2WVCA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
132
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDEDNPNDESKIAVLVVIYDGGQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 32
structure length 132
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvcA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvcA02
1MYKA 3QSIA 2NZCA 2BNZA 2WVBA 2K6LA 1IRQA 1U9PA 1PARA 2CPGA 4ME7E 2BNWA 2K1OA 3BKTA 2CA9A 2BJ8A 1Q5VA 2WVEA 2BSQE 2AY0A 1BDVA 1NLAA 1BAZA 2Y3YA 2K29A 2JXHA 2BJ3A 2BJ1A 2WVDA 3GXQA 2JXGA 1X93A 3LGHA 1EA4A 4D8JA 1BDTA 2JXIA 1P94A 1QTGA 2K9IA 2KELA 2CADA 2BJ9A 2K5JA 3QOQA 2PC6A 2GPEA 1MYLA 2HZVA 3VW4A 3PHTA 2WVFA 2H1OE 3BKUA 3H87C 1B01A 2CAXA 4FXEA 2BA3A 3OD2A 1B28A 2FGCA 2HZAA 2WVCA 3FT7A 4HV0A 2CAJA 1ARQA 1MNTA 2BJ7A 2RBFA 1Q5YA 3BKFA 2F1FA 3FMTA 3VEBA 1ARRA 3VEAA
chains in the Genus database with same CATH superfamily
2KOEA 3MAAA 3ZTQA 4HVZA 5D4OA 1K0TA 1UVNA 4UQTA 1YRUA 2H65B 3BYRA 2M9KA 3Q8YA 4NLVA 1C4CA 2AW0A 4F0KA 3GLJA 1IJEB 1EQ0A 4IG3B 2EXUA 4X65F 3NL0A 4OZLA 3DC2A 3RZAA 3DHWC 5C24B 1WTFA 2GA7A 4A8OA 1AXQA 4EBCA 5C25B 1HNVA 2OD4A 3MMJA 2D3O1 3M8SA 3LP1A 2KVIA 3AD9C 1H72C 3ZO7A 4P10A 4JV5F 2GC8A 4OYAA 3OTCA 3R6GB 2QA4S 1GT8A 3HJFA 3LF0A 3MI7X 1LK7A 1CJKB 1WG4A 3ELHA 5KFZA 4E2FB 1FESA 1YIJS 4EZ6A 1HIYA 1JKHA 2CQ0A 2YQ0A 2WTFA 1DRZA 1FDAA 3CJ2A 1L3KA 2GQ2A 1HKAA 3R5JB 1PO6A 4DSKA 2XG8A 2VBZA 3AFGA 3DOKA 4DR4F 2F1FA 2YKMA 3EE3A 1DLOB 3I5AA 3DXSX 1SB6A 1CSJA 2F9JA 1AB8A 5KG7A 2Z30B 4ZOSA 3BSAA 4X84A 2WOMB 1RXOB 2UUBF 4C3MA 5KFPA 3CJ4A 3S6EA 2XMTA 2BSQE 1FD8A 2QYCA 1R8AA 3GCXP 3M2RA 4ED3A 3RRGA 1OIAA 3LAKA 1MN9A 1HBUB 3HF5A 1KLMA 3HVTB 3Q8PB 1TL7A 3RG6A 4F2RA 3FKBA 1UVJA 2C3UA 3SYZA 1XNQJ 1F0XA 2PFDA 3BBFA 2A10A 2A2DA 4J9QA 4JV2A 2J9DA 4YHHJ 2H1OE 2H1YA 1I1GA 3AXMA 3M8QA 4UW2A 1GXLA 4K0KJ 1IKWB 4KGZB 3G87A 3C46A 1URNA 1MSWD 1RTIA 2ZOFA 4EYIB 1JLEB 4ED5A 4KPCA 2XSFA 5I3PA 1CPZA 1JLFA 2VFVA 1VRQC 3HFKA 3QLHA 2EKNA 2GIFA 3HT3A 3MEGA 3QGGA 4IG0B 4F36A 4MYTA 1RJJA 2AF6A 1S6OA 4X4SA 3ZZTA 3VALA 2R7SA 4LR9A 4LVOP 5J1PA 1N56A 3FDSA 2CWXA 3KJFB 3H2UB 1U24A 2FZKB 4NYZA 4ZVGA 4U7UK 4OLPA 3CD7A 2F7VA 4RW7B 3CJ3A 2B56A 3UD5A 3I31A 4A8XA 3EDQB 3GV5B 3HM9A 4OYZA 2BUNA 3TYTA 4USVA 3RBDA 1HBMB 4JI2F 