3VEBA

Crystal structure of matp-mats
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
KYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrodomain Ter protein
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
total genus 48
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3vebA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3vebA01
2K6LA 1Q5VA 1MYKA 2WVFA 2JXIA 2K9IA 2BJ3A 1MNTA 2AY0A 3QOQA 4D8JA 2CPGA 2K1OA 2KELA 1PARA 2CADA 2BNZA 2HZVA 2WVDA 1QTGA 2CA9A 2CAJA 1BAZA 2K5JA 1BDTA 2BJ8A 2BJ7A 3VEAA 1IRQA 2RBFA 2HZAA 3VEBA 2BSQE 3FT7A 1ARQA 2JXHA 1ARRA 2WVEA 3VW4A 1P94A 2BNWA 2BJ1A 2WVBA 3OD2A 1MYLA 2K29A 4FXEA 2BJ9A 1NLAA 1EA4A 1B01A 2JXGA 2BA3A 1U9PA 2H1OE 3FMTA 1BDVA 4HV0A 3H87C 2GPEA 1X93A 2CAXA 3LGHA 4ME7E 3GXQA 2WVCA 1B28A
chains in the Genus database with same CATH superfamily
1Q5VA 2ADLA 1JQKA 3M3WA 2BJ3A 3BVXA 1OA0A 3DX4A 1DKZA 3BSNA 2LXYA 2GAFD 2JBVA 3NO7A 4M0MA 1W9MA 2A2BA 4AZCB 2F7PA 1ARRA 3NNEA 4JWEA 4NRTA 1I49A 4R5GA 1OHNA 3RPMA 2KKEA 3LLLA 1R5EA 1R33A 5FIGA 2RAJA 3SOGA 1TQVA 3O3OB 1GNLA 4D8JA 1PARA 2K5JA 3KDRA 1X04A 3QNIA 2OO2A 3CV5A 1SH3A 1SU6A 2JXHA 4IM3A 2BJ1A 2QKWA 4JNFA 1EA4A 3KAVA 2LM0A 2X3XA 3Q84A 2YL9A 3B52X 3UQSA 4IM2A 2PMRA 3BLBA 2OW7A 2AY0A 4FZOA 4AZ7A 4F01A 2YL6A 4EZRA 2D4CA 4WPCA 4KIKB 3T49A 3DDFA 2EFLA 4JNEA 1DKXA 3OWGA 1GN9A 2FYVA 1OA1A 4AZHA 4EZUA 2UUWA 4LQ3A 1QWNA 1B01A 2QFFA 3SFUA 3CZSA 4JWDA 2JNSA 3NAHA 3UR0A 1YWMA 4AZIA 3DPPA 1HTYA 2F18A 4EZTA 2BJ7A 1DKYA 4I1QA 2RBFA 3D4ZA 3QWEA 3BUDA 2C08A 3F7WA 1HXKA 1P94A 2ZXQA 1TQWA 4FM3A 1SUFA 2JXGA 4AZ6A 2RAKA 2OW6A 1HWWA 1X03A 3G9GA 3L3OM 2KHOA 3LJPA 2JNKA 2CADA 5TKYA 1ZYLA 1BAZA 4EZNA 2X3VA 2OZNB 3DPOA 3EJSA 2EWFA 4NRUA 4F00A 2EX3B 2Q2KA 3A98A 4E3CA 1LQ7A 3HAHA 2H1OE 3I39X 2EFKA 1E1DA 3BUBA 2Z8YA 1PS3A 2MI7A 2K9IA 2F7OA 1OAOA 3VKHA 1GNTA 4E81A 4IWOA 4AVMA 3FT7A 4WPEA 1ARQA 1SH0A 2YL8A 4EZSA 3T46A 3RV0A 1I4DA 2H3AA 2WVCA 1Q16A 2F1AA 3OHXM 