3VEBA

Crystal structure of matp-mats
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
KYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Macrodomain Ter protein
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
total genus 48
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3vebA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3vebA01
2BJ8A 2WVDA 3LGHA 3QOQA 2BJ7A 1B01A 1MYLA 3H87C 3VEBA 2RBFA 2BNWA 1B28A 2WVCA 2BNZA 1X93A 4HV0A 2CPGA 2K9IA 2BSQE 1BDTA 1ARQA 2CAJA 2WVEA 2CADA 2BJ9A 1PARA 1U9PA 2WVBA 1IRQA 3OD2A 4FXEA 4D8JA 2HZAA 2K5JA 3GXQA 2GPEA 4ME7E 1Q5VA 1BAZA 2HZVA 1ARRA 1QTGA 2K29A 2WVFA 3VEAA 2JXHA 1MYKA 2BA3A 1EA4A 2CA9A 3FT7A 1P94A 2AY0A 3VW4A 2K6LA 2JXGA 2K1OA 2KELA 1MNTA 2BJ1A 3FMTA 2H1OE 2BJ3A 2JXIA 1NLAA 2CAXA 1BDVA
chains in the Genus database with same CATH superfamily
3BVWA 3LGHA 1GNTA 3L3OM 3LMFA 3H87C 3I39X 4H6IA 1BDTA 4JNEA 4LQ3A 2LXYA 4WPEA 1X04A 3OWGA 3QNIA 1Q5VA 3DX2A 3LVTA 3CKDA 1QWUA 2YL6A 4HR1A 1MJGA 3EJQA 3BUDA 3ERCC 1SUFA 3NAIA 2ND1A 2D4CA 2OO2A 2WVEA 3D51A 2WVBA 3OD2A 2H3AA 4EZZA 3UQSA 3Q0KA 1HXKA 2QFFA 2A2BA 2WVFA 3VEAA 2JXHA 3HAJA 4O4RA 2RAKA 3T4AG 4JWEA 2OW6A 3D50A 4LRVA 2H1OE 2JXGA 1WDZA 3BUPA 2WVDA 3CAZA 2F7PA 3B52X 2QKWA 2Z0OA 3EJUA 3I04A 3DDGA 4IM2A 2X3VA 1U9PA 5E84A 2JNSA 4EZRA 3IR7A 3DDFA 2HZVA 1GN9A 3ACOA 1QTGA 3KDRA 2CA9A 2B43A 3D2FA 1X03A 2EX3B 4NSWA 3SOGA 3FD9A 1O7DC 1U00A 3RV0A 4AKVA 2YI8A 4R5IA 3KAWA 4R5KA 2Q12A 4AZBA 1R33A 2D1LA 3H5XA 4EZVA 1SH2A 3NO7A 4F00A 5FIGA 2JBVA 2F1BA 3NNEA 3SYVA 2OZNB 4UDYX 4JN4A 2AY0A 3FMTA 2KOEA 4NQIA 3BVUA 4EZYA 4AVMA 1MYLA 2EFKA 3A98A 2N3KA 1X93A 2RAJA 3L3PA 1ARQA 2PY6A 3BUBA 3CV5A 3ZEDA 3CVRA 2FICA 2FYVA 1I49A 3EJRA 4AZ6A 4AZ7A 2YIAA 2C08A 3I2WA 3O3MB 3DPOA 4AZHA 1JQKA 1DKXA 1TQTA 5C5BB 2BNWA 2CPGA 1Y2OA 2KHOA 3O3NB 3CZSA 4NRUA 3H5YA 4JNFA 4IWOA 4G6QA 2Q13A 3EJSA 3B51X 1BAZA 4F01A 3DX3A 2X5CA 3EJPA 2YLLA 2F7RA 3BVXA 3QE6A 2WYHA 3LJPA 4E3CA 