3VEBA

Crystal structure of matp-mats
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
KYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
molecule keywords Macrodomain Ter protein
total genus 48
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3vebA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3vebA01
2BNZA 2BA3A 4HV0A 1ARQA 4FXEA 2K6LA 2KELA 2K1OA 3GXQA 2K9IA 2BJ3A 3QOQA 3FT7A 2BJ8A 2CPGA 1U9PA 2WVEA 3VW4A 1PARA 2CADA 2K29A 2WVDA 1ARRA 2BJ9A 2WVBA 1MYKA 2WVFA 3VEBA 2HZAA 2GPEA 3LGHA 2BSQE 2H1OE 4D8JA 2K5JA 2BJ7A 1IRQA 1NLAA 2BJ1A 3H87C 4ME7E 1BDTA 2CA9A 1MNTA 2JXIA 1X93A 2AY0A 3OD2A 1BAZA 1EA4A 2CAXA 3VEAA 1B28A 1Q5VA 2HZVA 2CAJA 2WVCA 1QTGA 2JXHA 1BDVA 2BNWA 1B01A 2JXGA 1MYLA 2RBFA 3FMTA 1P94A
chains in the Genus database with same CATH superfamily
1ARQA 3RV0A 2YL5A 2GF4A 3GXQA 4KIKA 2RAIA 3EJUA 4AZCA 3L3PA 4DCNC 5C5BA 3ER9B 1LQ7A 4NQIA 4AZIA 3FD9A 1I4LA 1PS3A 3DPOA 1R5EA 4JWDA 3L3OM 3BVVA 2Z0NA 3OD2A 2RAJA 2JNSA 3ER8C 1SUFA 1B01A 3DDGA 1QWUA 2Q13A 1W9MA 3EJSA 2QKWA 3C7NA 3BUQA 3BUIA 3OK8A 5FLEX 4EZUA 3DDFA 3SFUA 2KKEA 4DYLA 2ELBA 2F1AA 2F7PA 4WPCA 2ADLA 2V0OA 2AN7A 2YKTA 2YL9A 2H1OE 4E81A 3EJQA 2Q12A 2KHOA 1QX1A 3F7WA 3VEAA 3BSNA 3QNJA 2Q2KA 3DPPA 4H6HA 1MYLA 4G6QA 4AZCB 3BVUA 1U9PA 3LMFA 4R5JA 4EZVA 3M3WA 2K29A 3NAHA 2FICA 4IWPA 2BJ1A 2F7RA 3SYVA 3T49A 3DX1A 4JNFA 4EZRA 2D1LA 2YL6A 3LVTA 4FXEA 3I04A 2WVEA 1MJGA 4NRUA 3NAIA 1ZWWA 2UUWA 3LJPA 1I4TA 4EZWA 2QFFA 3LLLA 4H8SA 2WVFA 2K5JA 2BJ7A 4ATMA 3HAIA 3CKDA 4UDXX 2HZVA 4LRVA 3BVTA 3BSOA 3UR0A 1SH2A 2C08A 4BNEA 2K9IA 4IW0A 2ND0A 3D2EA 2B43A 3D2FA 1OA0A 3KAVA 1Y2OA 3EJTA 4AAIA 3Q84A 1SH0A 2OO2A 4ME7E 3D52A 2EX3B 2JXGA 4JN4A 2CPGA 1R33A 1OG7A 4HY9A 3T4AG 1OAOA 1JQKA 1HWWA 4PO2A 2HZAA 4EZTA 5KBPA 2YLAA 2YI9A 1WDZA 2QXLA 2OBLA 3QNIA 4R5IA 1QWNA 2LM0A 2NCZA 3I2WA 4AVMA 2GA9D 3O3OB 2Z0OA 4FZPA 3DX4A 4R5KA 2CADA 3EJRA 4MJWA 3SOGA 3T48A 3BUPA 1BAZA 1R34A 2ZXQA 2F7QA 