4NPHA 2YLAA 1QX1A 3DDGA 1I4TA 2YIVX 2Z0NA 2WYHA 4O4RA 3KAWA 4EZPA 2WVBA 3EJUA 3Q0KA 4UDXX 3ER8C 3NAIA 2BA3A 3GI7A 5C5BA 2BNZA 2GA9D 4NQIA 4R5IA 4H6IA 3T4AG 4EZVA 1SH2A 1IRQA 3DYTA 2WK4A 1O7DC 4NSWA 1SIWA 4HV0A 2NCZA 4ME7E 3GXQA 3EJPA 3BUQA 4IWQA 1MNTA 2K1OA 4H8SA 3DX0A 1I4LA 2CA9A 1TQSA 2X3WA 4EZQA 3CVRA 3DX3A 3C7NA 4FZPA 1O7DB 3LMFA 3ACOA 3ZEDA 1MJGA 4EZXA 3QA8A 3BVVA 4R5KA 2CKWA 4HY9A 3FD9A 2F7RA 4ATMA 2ND1A 2ALWA 2YI8A 3RV1A 5FLEX 4JL9A 4H6HA 3HAJA 3H5XA 4HR1A 3QIDA 2ND0A 2BNWA 1ZWWA 3PLTA 3EJRA 4IW0A 2PY6A 3SFGA 5KBPA 3H87C 2YI9A 3B51X 4G6QA 1Y2OA 5E84A 3DX2A 2B43A 4QPXA 2HZVA 4IM0A 4KIKA 1TQTA 3D51A 2WVDA 5C5BB 1BDTA 2BJ8A 4DYLA 2QXLA 3IR7A 4JWCA 4AZGA 1R34A 1MYLA 1QWUA 2F1BA 1E9VA 4AKVA 2KOEA 4PO2A 1E2UA 3OK8A 3ABHA 3CAZA 2V0OA 4AAIA 3D2EA 2Z0OA 2FICA 2F7QA 3I01A 2X5CA 4EZOA 2AN7A 4FXEA 3BVUA 3CKDA 2OBLA 3BVTA 3O3NB 3I04A 3BUIA 2YKTA 3I2WA 2YL5A 4DCNC 4AZBA 2BSQE 2YIBA 4JWIA 4MJWA 4HR1B 4LQ9A 2BJ9A 2OBMA 1U9PA 3FMTA 2D1LA 2O0I1 2N3KA 3T47A 1X93A 2ELBA 3VW4A 2Q12A 3EJQA 3T48A 3BSOA 1SU7A 3BVWA 2KELA 3D2FA 2YLLA 2RT6A 2WINM 2YIAA 4AZCA 1TQUA 3DX1A 2HZAA 1WDZA 3ER9B 2WVEA 4B9QA 3UITA 4LRVA 3L3PA 3EJTA 2K29A 1NLAA 1OG7A 3HAIA 3LGHA 3H5YA 4EZYA 4EZZA 2WVFA 2JXIA 3QOQA 2CPGA 3DPQA 3D52A 1QTGA 3SYVA 3ERCC 1URUA 3QNJA 4AZ5A 2RAIA 4JLCA 2Q13A 3VEBA 2WYIA 2Z0VA 2GF4A 3UPFA 1SU8A 3QE6A 4BNEA 4R5JA 1UPXA 2GPEA 3G5OA 2CAXA 4JN4A 1U00A 4UDYX 1B28A 2K6LA 1MYKA 3B53X 3CZNA 3D50A 3D4YA 4FZSA 2CAJA 3VEAA 2UUTA 3LVTA 3O3MB 3OD2A 3BUPA 4R5LA 4EZWA 1BDVA 4IWPA 4HYBA
chains in the Genus database with same CATH topology
1Q5VA 1JQKA 2KHOA 3I04A 2BJ3A 4IWQA 1OA0A 1MNTA 2K1OA 2CADA 2CA9A 5TKYA 1ZYLA 1BAZA 4EZNA 1DKZA 2GAFD 4EZQA 4M0MA 3DPOA 1W9MA 2EWFA 2BSQE 2YIBA 4F00A 2EX3B 3C7NA 1ARRA 4JWEA 4JWIA 3LMFA 4R5GA 3A98A 4HR1B 4E3CA 3ZEDA 2BJ9A 2OBMA 1U9PA 2H1OE 3I39X 3FMTA 1MJGA 4EZXA 2N3KA 1E1DA 5FIGA 3T47A 3QA8A 1X93A 4R5KA 3VW4A 2Z8YA 3O3OB 4HY9A 3T48A 