4LQ9A 2BJ3A 2JXIA 2RT6A 3QNJA 3VEBA 2BSQE 1SH3A 2GAFD 4B9QA 2K5JA 3DPPA 2YIVX 3ER8C 4IWQA 4UDXX 3B53X 1ARRA 2K29A 3DX0A 3HAIA 1SH0A 4NRTA 4EZTA 3VW4A 2KELA 1TQWA 4FM3A 4PO2A 3UITA 3BLBA 3BSNA 3F7WA 2QXLA 2K9IA 1HTYA 4R5GA 1PARA 3DPQA 3PLTA 2OBLA 4JWDA 2GPEA 2PMRA 1PS3A 3I01A 2Q2KA 3NAHA 4R5JA 3FT7A 2ND0A 2V0OA 3UPFA 3HAHA 3T46A 4EZPA 1OA0A 3OK8A 3D2EA 3VKHA 4IWPA 3QWEA 2YKTA 4FXEA 4HY9A 2NCZA 2YL8A 3GXQA 3DYTA 4EZQA 2ADLA 3M3WA 4IW0A 2YIBA 3RPMA 1I4TA 2YI9A 2WK4A 1R34A 2Z0NA 3BVTA 3BUQA 4JL9A 2F1AA 1ZWWA 3SFUA 2YL5A 1TQUA 3C7NA 3EJTA 3DX1A 4D8JA 2GA9D 2JNKA 1SU7A 4AZ5A 1DKZA 3DX4A 4EZWA 1SIWA 2K1OA 4ATMA 3O3OB 1NLAA 1BDVA 2O0I1 3Q84A 1OHNA 1SU6A 4DCNC 2KKEA 1B01A 4EZXA 1TQVA 4AZGA 2F7OA 4AZCB 2X3WA 2BJ9A 2F7QA 2GF4A 4HR1B 4I1QA 3T48A 3OHXM 4EZNA 1LQ7A 2BJ1A 4FZOA 3QIDA 2YLAA 1TQSA 2RBFA 4AAIA 2BNZA 4EZUA 1GNLA 4IM3A 2CAJA 2CKWA 4NPHA 3LLLA 5C5BA 3QA8A 1QWNA 2F18A 4AZCA 4ME7E 4WPCA 1E2UA 5KBPA 4M0MA 1E9VA 2BA3A 2LM0A 2K6LA 2UUWA 2BJ8A 3QOQA 4FZSA 2CADA 4EZOA 2ELBA 2HZAA 1QX1A 1HWWA 3SFGA 4JWIA 2WYIA 2YL9A 1O7DB 4QPXA 3D52A 5TKYA 1P94A 2ALWA 1OAOA 2EFLA 2WVCA 2BJ7A 4MJWA 3ABHA 4HV0A 2OW7A 2OBMA 2EWFA 4DYLA 2Z8YA 3ER9B 1W9MA 3KAVA 3BSOA 3T47A 2Z0VA 1YWMA 1OG7A 1Q16A 1E1DA 1MNTA 2UUTA 1ZYLA 4KIKB 2CAXA 4HYBA 4E81A 1B28A 3UR0A 4AZIA 1SU8A 3G5OA 2X3XA 1I4DA 1URUA 4IM0A 5FLEX 1UPXA 3D4YA 4EZSA 1EA4A 1R5EA 4R5LA 1OA1A 4JLCA 3GI7A 3RV1A 3BUIA 2RAIA 4KIKA 3D4ZA 1DKYA 3G9GA 4BNEA 2ZXQA 1IRQA 3BVVA 4FZPA 3T49A 1I4LA 3CZNA 1MYKA 4H6HA 4H8SA 4JWCA 2WINM 2AN7A 2MI7A
chains in the Genus database with same CATH topology
2BJ8A 3LGHA 3QOQA 1OA0A 1GNTA 3L3OM 3LMFA 1MYLA 3H87C 3D2EA 3VKHA 3I39X 3A98A 2N3KA 4H6IA 4IWPA 1X93A 1BDTA 1ARQA 2CADA 4JNEA 4EZOA 2PY6A 4FXEA 4HY9A 2HZAA 2NCZA 3ZEDA 3GXQA 3OWGA 1Q5VA 4JWIA 4EZQA 4IW0A 2YIBA 2YIAA 5TKYA 1P94A 2YI9A 3O3MB 4HR1A 1OAOA 3DPOA 1MJGA 2WVCA 3ERCC 1JQKA 1SUFA 1DKXA 2BJ7A 4JL9A 2ND1A 2BNWA 4HV0A 2CPGA 2KHOA 