1QTGA 1BDVA 5FIGA 4E3CA 2LXYA 3A98A 2WK4A 3ABHA 1UPXA 3H5XA 5E84A 1ZYLA 1TQSA 3UPFA 2GPEA 4D8JA 1SU7A 1NLAA 1X93A 2AY0A 2UUTA 3BUBA 1I49A 3O3MB 2PY6A 3D51A 2ND1A 3FT7A 4KIKB 5C5BB 1TQTA 3QIDA 2F7OA 2OW7A 3CZNA 2KOEA 3ACOA 2PMRA 2YLLA 2YI8A 4HR1B 1IRQA 2CA9A 1YWMA 3GI7A 1E2UA 3PLTA 1B28A 1Q5VA 2RT6A 4UDYX 4WPEA 3G9GA 2RBFA 4EZOA 2YIBA 3BVWA 3I01A 2X3WA 1TQVA 2EFLA 1ARRA 2WVBA 2O0I1 4AZHA 4JNEA 4F01A 1TQWA 3QA8A 2WINM 1HTYA 3H87C 2D4CA 3D4YA 2X3XA 4NRTA 3FMTA 3T47A 4IM3A 2K6LA 2JNKA 2KELA 3T46A 4O4RA 3HAHA 1MYKA 4AZBA 2OBMA 2RAKA 4NSWA 3CVRA 2CAXA 1OA1A 3B52X 4M0MA 1X04A 4HV0A 1X03A 4EZQA 2FYVA 2YL8A 3I39X 3BLBA 2F18A 3HAJA 4IWQA 1GNTA 3UITA 3KAWA 4FZOA 3VEBA 3LGHA 2BSQE 4IM2A 3G5OA 1TQUA 1MNTA 4FM3A 4R5GA 2CAJA 2JXHA 3DX3A 4EZPA 3IR7A 2BA3A 4AKVA 2OW6A 4HYBA 2BJ8A 1O7DB 3OHXM 3ZEDA 3UQSA 2N3KA 2MI7A 3D50A 1OHNA 1SU8A 2CKWA 4JWEA 2H3AA 3SFGA 4I1QA 4EZNA 1O7DC 2JXIA 4FZSA 3O3NB 3DPQA 4LQ3A 4R5LA 2WVCA 4QPXA 1EA4A 1E1DA 1E9VA 2K1OA 2BJ3A 4EZZA 2Z8YA 2F1BA 2X3VA 4B9QA 2WVDA 3B53X 4EZXA 3H5YA 3CV5A 2YIVX 1BDTA 2X5CA 4LQ9A 1GNLA 2GAFD 4IM0A 2EWFA 3DX0A 2BNZA 3QWEA 4HR1A 4EZYA 3BUDA 3VW4A 3CZSA 3NO7A 3OWGA 4JWCA 4JLCA 1GN9A 4AZ6A 3D4ZA 3QE6A 3B51X 4JWIA 4AZ5A 2EFKA 4EZSA 2OZNB 2A2BA 2Z0VA 1SIWA 1HXKA 3KDRA 2BNWA 4H6IA 4JL9A 1P94A 3ERCC 4AZGA 3QOQA 1U00A 1Q16A 3DYTA 1DKXA 3NNEA 4IWOA 4AZ7A 2ALWA 1SU6A 1I4DA 1PARA 2BJ9A 3Q0KA 3EJPA 1URUA 3CAZA 2WYHA 3VKHA 2WYIA 2JBVA 1DKYA 3DX2A 3BVXA 1DKZA 4NPHA 5TKYA 3RPMA 1SH3A 3RV1A 2YIAA 4F00A
chains in the Genus database with same CATH topology
2BA3A 1ARQA 2ND1A 3RV0A 3GXQA 4KIKA 2K9IA 4HYBA 3FT7A 2BJ8A 4KIKB 3OHXM 4IW0A 3ZEDA 2ND0A 3D2EA 2N3KA 3ER9B 3D2FA 1OA0A 3KAVA 3FD9A 1SU8A 2YI8A 4JWEA 4HR1B 3DPOA 4EZNA 1IRQA 4JWDA 4ME7E 2CA9A 2JXIA 3L3OM 2EX3B 3O3NB 3OD2A 3GI7A 1E2UA 3DPQA 2JNSA 1B28A 4R5LA 1Q5VA 3ER8C 2WVCA 2RT6A 4UDYX 1SUFA 1B01A 2JXGA 2RBFA 1EA4A 4JN4A 1E1DA 1E9VA 4EZOA 3C7NA 1W9MA 2YIBA 