3FD9A 2K9IA 1SU7A 1GNLA 1OAOA 2ND1A 4D8JA 1PARA 2KELA 3VKHA 2YI8A 3D2FA 1GNTA 2RT6A 2WINM 2K5JA 2YIAA 3RV1A 5FLEX 4JL9A 4E81A 4H6HA 4IWOA 2HZAA 3KDRA 3FT7A 4HR1A 1ARQA 1SU6A 2JXHA 2ND0A 3ER9B 2WVEA 4IM3A 4B9QA 2BNWA 2BJ1A 3UITA 4EZSA 3T46A 4HYBA 2K29A 4IW0A 4JNFA 1NLAA 1EA4A 3KAVA 3RV0A 2PY6A 2LM0A 3H87C 2YI9A 3B51X 3LGHA 3B52X 4G6QA 4EZYA 5E84A 4EZZA 2WVCA 4IM2A 2WVFA 2JXIA 3OHXM 2AY0A 3QOQA 2HZVA 2CPGA 4IM0A 4KIKA 4NPHA 3DPQA 2WVDA 1QTGA 4F01A 3ERCC 4EZRA 3QNJA 4JLCA 1BDTA 2BJ8A 4KIKB 3T49A 2YIVX 2QXLA 3VEBA 4JNEA 1DKXA 3KAWA 4JWCA 4EZPA 3OWGA 1GN9A 4EZUA 1OA1A 2WVBA 3ER8C 4UDXX 1SU8A 1MYLA 1E9VA 1B01A 2QFFA 4R5JA 2BA3A 4PO2A 1E2UA 1UPXA 4JWDA 2JNSA 2GPEA 4JN4A 2CAXA 1U00A 4UDYX 1B28A 2K6LA 1MYKA 3B53X 3GI7A 2BNZA 2GA9D 3DPPA 2CAJA 3D2EA 4H6IA 4R5IA 3T4AG 4EZTA 4EZVA 2BJ7A 1DKYA 3VEAA 1IRQA 2RBFA 3F7WA 3I01A 2X5CA 1P94A 4EZOA 3O3MB 4FM3A 3OD2A 1SUFA 4R5LA 4FXEA 2JXGA 4EZWA 1BDVA 4HV0A 2OBLA 2NCZA 4IWPA 4ME7E 3GXQA 3L3OM 3O3NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6L A;  1Q5V A;  1MYK A;  2WVF A;  2JXI A;  2K9I A;  2BJ3 A;  1MNT A;  2AY0 A;  3QOQ A;  4D8J A;  2CPG A;  2K1O A;  2KEL A;  1PAR A;  2CAD A;  2BNZ A;  2HZV A;  2WVD A;  1QTG A;  2CA9 A;  2CAJ A;  1BAZ A;  2K5J A;  1BDT A;  2BJ8 A;  2BJ7 A;  3VEA A;  1IRQ A;  2RBF A;  2HZA A;  3VEB A;  2BSQ E;  3FT7 A;  1ARQ A;  2JXH A;  1ARR A;  2WVE A;  3VW4 A;  1P94 A;  2BNW A;  2BJ1 A;  2WVB A;  3OD2 A;  1MYL A;  2K29 A;  4FXE A;  2BJ9 A;  1NLA A;  1EA4 A;  1B01 A;  2JXG A;  2BA3 A;  1U9P A;  2H1O E;  3FMT A;  1BDV A;  4HV0 A;  3H87 C;  2GPE A;  1X93 A;  2CAX A;  3LGH A;  4ME7 E;  3GXQ A;  2WVC A;  1B28 A; 
#chains in the Genus database with same CATH topology