2Q43A 2QV6A 1WOPA 1BQXA 4QPTA 2VIHA 3CB4A 4ANCA 2PIIA 3ILJA 3IS9B 3VGUA 1RT4B 1ARQA 1B70B 3FQKA 3MM8B 2G1HA 4RW8A 5ETRA 6FDRA 4CLUA 3KMSA 3KJVB 4DQIA 2MSSA 1N5YB 2H4YB 4RX6A 3OL8A 2P6TA 4ED4A 3RTVA 4JI8J 1IRQA 1RGVA 1L3TA 2W2NP 4N76A 2J6SA 1A0OB 3DU6A 3MAQA 1LWEA 2CFXA 2QLWA 4ECZA 1RHKB 1B0TA 4NLUA 1S1TA 5J2QA 1JJCB 5F8LA 3OR1B 4DZDA 5F8HA 4DUYJ 1AA1B 2E5HA 3AT1B 4J5OA 1M5HA 2YKAA 3W2VB 4LFAJ 3KLGB 4ECQA 1KHVA 2DXEA 3V6DA 1S97A 2UUCJ 3KNAA 2KT2A 1H7WA 5A0YB 3VZIA 5DM6Q 4Q45A 4H4KA 3RW6A 2FB0A 3PCOB 1RK8A 1B7FA 4M1KA 5DGBA 2VONA 3DI6A 1VI7A 1RT7A 3DRYA 3GJRB 4DSIA 2GZOA 5D3GB 2AD9A 4OMFG 2MGZB 5HMWA 1U4BA 5FDLB 1L3UA 5KFYA 5ITHA 4NXMF 4OQJA 1S9EA 2B5JA 4DQPA 5FDLA 1HFEL 2IMWP 1AYEA 2IDEA 4KR0B 2FD2A 2OJ3A 2YWKA 3BGFA 5B08A 2RRNA 5G0RA 1RI7A 3IRWP 2QX0A 1ELOA 4Q5VA 3AOAA 3N4WA 3QT5A 5MAOA 1GAOA 2Y0SD 1QDUB 3PRDA 7FDRA 3OT9A 2PD1A 4DV6F 3TZYA 2ZH6A 3CJKA 2ZDOA 3T6JA 4KHMA 4C0HA 1RLDA 3LP0A 2G1DA 1R8CA 2F3JA 1VJWA 2DGWA 2DEJA 3TI0A 1JJ2R 2YQ1A 2UVVA 3PW4A 2YNIA 1SJ4P 1JLBB 4DV4J 4B3SF 2GHPA 1NMEB 4TVAB 5ETLA 5BYSA 2NREA 1N54B 1IQTA 2DRAA 2WSEC 3DMJA 2OD6A 3KUEA 3T1AA 3UDVA 3FEZA 3W66A 3CC7S 3C66A 3MEGB 3D6HB 3KJNB 2QSWA 4BWJA 1FNMA 4B9TA 2R7TA 1RT4A 4DV3J 2KXFA 4F4XA 4DMZA 5CABA 4JI4F 4F4AA 4WF9Q 4DSFA 1UJ5A 5K8NA 2MB0B 1EHWA 2YPZA 1EQMA 2YNFB 3D4JA 4DQSA 2CVIA 2C3PA 1UVIA 4F0MA 2UUBJ 1X9SA 4OZ0A 1YHQS 4DJBA 1P9QC 2YNGB 3D0HE 2OIHA 1X4HA 2E1CA 4G1PA 2CPDA 2HVEA 2HWTA 1RCXB 4JI1F 3BO4A 1SQGA 3CJQA 4GC7A 2ATLA 3G4SS 3R7SB 1TK8A 3LPEA 3CE8A 2UUWA 1H0HB 2FVCA 2XBPA 2XI2A 2K06A 4UUXA 5K14B 3MR6A 3LOUA 4FZVA 1QJHA 2JX2A 2EFPA 2GV1A 3N5BA 3A8JA 1DLOA 2GO8A 4M8LA 3W7BA 3DOKB 4ICLB 2PI5A 5HQ8A 4O3SA 2CZ4A 2JSXA 4JI1J 4K0KF 2F65A 3Q89A 3BR9A 4CCHA 3GYNA 3L7OA 3RB3A 4F4ZA 3LGNA 3MCOA 1ZZFA 3BKUA 3I9V9 5F3ZA 3PVXA 1S0VA 2IFXA 1SJRA 3NLCA 1U1QA 4OX9J 2HPUA 3NCQA 4Q2MA 5LSOA 3VVTA 2HMIA 2BKOA 2ZEJA 1UEKA 1VQOS 2I0XA 1RT5A 1QE1B 2EG1A 4NLOA 1B64A 4R5PB 4I0WA 5C2CA 4GO5X 3G86A 1OY6A 1Q8IA 3DYAB 3IXQA 2DHSA 3CJTA 3L7PA 1TAQA 3VCDA 5AXLA 2BNZA 3PX0A 2GAHC 4CLSA 2BABA 4ED2A 1TVRB 4K4SA 2CDRB 5JXSA 4DV7F 1Q95G 1JLCB 2VL1A 4R5PA 4ED6A 2BJ3A 3DM2B 2K3IA 3O3LA 3DLEB 2ATCB 3DOMB 1H98A 4FVCA 5KFVA 3G6YA 2LEBA 2HMIB 5F8NA 2W7AA 1P94A 5KFHA 