2K1OA 5FLEX 2BJ3A 3I01A 4EZUA 2CPGA 4EZZA 2Z8YA 4HY9A 3T4AG 4B9QA 1OAOA 1JQKA 2WVDA 3B53X 1ARRA 2WVBA 4PO2A 4JNEA 4EZXA 2HZAA 4EZTA 4F01A 3QA8A 2H1OE 4E81A 2WINM 2YI9A 4EZPA 2YIVX 3H87C 1BDTA 2X5CA 2KHOA 2QXLA 1GNLA 2OBLA 3VEAA 2GAFD 3F7WA 3QNJA 4R5IA 3DPPA 4IM0A 2LM0A 2NCZA 2EWFA 1MYLA 4H6HA 3FMTA 2BNZA 3T47A 4IM3A 2K6LA 4G6QA 2KELA 2GA9D 1U9PA 3T46A 4HR1A 3O3OB 3LMFA 4R5JA 4EZVA 4EZYA 3VW4A 4R5KA 3OWGA 2CADA 2K29A 4JWCA 4JLCA 1GN9A 1MYKA 4IWPA 2OBMA 3B51X 4JWIA 4EZSA 2BJ1A 3T48A 1BAZA 2CAXA 1OA1A 3T49A 3B52X 4M0MA 4JNFA 1QTGA 1BDVA 3KDRA 4H6IA 2BNWA 5FIGA 4EZRA 4JL9A 1P94A 4HV0A 4FXEA 4EZQA 3I04A 3ERCC 3QOQA 4E3CA 1U00A 2WVEA 1MJGA 3I39X 1DKXA 3A98A 4IWOA 1SU6A 1UPXA 1PARA 4IWQA 4EZWA 2BJ9A 1GNTA 2QFFA 3UITA 3O3MB 5E84A 1ZYLA 3KAWA 2WVFA 3VEBA 2GPEA 3LGHA 2BSQE 3VKHA 4D8JA 2K5JA 1DKYA 2BJ7A 1SU7A 1NLAA 4IM2A 5TKYA 1DKZA 4NPHA 1MNTA 4FM3A 1X93A 4R5GA 2AY0A 4UDXX 3RV1A 2HZVA 2CAJA 2JXHA 2YIAA 2PY6A 4F00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNZ A;  2BA3 A;  4HV0 A;  1ARQ A;  4FXE A;  2K6L A;  2KEL A;  2K1O A;  3GXQ A;  2K9I A;  2BJ3 A;  3QOQ A;  3FT7 A;  2BJ8 A;  2CPG A;  1U9P A;  2WVE A;  3VW4 A;  1PAR A;  2CAD A;  2K29 A;  2WVD A;  1ARR A;  2BJ9 A;  2WVB A;  1MYK A;  2WVF A;  3VEB A;  2HZA A;  2GPE A;  3LGH A;  2BSQ E;  2H1O E;  4D8J A;  2K5J A;  2BJ7 A;  1IRQ A;  1NLA A;  2BJ1 A;  3H87 C;  4ME7 E;  1BDT A;  2CA9 A;  1MNT A;  2JXI A;  1X93 A;  2AY0 A;  3OD2 A;  1BAZ A;  1EA4 A;  2CAX A;  3VEA A;  1B28 A;  1Q5V A;  2HZV A;  2CAJ A;  2WVC A;  1QTG A;  2JXH A;  1BDV A;  2BNW A;  1B01 A;  2JXG A;  1MYL A;  2RBF A;  3FMT A;  1P94 A; 
#chains in the Genus database with same CATH topology