 1Q5V A;  2ADL A;  1JQK A;  3M3W A;  2BJ3 A;  3BVX A;  1OA0 A;  3DX4 A;  1DKZ A;  3BSN A;  2LXY A;  2GAF D;  2JBV A;  3NO7 A;  4M0M A;  1W9M A;  2A2B A;  4AZC B;  2F7P A;  1ARR A;  3NNE A;  4JWE A;  4NRT A;  1I49 A;  4R5G A;  1OHN A;  3RPM A;  2KKE A;  3LLL A;  1R5E A;  1R33 A;  5FIG A;  2RAJ A;  3SOG A;  1TQV A;  3O3O B;  1GNL A;  4D8J A;  1PAR A;  2K5J A;  3KDR A;  1X04 A;  3QNI A;  2OO2 A;  3CV5 A;  1SH3 A;  1SU6 A;  2JXH A;  4IM3 A;  2BJ1 A;  2QKW A;  4JNF A;  1EA4 A;  3KAV A;  2LM0 A;  2X3X A;  3Q84 A;  2YL9 A;  3B52 X;  3UQS A;  4IM2 A;  2PMR A;  3BLB A;  2OW7 A;  2AY0 A;  4FZO A;  4AZ7 A;  4F01 A;  2YL6 A;  4EZR A;  2D4C A;  4WPC A;  4KIK B;  3T49 A;  3DDF A;  2EFL A;  4JNE A;  1DKX A;  3OWG A;  1GN9 A;  2FYV A;  1OA1 A;  4AZH A;  4EZU A;  2UUW A;  4LQ3 A;  1QWN A;  1B01 A;  2QFF A;  3SFU A;  3CZS A;  4JWD A;  2JNS A;  3NAH A;  3UR0 A;  1YWM A;  4AZI A;  3DPP A;  1HTY A;  2F18 A;  4EZT A;  2BJ7 A;  1DKY A;  4I1Q A;  2RBF A;  3D4Z A;  3QWE A;  3BUD A;  2C08 A;  3F7W A;  1HXK A;  1P94 A;  2ZXQ A;  1TQW A;  4FM3 A;  1SUF A;  2JXG A;  4AZ6 A;  2RAK A;  2OW6 A;  1HWW A;  1X03 A;  3G9G A;  3L3O M;  2KHO A;  3LJP A;  2JNK A;  2CAD A;  5TKY A;  1ZYL A;  1BAZ A;  4EZN A;  2X3V A;  2OZN B;  3DPO A;  3EJS A;  2EWF A;  4NRU A;  4F00 A;  2EX3 B;  2Q2K A;  3A98 A;  4E3C A;  1LQ7 A;  3HAH A;  2H1O E;  3I39 X;  2EFK A;  1E1D A;  3BUB A;  2Z8Y A;  1PS3 A;  2MI7 A;  2K9I A;  2F7O A;  1OAO A;  3VKH A;  1GNT A;  4E81 A;  4IWO A;  4AVM A;  3FT7 A;  4WPE A;  1ARQ A;  1SH0 A;  2YL8 A;  4EZS A;  3T46 A;  3RV0 A;  1I4D A;  2H3A A;  2WVC A;  1Q16 A;  2F1A A;  3OHX M;  4NPH A;  2YLA A;  1QX1 A;  3DDG A;  1I4T A;  2YIV X;  2Z0N A;  2WYH A;  4O4R A;  3KAW A;  4EZP A;  2WVB A;  3EJU A;  3Q0K A;  4UDX X;  3ER8 C;  3NAI A;  2BA3 A;  3GI7 A;  5C5B A;  2BNZ A;  2GA9 D;  4NQI A;  4R5I A;  4H6I A;  3T4A G;  4EZV A;  1SH2 A;  1IRQ A;  3DYT A;  2WK4 A;  1O7D C;  4NSW A;  1SIW A;  4HV0 A;  2NCZ A;  4ME7 E;  3GXQ A;  3EJP A;  3BUQ A;  4IWQ A;  1MNT A;  2K1O A;  4H8S A;  3DX0 A;  1I4L A;  2CA9 A;  1TQS A;  2X3W A;  4EZQ A;  3CVR A;  3DX3 A;  3C7N A;  4FZP A;  1O7D B;  3LMF A;  3ACO