3GE9A 2EC2A 1Y10A 3HO1A 1X60A 2LDYA 3F44A 5E5NA 4OZ5A 4P6QA 3D67A 2AGPA 1J5OA 2D41A 2OEJA 5IT0A 1PBAA 1WJ9A 2MQNA 3MPWA 4DV0J 1HQUB 3GIKA 3VGSA 3DDNA 2JJ4D 4ATNA 2C2DA 3MF5A 3P5BP 5H9EJ 3H5XA 2XMWA 4ZCIA 2WVCA 3J7YU 2KI2A 3U1MA 1V6HA 3LO3A 3FSIA 2R7WA 4RW6B 3US5A 3PO4A 3PR4A 3G6VA 3Q2TC 4DR1F 3P45B 1NKBA 2E5GA 4UY85 2P9EA 3FEXB 3B54A 3UR3C 4F3MA 4EK2A 3CD5A 3KLHA 3WHIA 4XTTA 2FC8A 3CNQP 1KQKA 2IVYA 1VRTB 3NO7A 2YPYA 1MU2A 2RKIB 4XK8C 4YMEA 5L9NA 1RAGB 2APOA 3JAMY 2P9GA 2ZM6F 2FVSA 3X1LB 3H5UA 4MKYA 3CUNA 1GMWA 4C0OC 2RRAA 4PR6A 2GMLA 1IR2A 1GMVA 3F0NA 2CKWA 3UN2A 2CJXB 1P1LA 2NXCA 4ZKAA 2KTQA 1KRPA 1CG2A 1X4DA 2QIFA 3NNEA 3QMQA 3QRPA 5DG8A 1S4FA 1UEVA 2DHXA 2ZKTA 5D77A 4ENOA 2IHR1 1RKIA 1KVKA 3MEDB 3DHXA 3ZZYA 5KT6A 4O0IA 1RYRA 1MYKA 1CS4B 1S6QA 2WW8A 2HBYB 2OTJS 1PC4A 1Q7LB 1U9PA 3MMAA 4DCOB 5U47A 2HRTA 1EAYC 2MZQA 4PZVA 1V3ZA 5A6WA 4J9PA 2GX8A 5GMDA 2ZOGA 3G71S 2FVQA 4I6AA 2PT0A 5IV3A 3TA1A 3C15A 1UFKA 1C0UA 4P52A 3J81Y 2AYBA 2OPRA 1C1BA 3FFIB 3D6FB 5KFDA 1REGX 2XY5A 2N3LA 2ZHAA 1IQZA 3FFIA 5DDOC 2VODA 1TV6B 1OPZA 2K7JA 2WONA 1FK9A 2LVWA 2B9YA 3EXYA 3I82A 3MCNA 1EZZB 5KTQA 3CCJS 1O0PA 3OR1A 4NLGA 3QJPA 4DR7F 5J2MA 2DCUB 4KFBB 4QYZK 4EO6A 5E33A 2MZTA 5IXUA 2ZH4A 2V4RA 5J1NA 2W9AA 4OJ1A 2MGZA 2OEMA 4L3NA 2D3UA 2XI3A 1WELA 2VG7A 1O8BA 4HTIA 4USUA 4F3QA 2DNMA 1R89A 2DNLA 2LEAA 5HMXA 3DI6B 3C14B 4PCQA 2R8HA 4DR7J 2FIUA 4WFZA 2D7SA 2MJUA 4DPOA 2DPIA 4E0DA 4C8MA 1TMJA 2V68A 3GILA 1VQYA 4KRWA 4CNYA 1FJGF 4DL3A 4QIVA 5ETMA 1T94A 1DFDA 1RWMB 4DQQA 3Q22A 2ZE2A 3PJXA 3ZNUA 3L7UA 4HV0A 2XM3A 4LFAF 2GO9A 1WG1A 3BSOA 2L48A 2RILA 3OJSA 4DR2J 1F9HA 2HHSA 2R42A 2OGUA 1N32J 2V2QA 3HHKA 2AYMA 4DUZF 4BC9A 3RBEA 1F3FA 1LWCA 3KK3A 2ZWPA 2ASYA 3IGNA 3U1LA 3NOGA 3ISNC 2BE9B 5CYJA 2MZJA 2GVZA 2ADCA 2ZHOA 4O3QA 4TLQA 2ZC4A 1NJXA 3FJ2A 2VC0A 5J1EA 1X0FA 3ET6B 5E41A 2OKQA 4L73A 3RAXA 4V19J 1U8WA 2IJNA 3EICA 3JXOA 1J5OB 2VG6A 4IYQA 3ET6A 3JSBA 4K5RA 4AT1B 2XHWA 2KH9A 2DH8A 1LWFA 3HSJA 4MKBA 3Q2SC 1RP5A 1CJTB 2KFZA 2V8HA 3EGWB 3HP6A 3FK4A 4D3GA 1SJQA 5MLCV 2L9WA 3M8WA 2QZ8A 4IDKA 3J81j 2MLZA 3KK3B 4LSZB 3PIOQ 2C1EB 4KTQA 1QLNA 5IT9Y 2B9WA 4AAIA 2MHNA 2KM8B 1KS2A 4KH0B 3JSMA 1XJWB 1C0TB 1VLOA 3EM1A 5E3AA 2BA9A 1GQEA 7AT1B 1WACA 1I6JA 