3O3NB 2WVEA 3C7NA 2WVBA 3OD2A 2EWFA 2OBMA 4JNFA 4EZZA 4D8JA 2GA9D 1SU7A 4IWOA 4G6QA 2Z8YA 2QFFA 3B51X 1BAZA 4F01A 3ER9B 1W9MA 3KAVA 1DKZA 2WVFA 3VEAA 2X5CA 2JXHA 3T47A 3T4AG 4JWEA 4EZWA 2K1OA 1E1DA 4E3CA 1MNTA 2H1OE 1ZYLA 4KIKB 2JXGA 2BJ3A 2JXIA 1NLAA 2CAXA 1BDVA 3O3OB 2RT6A 4HYBA 2WVDA 1SU6A 4E81A 3B52X 1B01A 3QNJA 3VEBA 1B28A 3I04A 4EZXA 2BSQE 2GAFD 4IM2A 1SU8A 2BJ9A 1U9PA 5E84A 2JNSA 2K5JA 4B9QA 3DPPA 2YIVX 4IM0A 4EZRA 3ER8C 4HR1B 2HZVA 4IWQA 1GN9A 3B53X 3OHXM 4UDXX 1ARRA 3T48A 1QTGA 2K29A 5FLEX 1UPXA 3KDRA 4EZSA 1EA4A 2CA9A 4EZNA 3VW4A 3D2FA 4EZTA 4R5LA 2KELA 2EX3B 2BJ1A 1OA1A 4JLCA 3GI7A 3RV1A 4FM3A 3FD9A 4PO2A 3UITA 1U00A 3RV0A 3F7WA 2RBFA 2QXLA 2YI8A 4KIKA 2BNZA 4R5IA 2K9IA 4EZUA 1DKYA 1GNLA 4IM3A 3KAWA 4R5KA 2CAJA 4R5GA 1PARA 4NPHA 1IRQA 4EZVA 3QA8A 3DPQA 2OBLA 4JWDA 2GPEA 4ME7E 1E2UA 4F00A 4M0MA 5FIGA 3T49A 3I01A 1MYKA 2BA3A 1E9VA 2LM0A 4R5JA 4UDYX 3FT7A 4H6HA 4JN4A 2AY0A 2K6LA 2ND0A 4JWCA 2WINM 3FMTA 4EZYA 3T46A 4EZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ8 A;  2WVD A;  3LGH A;  3QOQ A;  2BJ7 A;  1B01 A;  1MYL A;  3H87 C;  3VEB A;  2RBF A;  2BNW A;  1B28 A;  2WVC A;  2BNZ A;  1X93 A;  4HV0 A;  2CPG A;  2K9I A;  2BSQ E;  1BDT A;  1ARQ A;  2CAJ A;  2WVE A;  2CAD A;  2BJ9 A;  1PAR A;  1U9P A;  2WVB A;  1IRQ A;  3OD2 A;  4FXE A;  4D8J A;  2HZA A;  2K5J A;  3GXQ A;  2GPE A;  4ME7 E;  1Q5V A;  1BAZ A;  2HZV A;  1ARR A;  1QTG A;  2K29 A;  2WVF A;  3VEA A;  2JXH A;  1MYK A;  2BA3 A;  1EA4 A;  2CA9 A;  3FT7 A;  1P94 A;  2AY0 A;  3VW4 A;  2K6L A;  2JXG A;  2K1O A;  2KEL A;  1MNT A;  2BJ1 A;  3FMT A;  2H1O E;  2BJ3 A;  2JXI A;  1NLA A;  2CAX A;  1BDV A; 
#chains in the Genus database with same CATH topology