A;  3ZED A;  1MJG A;  4EZX A;  3QA8 A;  3BVV A;  4R5K A;  2CKW A;  4HY9 A;  3FD9 A;  2F7R A;  4ATM A;  2ND1 A;  2ALW A;  2YI8 A;  3RV1 A;  5FLE X;  4JL9 A;  4H6H A;  3HAJ A;  3H5X A;  4HR1 A;  3QID A;  2ND0 A;  2BNW A;  1ZWW A;  3PLT A;  3EJR A;  4IW0 A;  2PY6 A;  3SFG A;  5KBP A;  3H87 C;  2YI9 A;  3B51 X;  4G6Q A;  1Y2O A;  5E84 A;  3DX2 A;  2B43 A;  4QPX A;  2HZV A;  4IM0 A;  4KIK A;  1TQT A;  3D51 A;  2WVD A;  5C5B B;  1BDT A;  2BJ8 A;  4DYL A;  2QXL A;  3IR7 A;  4JWC A;  4AZG A;  1R34 A;  1MYL A;  1QWU A;  2F1B A;  1E9V A;  4AKV A;  2KOE A;  4PO2 A;  1E2U A;  3OK8 A;  3ABH A;  3CAZ A;  2V0O A;  4AAI A;  3D2E A;  2Z0O A;  2FIC A;  2F7Q A;  3I01 A;  2X5C A;  4EZO A;  2AN7 A;  4FXE A;  3BVU A;  3CKD A;  2OBL A;  3BVT A;  3O3N B;  3I04 A;  3BUI A;  2YKT A;  3I2W A;  2YL5 A;  4DCN C;  4AZB A;  2BSQ E;  2YIB A;  4JWI A;  4MJW A;  4HR1 B;  4LQ9 A;  2BJ9 A;  2OBM A;  1U9P A;  3FMT A;  2D1L A;  2O0I 1;  2N3K A;  3T47 A;  1X93 A;  2ELB A;  3VW4 A;  2Q12 A;  3EJQ A;  3T48 A;  3BSO A;  1SU7 A;  3BVW A;  2KEL A;  3D2F A;  2YLL A;  2RT6 A;  2WIN M;  2YIA A;  4AZC A;  1TQU A;  3DX1 A;  2HZA A;  1WDZ A;  3ER9 B;  2WVE A;  4B9Q A;  3UIT A;  4LRV A;  3L3P A;  3EJT A;  2K29 A;  1NLA A;  1OG7 A;  3HAI A;  3LGH A;  3H5Y A;  4EZY A;  4EZZ A;  2WVF A;  2JXI A;  3QOQ A;  2CPG A;  3DPQ A;  3D52 A;  1QTG A;  3SYV A;  3ERC C;  1URU A;  3QNJ A;  4AZ5 A;  2RAI A;  4JLC A;  2Q13 A;  3VEB A;  2WYI A;  2Z0V A;  2GF4 A;  3UPF A;  1SU8 A;  3QE6 A;  4BNE A;  4R5J A;  1UPX A;  2GPE A;  3G5O A;  2CAX A;  4JN4 A;  1U00 A;  4UDY X;  1B28 A;  2K6L A;  1MYK A;  3B53 X;  3CZN A;  3D50 A;  3D4Y A;  4FZS A;  2CAJ A;  3VEA A;  2UUT A;  3LVT A;  3O3M B;  3OD2 A;  3BUP A;  4R5L A;  4EZW A;  1BDV A;  4IWP A;  4HYB A; 
#chains in the Genus database with same CATH homology