1K0VA 2IM0A 1TL1A 3H2LA 3WC0A 3F41A 3T1HJ 4UQGA 1S6PA 1M0SA 1WF2A 3GV7B 4LF7F 2HVDA 1RBOB 1RWKB 3BBBA 4ZCKA 2AT1B 1WEZA 3UW1A 4A4JA 1YBUA 5LL6d 1NH7A 4CM0A 5B0DA 4I1TA 2CWKA 5L1IA 2JOQA 1YDLA 4YY3J 4DBQA 1ZA2B 1XR5A 1KFSA 1NO8A 2EKYA 4MH8A 4TNOA 4OHVA 1UA1A 2I8EA 2E7XA 3H20A 1WKJA 2IAJA 2XMUA 2LXIA 2FJDB 1VQPS 4DL0C 1ZYQA 3C6TB 3G5OA 2LMIA 2V2VA 2KJVA 4LJMA 1C0TA 2HVZA 4E8UA 4PG4A 3H4BA 4DF4A 5KFXA 1XIQA 1X5TA 4PPZA 2EBEA 2KKEA 4FXWA 1FXLA 3GXQA 3CDBA 5JJBA 1OO0B 3UN5A 2CPFA 1YKWA 2O5DA 4M5LA 2YKNB 3GB0A 4QOTA 5D0EA 3Q0AA 4NA2A 1MROB 2WONB 3D0GE 4BHQA 2XCPA 3RAQA 2IVMA 3C2PA 5D0GA 2J0QD 5IV4A 4Q44A 3GP9A 2VG6B 3R5DA 5KG3A 1QSYA 4C48A 2VDHA 4NMLA 3SIPB 1R7IA 2AX1A 4BWMA 5LMNF 4UUWA 3I96A 4U7CA 1C0UB 1AFIA 2XNQA 1X4BA 2LCWA 3GWCA 1G2EA 1B4SA 3MCSA 3RU0A 3UN3A 1NZ8A 2KRRA 5KG5A 3B6BA 2D9PA 4ECUA 1U1MA 4PABA 4ZVFA 2AJ0A 1OWXA 4RBTA 1FE4A 3MMAB 4ZVUB 2BKNA 3D6MB 4CI0B 4G1QB 1Q5VA 1PAUB 3DGPB 1M1KT 5T7LA 3OUYA 4WU2A 3PYEA 5L8RC 3MEDA 4Z37A 2HKEA 2GMHA 4K7QA 3LWLA 1KD1T 2U2FA 3NWRA 3TARA 1BDTA 1REVB 3SDEA 1ZH5A 2D3OR 4LF9F 4XIUA 1YJUA 2RQKA 1UKUA 2X1AA 4HKQA 2OI2A 3OFHA 1TL3B 4X62F 1WG5A 3EMTA 1XMQJ 2A2CA 5HQMA 1V9OA 2UZAA 3AAWB 3ITHB 4FKYA 2CJYB 3OXLA 4OZNA 1NRKA 1AW0A 4MMOA 2C3YA 2MQ8A 3HHEA 2Y1LB 3KK2B 2BE2A 5D6GA 1WWHA 4C8OA 1VRTA 2IIHA 3UD4P 4ZVEA 4EI2A 3CMQA 3TZZA 4HYKA 2OPSA 2YH0A 5EWGA 4XPEA 4C97A 3GIRA 4WYWA 4USJC 2RUSA 2HK2A 2KB2A 1CEZA 5J2MB 2JEIA 3TAMB 4RW6A 2FYXA 3I6PA 1MWQA 4WK1A 1RE1B 1U0HA 2VPZB 2DHAA 2JXIA 1PJ5A 2LKZA 4I4BA 2JLFA 3QOQA 2QO3A 1U8SA 3MD1A 4NOHA 1XERA 4TY8A 4WP3A 5KFRA 2N3OA 1FNXH 1GNKA 1RBLA 4CLPA 3BO3A 3PO5A 1YGYA 2AV5A 4UOCA 1S1XB 3TOQA 2MQQA 1H7XA 1VIOA 1F9EB 5KFFA 3VVUA 2GVDB 4X4OA 2Z0GA 3ZZRA 2XMAA 1TR0A 1KOOA 1VLYA 4UOFA 4P74A 5HANA 3GFZA 5ETKA 2CZVC 3X3UA 5F9LA 1Y5LB 1LW2A 4LFBJ 3BGLA 2Q79A 3GIMA 4M5HA 4OHZA 1JLCA 2B9EA 3K17A 3LALA 1VK3A 1Q79A 3ENQA 3LP2A 2ADBA 1NK9A 2VH7A 3CJRA 3CULA 2LXFA 1SQEA 2LYVA 3BYPA 1OHNA 4B9UA 1NB2A 2MKSA 3PX4A 3UDEA 2CPYA 5HLFA 1VYAA 3S7RA 3J7AN 1VQ5S 2VA2A 1YK9A 1W2IA 2FY8A 2PO4A 3EVOA 4QWBA 2J0SD 2LA4A 5CA5A 1HW8A 4RW4B 1DHMA 5F0UA 4UT4A 1HBMA 2CPXA 4MKVA 1TMMA 3JAMU 4NXMJ 4B3OA 1WSRA 2KKHA 3T41A 3OVSA 4Z2XA 1EX8A 3EVMA 2DXDA 1HA1A 4U96A 4ZP6A 1AFJA 