 1ARQ A;  3RV0 A;  2YL5 A;  2GF4 A;  3GXQ A;  4KIK A;  2RAI A;  3EJU A;  4AZC A;  3L3P A;  4DCN C;  5C5B A;  3ER9 B;  1LQ7 A;  4NQI A;  4AZI A;  3FD9 A;  1I4L A;  1PS3 A;  3DPO A;  1R5E A;  4JWD A;  3L3O M;  3BVV A;  2Z0N A;  3OD2 A;  2RAJ A;  2JNS A;  3ER8 C;  1SUF A;  1B01 A;  3DDG A;  1QWU A;  2Q13 A;  1W9M A;  3EJS A;  2QKW A;  3C7N A;  3BUQ A;  3BUI A;  3OK8 A;  5FLE X;  4EZU A;  3DDF A;  3SFU A;  2KKE A;  4DYL A;  2ELB A;  2F1A A;  2F7P A;  4WPC A;  2ADL A;  2V0O A;  2AN7 A;  2YKT A;  2YL9 A;  2H1O E;  4E81 A;  3EJQ A;  2Q12 A;  2KHO A;  1QX1 A;  3F7W A;  3VEA A;  3BSN A;  3QNJ A;  2Q2K A;  3DPP A;  4H6H A;  1MYL A;  4G6Q A;  4AZC B;  3BVU A;  1U9P A;  3LMF A;  4R5J A;  4EZV A;  3M3W A;  2K29 A;  3NAH A;  2FIC A;  4IWP A;  2BJ1 A;  2F7R A;  3SYV A;  3T49 A;  3DX1 A;  4JNF A;  4EZR A;  2D1L A;  2YL6 A;  3LVT A;  4FXE A;  3I04 A;  2WVE A;  1MJG A;  4NRU A;  3NAI A;  1ZWW A;  2UUW A;  3LJP A;  1I4T A;  4EZW A;  2QFF A;  3LLL A;  4H8S A;  2WVF A;  2K5J A;  2BJ7 A;  4ATM A;  3HAI A;  3CKD A;  4UDX X;  2HZV A;  4LRV A;  3BVT A;  3BSO A;  3UR0 A;  1SH2 A;  2C08 A;  4BNE A;  2K9I A;  4IW0 A;  2ND0 A;  3D2E A;  2B43 A;  3D2F A;  1OA0 A;  3KAV A;  1Y2O A;  3EJT A;  4AAI A;  3Q84 A;  1SH0 A;  2OO2 A;  4ME7 E;  3D52 A;  2EX3 B;  2JXG A;  4JN4 A;  2CPG A;  1R33 A;  1OG7 A;  4HY9 A;  3T4A G;  1OAO A;  1JQK A;  1HWW A;  4PO2 A;  2HZA A;  4EZT A;  5KBP A;  2YLA A;  2YI9 A;  1WDZ A;  2QXL A;  2OBL A;  3QNI A;  4R5I A;  1QWN A;  2LM0 A;  2NCZ A;  3I2W A;  4AVM A;  2GA9 D;  3O3O B;  2Z0O A;  4FZP A;  3DX4 A;  4R5K A;  2CAD A;  3EJR A;  4MJW A;  3SOG A;  3T48 A;  3BUP A;  1BAZ A;  1R34 A;  2ZXQ A;  2F7Q A;  1QTG A;  1BDV A;  5FIG A;  4E3C A;  2LXY A;  3A98 A;  2WK4 A;  3ABH A;  1UPX A;  3H5X A;  5E84 A;  1ZYL A;  1TQS A;  3UPF A;  2GPE A;  4D8J A;  1SU7 A;  1NLA A;  1X93 A;  2AY0 A;  2UUT A;  3BUB A;  1I49 A;  3O3M B;  2PY6 A;  3D51 A;  2ND1 A;  3FT7 A;  4KIK B;  5C5B B;  1TQT A;  3QID A;  2F7O A;  2OW7 A;  3CZN A;  2KOE A;  3ACO A;  2PMR A;  2YLL A;  2YI8 A;  4HR1 B;  1IRQ A;  2CA9 A;  1YWM A;  3GI7 A;  1E2U A;  3PLT A;  1B28 A;  1Q5V A;  2RT6 A;  4UDY X;  4WPE A;  3G9G