 3BVW A;  3LGH A;  1GNT A;  3L3O M;  3LMF A;  3H87 C;  3I39 X;  4H6I A;  1BDT A;  4JNE A;  4LQ3 A;  2LXY A;  4WPE A;  1X04 A;  3OWG A;  3QNI A;  1Q5V A;  3DX2 A;  3LVT A;  3CKD A;  1QWU A;  2YL6 A;  4HR1 A;  1MJG A;  3EJQ A;  3BUD A;  3ERC C;  1SUF A;  3NAI A;  2ND1 A;  2D4C A;  2OO2 A;  2WVE A;  3D51 A;  2WVB A;  3OD2 A;  2H3A A;  4EZZ A;  3UQS A;  3Q0K A;  1HXK A;  2QFF A;  2A2B A;  2WVF A;  3VEA A;  2JXH A;  3HAJ A;  4O4R A;  2RAK A;  3T4A G;  4JWE A;  2OW6 A;  3D50 A;  4LRV A;  2H1O E;  2JXG A;  1WDZ A;  3BUP A;  2WVD A;  3CAZ A;  2F7P A;  3B52 X;  2QKW A;  2Z0O A;  3EJU A;  3I04 A;  3DDG A;  4IM2 A;  2X3V A;  1U9P A;  5E84 A;  2JNS A;  4EZR A;  3IR7 A;  3DDF A;  2HZV A;  1GN9 A;  3ACO A;  1QTG A;  3KDR A;  2CA9 A;  2B43 A;  3D2F A;  1X03 A;  2EX3 B;  4NSW A;  3SOG A;  3FD9 A;  1O7D C;  1U00 A;  3RV0 A;  4AKV A;  2YI8 A;  4R5I A;  3KAW A;  4R5K A;  2Q12 A;  4AZB A;  1R33 A;  2D1L A;  3H5X A;  4EZV A;  1SH2 A;  3NO7 A;  4F00 A;  5FIG A;  2JBV A;  2F1B A;  3NNE A;  3SYV A;  2OZN B;  4UDY X;  4JN4 A;  2AY0 A;  3FMT A;  2KOE A;  4NQI A;  3BVU A;  4EZY A;  4AVM A;  1MYL A;  2EFK A;  3A98 A;  2N3K A;  1X93 A;  2RAJ A;  3L3P A;  1ARQ A;  2PY6 A;  3BUB A;  3CV5 A;  3ZED A;  3CVR A;  2FIC A;  2FYV A;  1I49 A;  3EJR A;  4AZ6 A;  4AZ7 A;  2YIA A;  2C08 A;  3I2W A;  3O3M B;  3DPO A;  4AZH A;  1JQK A;  1DKX A;  1TQT A;  5C5B B;  2BNW A;  2CPG A;  1Y2O A;  2KHO A;  3O3N B;  3CZS A;  4NRU A;  3H5Y A;  4JNF A;  4IWO A;  4G6Q A;  2Q13 A;  3EJS A;  3B51 X;  1BAZ A;  4F01 A;  3DX3 A;  2X5C A;  3EJP A;  2YLL A;  2F7R A;  3BVX A;  3QE6 A;  2WYH A;  3LJP A;  4E3C A;  4LQ9 A;  2BJ3 A;  2JXI A;  2RT6 A;  3QNJ A;  3VEB A;  2BSQ E;  1SH3 A;  2GAF D;  4B9Q A;  2K5J A;  3DPP A;  2YIV X;  3ER8 C;  4IWQ A;  4UDX X;  3B53 X;  1ARR A;  2K29 A;  3DX0 A;  3HAI A;  1SH0 A;  4NRT A;  4EZT A;  3VW4 A;  2KEL A;  1TQW A;  4FM3 A;  4PO2 A;  3UIT A;  3BLB A;  3BSN A;  3F7W A;  2QXL A;  2K9I A;  1HTY A;  4R5G A;  1PAR A;  3DPQ A;  3PLT A;  2OBL A;  4JWD A;  2GPE A;  2PMR A;  1PS3 A;  3I01 A;  2Q2K A;  3NAH A;  4R5J A;  3FT7 A;  2ND0 A;  2V0O A;  3UPF A;  3HAH A;  3T46 A;  4EZP A;  