1C4AA 3PW0A 3M6VA 4CLZA 3QIPA 4CYUB 4RUCA 4AL7A 3VGTA 4EU0A 3K5LA 4B3MJ 2BJ7A 2FVPA 1N52B 4O0NA 4J9NA 2O01C 1KKHA 3FQLA 2P6SA 2R2TA 3IR7A 4OFZA 1FFSB 2G0CA 4NYOA 2FJBB 3Q8UA 1HR0F 1LFPA 2E5JA 1QAXA 3QWPA 3SCKE 4QBUA 2EW9A 2HK3A 3RRKA 4A8KA 3HHLD 1K9MT 3AHPA 4NEYA 1HMVA 5DDQC 4DG1A 1RT3B 3BM7A 3QLHB 1YJVA 3UCZP 2VPWB 5M2RA 1R0AB 3VAHA 3OL9A 3CIMA 1FF2A 1RTIB 2H3AA 1JLAB 2CUYA 4LF1A 5BR8J 1CQMA 4K59A 4ZPVR 1VBXA 4TYAA 3DFEA 5IS2A 1HR0J 4I67A 3M8QB 1VHIA 2YNFA 2ADLA 1EJ7L 4F2SA 3L3CA 1FRMA 1TKTB 3I55S 2NLWA 1CJVB 4LF4J 1ULRA 4X4VA 2OMOA 2KZMA 4JI4J 4PRFA 4O3NA 2LXUA 3BPSP 3O1LA 2AEFA 3UE2A 1V5IB 1ZM2A 5C42A 4IH6A 1FJGJ 2GJ2A 4OV1A 3KHLA 3UD3P 3TW0A 2KFYA 1KTVA 3DMJB 4CH0S 1AZSB 3SSQA 3NEKA 3NAIA 2PMZD 4DPXA 3VQTA 4RNFA 3VAIA 4DL6A 2UXDJ 4X4NA 2A2BA 5HAOA 5J2QB 3DYAA 3IM8A 2UVWA 2WVDA 2HIYA 4B3RF 2YNIB 3GIIA 5LMNJ 1KQGB 2QL7B 2RS8A 1VQLS 1F2GA 1VS3A 1JKHB 3ZC4A 1RYSA 5IQ6A 1RAIB 2VBWA 4OJ3A 1TFWA 4K5SA 1XBWA 1G6BA 2H5JB 2VF3A 3R5GA 3T5HA 4L72B 2R7UA 1RADB 1SH3A 3MR7A 4CO2A 1DARA 1ZM3A 4ZPDA 3TUZC 3JQJA 1S72S 3T3FA 2DK2A 2O66A 4L74A 2C28A 1JB0C 3PY8A 1RAEB 3NS7B 1S77D 2VG7B 2HNDA 2RB7A 3LGMA 3UI3A 3NGRA 2RS2A 1HNXF 3OFFA 3DXBA 2UV8G 3V4IA 1FJCA 5B0EA 4DCPB 3BGUA 3GR0A 4ZVTB 4ZCMA 4OYWA 4KKOB 2GCFA 2J0XA 4ZPAA 3W9IA 4MFBB 1HNWF 2F4FA 2DNZA 2VQEF 1WD6A 2DNNA 5IM0A 2QFIA 3AD8C 4ZPCA 5GAHU 2AWZA 1VR6A 1TV6A 4OHWA 2AJ1A 1IM6A 4R25A 3DRPB 1HARA 1XWLA 2Y1JA 4O4RA 4CLLA 1N36J 4R0EA 2HGNA 1TFYA 4QW9A 3UR0A 3OD2A 2LU2A 5HMZA 4LF7J 3MOJB 2W9BA 2HW3A 3EYZA 5KFLA 2DVIA 2HS4A 4ED8A 2DY1A 1HLWA 2KHCA 2OPQA 4TXSA 3C16A 3CGIA 3UNYA 4C6AA 5DGAA 1WC4A 3BGRB 3NBPA 1J2VA 2PDAA 4H54A 4PEOA 4Q0BB 3W60A 3LQVA 2XGQA 4CTAA 2K6LA 4I6WA 1P8GA 2J7KA 1VIXA 5THWA 3N28A 3RW7A 2AYEA 5HROB 2FY1A 1HYSB 2K29A 2YX4A 3P4UB 4KO0B 1U25A 1HD1A 5KFEA 4V19X 1Q86T 4FVMA 2BW7A 3IS9A 1Q7YT 1J5EF 2DB1A 3KXDA 2DRBA 2YWWA 2V6AA 2R8GA 1ZM9A 3CTRA 3CJKB 4FNHA 2CAXA 3D54A 2BX6A 4MIWA 4Q8EA 2RUGA 2RHQB 2Z2YB 4ANDA 2CXEA 1E6VA 2XWXA 4B3TJ 1SKRA 2QG9B 1T7PA 4NCBA 2E9TA 4LFCJ 1APSA 3CC2S 3TUIC 1SKUB 1NZAA 1BWEA 1LNQA 3TAQA 2GPEA 1R8BA 2LQ8A 2QLJB 3PYFA 1ZS6A 3DCAA 4B02A 5K8OA 2N82B 2XC9A 1U6ZA 2W8LA 1JXLA 5CXTA 3J7A1 4JUZA 1BHNA 2W24A 1T9VA 4FYVB 1DTQA 1LEOA 1RDRA 