A;  2RBF A;  4EZO A;  2YIB A;  3BVW A;  3I01 A;  2X3W A;  1TQV A;  2EFL A;  1ARR A;  2WVB A;  2O0I 1;  4AZH A;  4JNE A;  4F01 A;  1TQW A;  3QA8 A;  2WIN M;  1HTY A;  3H87 C;  2D4C A;  3D4Y A;  2X3X A;  4NRT A;  3FMT A;  3T47 A;  4IM3 A;  2K6L A;  2JNK A;  2KEL A;  3T46 A;  4O4R A;  3HAH A;  1MYK A;  4AZB A;  2OBM A;  2RAK A;  4NSW A;  3CVR A;  2CAX A;  1OA1 A;  3B52 X;  4M0M A;  1X04 A;  4HV0 A;  1X03 A;  4EZQ A;  2FYV A;  2YL8 A;  3I39 X;  3BLB A;  2F18 A;  3HAJ A;  4IWQ A;  1GNT A;  3UIT A;  3KAW A;  4FZO A;  3VEB A;  3LGH A;  2BSQ E;  4IM2 A;  3G5O A;  1TQU A;  1MNT A;  4FM3 A;  4R5G A;  2CAJ A;  2JXH A;  3DX3 A;  4EZP A;  3IR7 A;  2BA3 A;  4AKV A;  2OW6 A;  4HYB A;  2BJ8 A;  1O7D B;  3OHX M;  3ZED A;  3UQS A;  2N3K A;  2MI7 A;  3D50 A;  1OHN A;  1SU8 A;  2CKW A;  4JWE A;  2H3A A;  3SFG A;  4I1Q A;  4EZN A;  1O7D C;  2JXI A;  4FZS A;  3O3N B;  3DPQ A;  4LQ3 A;  4R5L A;  2WVC A;  4QPX A;  1EA4 A;  1E1D A;  1E9V A;  2K1O A;  2BJ3 A;  4EZZ A;  2Z8Y A;  2F1B A;  2X3V A;  4B9Q A;  2WVD A;  3B53 X;  4EZX A;  3H5Y A;  3CV5 A;  2YIV X;  1BDT A;  2X5C A;  4LQ9 A;  1GNL A;  2GAF D;  4IM0 A;  2EWF A;  3DX0 A;  2BNZ A;  3QWE A;  4HR1 A;  4EZY A;  3BUD A;  3VW4 A;  3CZS A;  3NO7 A;  3OWG A;  4JWC A;  4JLC A;  1GN9 A;  4AZ6 A;  3D4Z A;  3QE6 A;  3B51 X;  4JWI A;  4AZ5 A;  2EFK A;  4EZS A;  2OZN B;  2A2B A;  2Z0V A;  1SIW A;  1HXK A;  3KDR A;  2BNW A;  4H6I A;  4JL9 A;  1P94 A;  3ERC C;  4AZG A;  3QOQ A;  1U00 A;  1Q16 A;  3DYT A;  1DKX A;  3NNE A;  4IWO A;  4AZ7 A;  2ALW A;  1SU6 A;  1I4D A;  1PAR A;  2BJ9 A;  3Q0K A;  3EJP A;  1URU A;  3CAZ A;  2WYH A;  3VKH A;  2WYI A;  2JBV A;  1DKY A;  3DX2 A;  3BVX A;  1DKZ A;  4NPH A;  5TKY A;  3RPM A;  1SH3 A;  3RV1 A;  2YIA A;  4F00 A; 
#chains in the Genus database with same CATH homology