1OA0 A;  3OK8 A;  3D2E A;  3VKH A;  4IWP A;  3QWE A;  2YKT A;  4FXE A;  4HY9 A;  2NCZ A;  2YL8 A;  3GXQ A;  3DYT A;  4EZQ A;  2ADL A;  3M3W A;  4IW0 A;  2YIB A;  3RPM A;  1I4T A;  2YI9 A;  2WK4 A;  1R34 A;  2Z0N A;  3BVT A;  3BUQ A;  4JL9 A;  2F1A A;  1ZWW A;  3SFU A;  2YL5 A;  1TQU A;  3C7N A;  3EJT A;  3DX1 A;  4D8J A;  2GA9 D;  2JNK A;  1SU7 A;  4AZ5 A;  1DKZ A;  3DX4 A;  4EZW A;  1SIW A;  2K1O A;  4ATM A;  3O3O B;  1NLA A;  1BDV A;  2O0I 1;  3Q84 A;  1OHN A;  1SU6 A;  4DCN C;  2KKE A;  1B01 A;  4EZX A;  1TQV A;  4AZG A;  2F7O A;  4AZC B;  2X3W A;  2BJ9 A;  2F7Q A;  2GF4 A;  4HR1 B;  4I1Q A;  3T48 A;  3OHX M;  4EZN A;  1LQ7 A;  2BJ1 A;  4FZO A;  3QID A;  2YLA A;  1TQS A;  2RBF A;  4AAI A;  2BNZ A;  4EZU A;  1GNL A;  4IM3 A;  2CAJ A;  2CKW A;  4NPH A;  3LLL A;  5C5B A;  3QA8 A;  1QWN A;  2F18 A;  4AZC A;  4ME7 E;  4WPC A;  1E2U A;  5KBP A;  4M0M A;  1E9V A;  2BA3 A;  2LM0 A;  2K6L A;  2UUW A;  2BJ8 A;  3QOQ A;  4FZS A;  2CAD A;  4EZO A;  2ELB A;  2HZA A;  1QX1 A;  1HWW A;  3SFG A;  4JWI A;  2WYI A;  2YL9 A;  1O7D B;  4QPX A;  3D52 A;  5TKY A;  1P94 A;  2ALW A;  1OAO A;  2EFL A;  2WVC A;  2BJ7 A;  4MJW A;  3ABH A;  4HV0 A;  2OW7 A;  2OBM A;  2EWF A;  4DYL A;  2Z8Y A;  3ER9 B;  1W9M A;  3KAV A;  3BSO A;  3T47 A;  2Z0V A;  1YWM A;  1OG7 A;  1Q16 A;  1E1D A;  1MNT A;  2UUT A;  1ZYL A;  4KIK B;  2CAX A;  4HYB A;  4E81 A;  1B28 A;  3UR0 A;  4AZI A;  1SU8 A;  3G5O A;  2X3X A;  1I4D A;  1URU A;  4IM0 A;  5FLE X;  1UPX A;  3D4Y A;  4EZS A;  1EA4 A;  1R5E A;  4R5L A;  1OA1 A;  4JLC A;  3GI7 A;  3RV1 A;  3BUI A;  2RAI A;  4KIK A;  3D4Z A;  1DKY A;  3G9G A;  4BNE A;  2ZXQ A;  1IRQ A;  3BVV A;  4FZP A;  3T49 A;  1I4L A;  3CZN A;  1MYK A;  4H6H A;  4H8S A;  4JWC A;  2WIN M;  2AN7 A;  2MI7 A; 
#chains in the Genus database with same CATH homology