2V34A 1DBDA 2XWYA 2Z58B 3MM6B 2VFRA 2VHGA 2HHHJ 1FTRA 1JLGA 3GFHA 5AXMA 1HNZF 3J7Z5 3EZUA 5B7WA 1TELA 2ZOMA 4P2SA 1NPRA 3B4MA 1S1UB 1QTGA 2OMLA 3EWGA 5EDWA 3BR8A 4OI0A 2K5JA 2AJ2A 4D3HA 2W7OA 2MQOA 2ZNZA 2JFKA 2VA3A 4J9VA 1BQMB 3BS9A 4PKDB 4OYBA 2D74B 3W62A 5JUMA 1B0VA 2V8GA 4DX7A 3THPA 3V4MA 3TUJC 2JEJA 1S12A 4PUOA 4ELTA 4ILLA 4M5NA 5IM0B 3BZQA 1RLCL 2AYGA 4KQZA 2G0JA 4WBFA 2AX0A 2B51A 4LIRA 3NWGA 4PWWA 3R9LA 1RCOB 4DEZA 3OW2R 4IRCA 4PWDA 2BE7D 3MMBB 3EGZA 3K5NA 5HQLA 3C6TA 2VV5A 1W25A 3UDCA 1FKPB 3R8YA 2UXCJ 2RSQA 3QAEA 1U1RA 3OLAA 5IT9U 2Y8WA 3PACA 4PXBA 4RW8B 2H51B 2BRLA 1IR1A 1D9AA 2IMOA 3DLJA 3JTOA 4HR2A 5DZ6A 4NWBA 3ZZPA 4QPXA 1WUUA 2BRKA 1SQFA 2YWHA 3QRQA 1SCJB 3RR8A 2AU0A 1MW7A 4OIXA 2PMHA 4P7TA 2W2MP 4YN3B 1RSCA 2DXFA 2RQMA 2MQMA 2RF2B 1UJ6A 2VICA 4LBHA 3H2VE 4ECTA 1PG5B 4QR2A 3R1LA 2VBYA 2M8DB 4U9RA 2NYHA 4OZ3A 3CMES 2CQ2A 5ETQA 3RJMB 4ECVA 1RT1A 2BBEA 2AHOB 3MM6A 1F9FA 1GTHA 1HI8A 1MG7A 1N0VC 1RHQB 2HHPA 5LXYA 4ED0A 2BW2A 3WDOA 1WHVA 2BNWA 4Y3CA 4JI5F 1MLAA 1G1XA 1EKRA 3HCXA 3ZTPA 5A8WA 1BAZA 5KG4A 5L1LA 5EX3A 3BV8A 5FD1A 3SV3A 1FTCA 2M52A 2O1PA 3AOCA 4OYPA 2B4OA 2Y1IA 3I5BA 4K4TA 1CJTA 3AOBA 5CYMB 8ATCB 4C7QA 3QFHA 2L41A 1TKTA 4NZ0A 3PHTA 1IKWA 2MTLA 1YJTA 2E1MC 2ZZNA 1ZPWX 3HKZD 4QCLA 3S01A 1WI6A 2WRMA 2R4FA 4U95A 4H4MA 4NE9C 4NLRA 2N4CA 5ETSA 2DHGA 2CYYA 3HHDA 2XULA 4C0BA 1R3NA 3Q23A 3NS6A 1SL2A 1HNXJ 4FBUA 4O3RA 2XNRA 1UJ4A 2HHTA 4LF8J 3RRHA 2EEYA 3QWUA 2X1FA 3TO8A 4EGLA 4DI6A 4K50A 4LRAA 2X51A 3P96A 2AQ4A 2QN6B 1IM4A 1ACMB 1Y3JA 5SUHA 3CD6S 4K4VA 3MWBA 1T9YA 4CTAB 2UXBF 1UP1A 4OYMA 4Z7CA 4HDHA 2KXHA 1FO1A 3CCUS 1NNDA 1S7IA 1U0SA 3NGSA 4OI4A 1Y11A 1DY3A 2V5HG 4USIA 2DGOA 2IC3A 2A6OA 2GIQA 2VBXA 3DLKB 1ITPA 3MUTP 1OYDA 1FRKA 2RDIA 1W2BR 3IR6B 3MHYA 3T9NA 4WE1B 4EMDA 5L46A 3G82A 2OHDA 3B78A 5HATA 2ZD1B 3CDAA 3BSNA 3R5AA 4X65J 3FBEA 4CIOA 5EN1A 1WF1A 4LRDA 4Y34A 1HBNA 2DIVA 4NCGB 4W92B 4RUBA 4YEAA 4XPCA 3DKDA 4TU8A 3NMRA 1B28A 3FCVA 4DR1J 4OI6A 1T11A 2YY3A 2DR8A 3GSIA 3FRZA 1RWUA 5C24A 3BB5A 2ZITA 4HT7A 4KHRA 3A8EA 4CWBA 1S49A 3DOLA 1SIZA 2BDPA 1QD1A 3LUYA 4N7TA 3MM9A 4AL5A 4KH1B 4WYLA 5LXRA 1S1WB 1DQ9A 2XYHB 3IRXB 3G2XA 2EI5A 4IRKA 5D3GA 4HH0A 3H90A 4PAAA 4DZ6A 3NMAA 2J5AA 3VF0B 4DOZA 3C8YA 2V2KA 