;  4R5I A;  2ND1 A;  1OAO A;  2D4C A;  3QOQ A;  3FD9 A;  3ER8 C;  4FZS A;  4D8J A;  4EZT A;  1SH0 A;  3Q0K A;  3D2E A;  2CAX A;  4UDY X;  4LQ3 A;  4IWP A;  4IM2 A;  4E81 A;  1MYK A;  3CV5 A;  3OHX M;  4NQI A;  3QNI A;  4IWO A;  4KIK B;  1U00 A;  1MJG A;  2NCZ A;  2YL9 A;  2PY6 A;  4IM3 A;  2EFL A;  3BUI A;  4R5L A;  3PLT A;  1SUF A;  2QKW A;  3QWE A;  4EZN A;  2HZV A;  2YL8 A;  3T46 A;  5KBP A;  2Q2K A;  4KIK A;  2K1O A; 
#chains in the Genus database with same CATH homology
 2BA3 A;  2N3K A;  2RBF A;  4EZY A;  2YI9 A;  1ARR A;  2JXG A;  2WVE A;  2X5C A;  4H6H A;  3ZED A;  2YIB A;  2ND0 A;  1MNT A;  4R5J A;  4HYB A;  2BJ1 A;  3I01 A;  2K29 A;  3VEB A;  4EZW A;  4EZR A;  4HY9 A;  1W9M A;  1IRQ A;  4JNF A;  1DKZ A;  1GNT A;  1BDT A;  2LM0 A;  1QTG A;  4EZS A;  1SU7 A;  3C7N A;  3KDR A;  2GPE A;  4ME7 E;  1ARQ A;  3QA8 A;  2AY0 A;  1SU6 A;  3FT7 A;  4IW0 A;  2EWF A;  2CPG A;  3LGH A;  2H1O E;  4IWQ A;  2WVF A;  3GXQ A;  3T4A G;  3A98 A;  2QXL A;  4EZO A;  4JWI A;  4F00 A;  4JNE A;  3OD2 A;  1SU8 A;  2BJ3 A;  2GA9 D;  1UPX A;  3UIT A;  4IM0 A;  3RV0 A;  1DKY A;  5E84 A;  5TKY A;  2HZA A;  2YIA A;  4JLC A;  4PO2 A;  1E2U A;  1GN9 A;  2KHO A;  2CAJ A;  2WVD A;  3T48 A;  2YI8 A;  3FMT A;  3KAV A;  3RV1 A;  4F01 A;  4E3C A;  4JN4 A;  3D2F A;  3VKH A;  4EZU A;  3ER9 B;  2EX3 B;  3B53 X;  3O3N B;  2K6L A;  4R5K A;  4FM3 A;  5FIG A;  3B51 X;  2QFF A;  3O3M B;  4HR1 B;  1NLA A;  3F7W A;  3GI7 A;  2BJ8 A;  3VEA A;  1B28 A;  3KAW A;  1JQK A;  1ZYL A;  1X93 A;  2CA9 A;  1DKX A;  4FXE A;  2K5J A;  3OWG A;  2YIV X;  3DPO A;  2RT6 A;  4R5I A;  2WVB A;  2ND1 A;  3H87 C;  1OAO A;  4R5G A;  3QOQ A;  2JXH A;  2JNS A;  1P94 A;  4JWC A;  3I04 A;  2OBM A;  1PAR A;  3FD9 A;  3ER8 C;  1OA1 A;  4D8J A;  3LMF A;  4EZT A;  2CAD A;  4EZV A;  3VW4 A;  3DPQ A;  4HR1 A;  3D2E A;  2CAX A;  1GNL A;  2WVC A;  1E9V A;  2BNZ A;  4H6I A;  4UDY X;  2WIN M;  4IWP A;  4IM2 A;  2KEL A;  4E81 A;  1EA4 A;  1MYK A;  3OHX M;  2OBL A;  2K9I A;  1OA0 A;  4IWO A;  4KIK B;  3ERC C;  1U00 A;  1MJG A;  2BNW A;  2NCZ A;  2Z8Y A;  4EZX A;  3B52 X;  2PY6 A;  4HV0 A;  4IM3 A;  5FLE X;  4NPH A;  2BJ9 A;  4R5L A;  1Q5V A;  2BJ7 A;  3I39 X;  3QNJ A;  3O3O B;  4JWD A;  1SUF A;  1MYL A;  1BAZ A;  1B01 A;  2HZV A;  3T47 A;  4EZN A;  2BSQ E;  4EZP A;  3T46 A;  3L3O M;  4EZQ A;  4UDX X;  4JL9 A;  4G6Q A;  1E1D A;  1U9P A;  4M0M A;  2JXI A;  4EZZ A;  4B9Q A;  4KIK A;  1BDV A;  2K1O A;  2GAF D;  3T49 A;  3DPP A;  4JWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...