 2BJ8 A;  3LGH A;  3QOQ A;  1OA0 A;  1GNT A;  3L3O M;  3LMF A;  1MYL A;  3H87 C;  3D2E A;  3VKH A;  3I39 X;  3A98 A;  2N3K A;  4H6I A;  4IWP A;  1X93 A;  1BDT A;  1ARQ A;  2CAD A;  4JNE A;  4EZO A;  2PY6 A;  4FXE A;  4HY9 A;  2HZA A;  2NCZ A;  3ZED A;  3GXQ A;  3OWG A;  1Q5V A;  4JWI A;  4EZQ A;  4IW0 A;  2YIB A;  2YIA A;  5TKY A;  1P94 A;  2YI9 A;  3O3M B;  4HR1 A;  1OAO A;  3DPO A;  1MJG A;  2WVC A;  3ERC C;  1JQK A;  1SUF A;  1DKX A;  2BJ7 A;  4JL9 A;  2ND1 A;  2BNW A;  4HV0 A;  2CPG A;  2KHO A;  3O3N B;  2WVE A;  3C7N A;  2WVB A;  3OD2 A;  2EWF A;  2OBM A;  4JNF A;  4EZZ A;  4D8J A;  2GA9 D;  1SU7 A;  4IWO A;  4G6Q A;  2Z8Y A;  2QFF A;  3B51 X;  1BAZ A;  4F01 A;  3ER9 B;  1W9M A;  3KAV A;  1DKZ A;  2WVF A;  3VEA A;  2X5C A;  2JXH A;  3T47 A;  3T4A G;  4JWE A;  4EZW A;  2K1O A;  1E1D A;  4E3C A;  1MNT A;  2H1O E;  1ZYL A;  4KIK B;  2JXG A;  2BJ3 A;  2JXI A;  1NLA A;  2CAX A;  1BDV A;  3O3O B;  2RT6 A;  4HYB A;  2WVD A;  1SU6 A;  4E81 A;  3B52 X;  1B01 A;  3QNJ A;  3VEB A;  1B28 A;  3I04 A;  4EZX A;  2BSQ E;  2GAF D;  4IM2 A;  1SU8 A;  2BJ9 A;  1U9P A;  5E84 A;  2JNS A;  2K5J A;  4B9Q A;  3DPP A;  2YIV X;  4IM0 A;  4EZR A;  3ER8 C;  4HR1 B;  2HZV A;  4IWQ A;  1GN9 A;  3B53 X;  3OHX M;  4UDX X;  1ARR A;  3T48 A;  1QTG A;  2K29 A;  5FLE X;  1UPX A;  3KDR A;  4EZS A;  1EA4 A;  2CA9 A;  4EZN A;  3VW4 A;  3D2F A;  4EZT A;  4R5L A;  2KEL A;  2EX3 B;  2BJ1 A;  1OA1 A;  4JLC A;  3GI7 A;  3RV1 A;  4FM3 A;  3FD9 A;  4PO2 A;  3UIT A;  1U00 A;  3RV0 A;  3F7W A;  2RBF A;  2QXL A;  2YI8 A;  4KIK A;  2BNZ A;  4R5I A;  2K9I A;  4EZU A;  1DKY A;  1GNL A;  4IM3 A;  3KAW A;  4R5K A;  2CAJ A;  4R5G A;  1PAR A;  4NPH A;  1IRQ A;  4EZV A;  3QA8 A;  3DPQ A;  2OBL A;  4JWD A;  2GPE A;  4ME7 E;  1E2U A;  4F00 A;  4M0M A;  5FIG A;  3T49 A;  3I01 A;  1MYK A;  2BA3 A;  1E9V A;  2LM0 A;  4R5J A;  4UDY X;  3FT7 A;  4H6H A;  4JN4 A;  2AY0 A;  2K6L A;  2ND0 A;  4JWC A;  2WIN M;  3FMT A;  4EZY A;  3T46 A;  4EZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...