2WW4A 3S1TA 5A76A 1V3RA 5M2PA 2QA4G 2R7OA 2QMUB 4I2QA 4DPYA 4MT1A 4MK8A 1RHUB 5A0YA 1P6TA 2PEHA 3QT6A 4DL4A 1D9DA 3BPDA 1ZZNA 2ZH1A 3C15B 3IBCB 3KOAA 2HAIA 2ROEA 2YNHB 3DNCA 2HHHF 2ZH8A 4AFFA 3H42A 5A2QY 2KXNB 4HT5A 2DRDA 1JMTA 1SC6A 2GJFA 3CCZA 2R7RA 4L75A 2G2ZA 5CHCB 1LWEB 5KFAA 1IBKJ 4GVBA 1XNRJ 3NNHA 3TP2A 2I5JA 4ALZA 2V50A 4PQUB 1BDVA 1S6QB 3T5KA 2IBKA 2HVIA 2B6AA 3OHBA 1T03B 5LT5A 4DV3F 3GG1A 1L5UA 1GMUA 3NGTA 3PKMA 1WC3A 3QZ7A 1DZ5A 4LQ9A 4OZJA 2CNOB 3EJMA 5HBMA 4K4WA 1HWIA 2R7VA 3G8TA 4URGA 2KYZA 4FNIA 1ROFA 4DN9A 1FRIA 4L6V3 1T05B 3QJLA 2DCLA 4GKKF 5H9FJ 1S9FA 5L1KA 4ZMMA 3TZWA 2CAJA 1IN0A 1MU2B 2RKIA 1MMLA 1RT3A 1UVKA 1FVQA 1S99A 3M2VB 4HACA 5D0HA 4EUVA 3E01A 2R2SA 3ICLA 1AUDA 1K47A 3OFEA 4M5JA 4Y2CA 9RUBA 4DR6F 4KHPF 2HRUA 4AUKA 3GFYA 2XGPA 3K7RA 3GPAA 4DPTA 3M1VA 3IP0A 1QM9A 1RTHB 2OP5A 1IBLJ 3D66A 2C2ZB 4GKKJ 1WOOA 4F04B 3QIPB 3H7HB 4NLQA 4CYUA 3EZ5A 3CCES 1YI2S 1UL3A 2FLLA 1WDDA 2MLYA 2VG5A 2YQ3A 1CC7A 3CJ0A 4YY3F 3KMQA 4GC6A 4ZN1A 3D28A 2BANA 3W8PA 3OXGA 4RUHA 2VOPA 1YZ7A 1QUPA 2AIRB 1SXLA 2IRXA 2JWNA 1ZAWA 3HLUA 4ZJQA 4P2XA 4CLTA 5SZTA 4N77A 4USMA 2JRSA 2WK4A 5E2QA 3MM7B 2D9OA 1EARA 1KC8T 4O44A 5LM7E 1HBUA 4DSJA 4RR5A 1X5SA 4LSNB 3I5CA 3JB9k 1S9GB 2DEIA 1PARA 4QZVB 3A3PB 3LANA 3P3DA 3PFEA 2DGQA 3MCMA 3RYLA 3D1QA 5L39A 5CQGA 3KHGA 1ZA1B 2YX7A 1UVMA 2IAJB 2C2EA 4OL8A 3M30A 3MUMP 1U6FA 2MJNA 2CPEA 1QE1A 2XZWA 4LFBF 3WX8A 1H2VZ 3BQ2A 4X4UA 3C6UA 4WFAQ 3CCLS 1F5AA 3K5OA 3PJ9A 2WCXA 1YTYA 2E1RA 5IWAF 1WOSA 2E7WA 1FKOA 2GMJA 2AMCB 2OLWA 1B99A 2L08A 1EP4A 2QMWA 3NP5A 4M5IA 3PW2A 3ULHA 4NRTA 1SH0A 1HNVB 5C25A 1Q16B 4IOBA 4WIIA 1T8EA 1Q5YA 2FQQB 3IN5A 1FJEB 1YRXA 1PYSB 4X64F 1KFDA 3CCMS 1N6QB 2CG8A 1O5JA 2IPOB 2SXLA 3KWMA 4UZCA 4Q8FA 4ZP7A 2IM3A 1BWVA 5H9EK 5LSRA 4OHXA 5F8GA 1VK8A 1Q1KA 1YJRA 4DPUA 1IBMJ 2ZZMA 3K59A 3E2EA 3OQ2A 2LDIA 2PN6A 4KPYA 4ECSA 3KYLA 3FBFA 4WFXA 5JMNA 2BR0A 3KLIB 2N4DA 1M5KC 2G2OA 2KELA 2D1CA 1FA0A 1S1VA 3AJ2A 2PC6A 3UO0A 2ZH3A 1VQNS 4NZ6A 3VW4A 2ZVSA 4QWCA 4F02A 5KT3A 3W9JA 2KZZA 5A8KB 5H1SV 3NNCA 1KDNA 4NLSA 2J9CA 3CJ8A 4QJVA 4ZVRB 3MR2A 4PG8A 1FJ7A 2L9DA 1IR0A 2O67A 3R1HA 5KFGA 1KQSR 2MYFA 2FGCA 3M9MB 4N41A 4RU2A 2QTWA 2Z56B 3GYGA 4J9UE 4M5DA 3TX8A 3HFZB 4ILRA 2M2BA 4WIQA 