 2BA3 A;  1ARQ A;  2ND1 A;  3RV0 A;  3GXQ A;  4KIK A;  2K9I A;  4HYB A;  3FT7 A;  2BJ8 A;  4KIK B;  3OHX M;  4IW0 A;  3ZED A;  2ND0 A;  3D2E A;  2N3K A;  3ER9 B;  3D2F A;  1OA0 A;  3KAV A;  3FD9 A;  1SU8 A;  2YI8 A;  4JWE A;  4HR1 B;  3DPO A;  4EZN A;  1IRQ A;  4JWD A;  4ME7 E;  2CA9 A;  2JXI A;  3L3O M;  2EX3 B;  3O3N B;  3OD2 A;  3GI7 A;  1E2U A;  3DPQ A;  2JNS A;  1B28 A;  4R5L A;  1Q5V A;  3ER8 C;  2WVC A;  2RT6 A;  4UDY X;  1SUF A;  1B01 A;  2JXG A;  2RBF A;  1EA4 A;  4JN4 A;  1E1D A;  1E9V A;  4EZO A;  3C7N A;  1W9M A;  2YIB A;  2K1O A;  5FLE X;  2BJ3 A;  3I01 A;  4EZU A;  2CPG A;  4EZZ A;  2Z8Y A;  4HY9 A;  3T4A G;  4B9Q A;  1OAO A;  1JQK A;  2WVD A;  3B53 X;  1ARR A;  2WVB A;  4PO2 A;  4JNE A;  4EZX A;  2HZA A;  4EZT A;  4F01 A;  3QA8 A;  2H1O E;  4E81 A;  2WIN M;  2YI9 A;  4EZP A;  2YIV X;  3H87 C;  1BDT A;  2X5C A;  2KHO A;  2QXL A;  1GNL A;  2OBL A;  3VEA A;  2GAF D;  3F7W A;  3QNJ A;  4R5I A;  3DPP A;  4IM0 A;  2LM0 A;  2NCZ A;  2EWF A;  1MYL A;  4H6H A;  3FMT A;  2BNZ A;  3T47 A;  4IM3 A;  2K6L A;  4G6Q A;  2KEL A;  2GA9 D;  1U9P A;  3T46 A;  4HR1 A;  3O3O B;  3LMF A;  4R5J A;  4EZV A;  4EZY A;  3VW4 A;  4R5K A;  3OWG A;  2CAD A;  2K29 A;  4JWC A;  4JLC A;  1GN9 A;  1MYK A;  4IWP A;  2OBM A;  3B51 X;  4JWI A;  4EZS A;  2BJ1 A;  3T48 A;  1BAZ A;  2CAX A;  1OA1 A;  3T49 A;  3B52 X;  4M0M A;  4JNF A;  1QTG A;  1BDV A;  3KDR A;  4H6I A;  2BNW A;  5FIG A;  4EZR A;  4JL9 A;  1P94 A;  4HV0 A;  4FXE A;  4EZQ A;  3I04 A;  3ERC C;  3QOQ A;  4E3C A;  1U00 A;  2WVE A;  1MJG A;  3I39 X;  1DKX A;  3A98 A;  4IWO A;  1SU6 A;  1UPX A;  1PAR A;  4IWQ A;  4EZW A;  2BJ9 A;  1GNT A;  2QFF A;  3UIT A;  3O3M B;  5E84 A;  1ZYL A;  3KAW A;  2WVF A;  3VEB A;  2GPE A;  3LGH A;  2BSQ E;  3VKH A;  4D8J A;  2K5J A;  1DKY A;  2BJ7 A;  1SU7 A;  1NLA A;  4IM2 A;  5TKY A;  1DKZ A;  4NPH A;  1MNT A;  4FM3 A;  1X93 A;  4R5G A;  2AY0 A;  4UDX X;  3RV1 A;  2HZV A;  2CAJ A;  2JXH A;  2YIA A;  2PY6 A;  4F00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...