 1Q5V A;  1JQK A;  2KHO A;  3I04 A;  2BJ3 A;  4IWQ A;  1OA0 A;  1MNT A;  2K1O A;  2CAD A;  2CA9 A;  5TKY A;  1ZYL A;  1BAZ A;  4EZN A;  1DKZ A;  2GAF D;  4EZQ A;  4M0M A;  3DPO A;  1W9M A;  2EWF A;  2BSQ E;  2YIB A;  4F00 A;  2EX3 B;  3C7N A;  1ARR A;  4JWE A;  4JWI A;  3LMF A;  4R5G A;  3A98 A;  4HR1 B;  4E3C A;  3ZED A;  2BJ9 A;  2OBM A;  1U9P A;  2H1O E;  3I39 X;  3FMT A;  1MJG A;  4EZX A;  2N3K A;  1E1D A;  5FIG A;  3T47 A;  3QA8 A;  1X93 A;  4R5K A;  3VW4 A;  2Z8Y A;  3O3O B;  4HY9 A;  3T48 A;  3FD9 A;  2K9I A;  1SU7 A;  1GNL A;  1OAO A;  2ND1 A;  4D8J A;  1PAR A;  2KEL A;  3VKH A;  2YI8 A;  3D2F A;  1GNT A;  2RT6 A;  2WIN M;  2K5J A;  2YIA A;  3RV1 A;  5FLE X;  4JL9 A;  4E81 A;  4H6H A;  4IWO A;  2HZA A;  3KDR A;  3FT7 A;  4HR1 A;  1ARQ A;  1SU6 A;  2JXH A;  2ND0 A;  3ER9 B;  2WVE A;  4IM3 A;  4B9Q A;  2BNW A;  2BJ1 A;  3UIT A;  4EZS A;  3T46 A;  4HYB A;  2K29 A;  4IW0 A;  4JNF A;  1NLA A;  1EA4 A;  3KAV A;  3RV0 A;  2PY6 A;  2LM0 A;  3H87 C;  2YI9 A;  3B51 X;  3LGH A;  3B52 X;  4G6Q A;  4EZY A;  5E84 A;  4EZZ A;  2WVC A;  4IM2 A;  2WVF A;  2JXI A;  3OHX M;  2AY0 A;  3QOQ A;  2HZV A;  2CPG A;  4IM0 A;  4KIK A;  4NPH A;  3DPQ A;  2WVD A;  1QTG A;  4F01 A;  3ERC C;  4EZR A;  3QNJ A;  4JLC A;  1BDT A;  2BJ8 A;  4KIK B;  3T49 A;  2YIV X;  2QXL A;  3VEB A;  4JNE A;  1DKX A;  3KAW A;  4JWC A;  4EZP A;  3OWG A;  1GN9 A;  4EZU A;  1OA1 A;  2WVB A;  3ER8 C;  4UDX X;  1SU8 A;  1MYL A;  1E9V A;  1B01 A;  2QFF A;  4R5J A;  2BA3 A;  4PO2 A;  1E2U A;  1UPX A;  4JWD A;  2JNS A;  2GPE A;  4JN4 A;  2CAX A;  1U00 A;  4UDY X;  1B28 A;  2K6L A;  1MYK A;  3B53 X;  3GI7 A;  2BNZ A;  2GA9 D;  3DPP A;  2CAJ A;  3D2E A;  4H6I A;  4R5I A;  3T4A G;  4EZT A;  4EZV A;  2BJ7 A;  1DKY A;  3VEA A;  1IRQ A;  2RBF A;  3F7W A;  3I01 A;  2X5C A;  1P94 A;  4EZO A;  3O3M B;  4FM3 A;  3OD2 A;  1SUF A;  4R5L A;  4FXE A;  2JXG A;  4EZW A;  1BDV A;  4HV0 A;  2OBL A;  2NCZ A;  4IWP A;  4ME7 E;  3GXQ A;  3L3O M;  3O3N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...