4CLYA 2DNKA 3HZGA 5FLXU 3AB4B 3FVYA 4ZJLA 1HQEB 1Y0HA 3AXKA 3KJQB 2ZUAA 3FGVA 3L9ZA 5C5JA 2MQPA 1BLUA 2CPGA 1FEEA 2Q2KA 2MKCA 2QSFA 2NCKL 2RMLA 2KG1A 2ZH2A 4IH5A 3TEHB 3QRRA 1VCTA 3TQEA 3KK1A 2MKJA 4DPWA 4A8YA 1FNOA 1R8PA 5IC6B 2W9BB 3OTOJ 5H9FK 1VQSA 3NY0A 3V2UC 3ETMA 3FNNA 2IM2A 5GMKa 2ZE2B 4AE5A 1SI9A 4RBVA 4EEYA 1NJYA 2E5LF 3KG0A 3TA2A 3TUPA 3SI8A 1XMBA 2Q6CA 4J9MA 2HURA 4IOAQ 2XQCA 3THVA 1N4LA 3HK2A 1S4EA 2CNLB 2I38A 4DX5A 1NDCA 3RGIA 2RDJA 1M5VC 4OLOA 3POTB 5A8RB 3CO0P 2QLBB 3AH6A 1HQ2A 1HWKA 2K1RB 4QYRA 3HZEA 2PMWA 3OTOF 5HP1B 4XAKA 4NZ7A 4K4YA 1NHUA 1S1WA 5HK4A 4OI1A 3SV4A 1GK8A 2F8MA 2Z4PA 3SSRA 2ZH9A 3N6LA 3LH2S 3K8VA 1SJFA 1RTDA 4R0JA 1CLFA 1QUVA 1BY9A 4CH7A 2PE8A 3BSCA 2JDJA 2M88A 2AZ1A 3HDSA 4LF8F 5KFUA 3J7YI 3N9UC 2PA3A 2ZC3A 2MZ1A 1Q16A 2R2UA 5GMEA 3VAGA 1CULB 2RQ4A 3FCWA 5KFMA 4NA1A 3HKWA 4KJIA 1HBOA 1RACB 2RNEA 2EVZA 1Q8BA 4OYXA 2NXNA 2HHWA 2VB6A 4NXNJ 3IG1A 2FJVA 1BQNA 2OUGA 4QU6A 4NA3A 1IKVB 2K2PA 2OPPB 4DV1F 3DRSB 2XS5A 4FXDA 3TZXA 5JVGQ 1VRUA 2DR6A 2DR5A 4DR6J 4FYYB 1X5OA 3EPGA 2KVQE 1Y4ZB 2OSQA 4NI2A 1VJQA 3VHQA 5CD4H 3VEAA 1AZSA 1XQIA 5HVHA 4ECRA 4ZLPA 1OS5A 4I2PA 3VTIA 3BDPA 1QSLA 1V5VA 4IO1A 2MEWA 4QQBA 4JV1A 1QY7A 4IDKB 3O8WA 2Y3YA 1T3OA 1UFWA 2QLXA 4JI0J 2Q1LA 1N5YA 4B9NA 3M9OB 2FHKA 2HQ3A 2OELA 2PA8D 4U6PA 3D2WA 4W90B 2AEMA 5KT7A 3VWSA 2HQGA 3G6ES 1S59A 2YKQA 3T1HF 1NK5A 3JQMA 1F6TA 1EB0A 3R5BA 1NDLA 2DNQA 2HZCA 2C2RA 2EC0A 5DZ7A 3MDFA 1FVSA 1X4AA 5HN0A 3PKYA 1S1VB 3SQGB 2FHJD 3MMCB 4U8YA 3WIVA 1HWJA 4ES2A 3W5ZA 2B4PA 4WFYA 5I3QA 1NJIT 2MY8A 1LWCB 4GKJF 3P6YC 2BJEA 3HSDA 1N8RT 3OV7A 5A8WB 5ETOA 2AJQA 2VU5A 3TRGA 1N34J 1FD2A 1BC6A 2ZVIA 3CC4S 3UDLA 1GX6A 3ETOA 2ERRA 1KTQA 2HQCA 3E01B 2DR9A 4DWIA 2CQCA 2F63A 2Q6BA 3KUHA 4FXVA 5L38A 1TL4A 5A2QU 4TU9A 3QT7A 3KLFB 2ASLA 2ILZA 2K3KA 1FWKA 3FUYA 1EETA 1Y5IB 3D7SB 5KG2A 4YFUA 1JWWA 2V4JB 3OBIA 4LUBA 3W5XA 5CCMA 3IWNC 4UOHA 5KG0A 3N6NA 1UA0A 1FKOB 4QWEA 4PG6A 1NPKA 3NGUA 4B08A 1HHTP 3CDEA 3M6XA 2W4CA 4FF4A 5KFTA 3H98A 3L95X 1PAEX 1OY8A 2IA0A 4X64J 2C2MB 3A8KA 2RJZA 2XMMA 3D3BJ 1XN9A 3LJPA 4CH1A 1RT2B 2B9XA 2YKPA 4UTGA 2KL8A 3H25A 3R3TA 2YH1A 1U2FA 2YXLA 1UTAA 1YZ6A 1F5BA 1TKZB 1DTTA 2VFSA 3GR1A 4AYBD 5DETA 2KM8C 4DV6J 2C42A 3OSPA 2WOMA 3B4DA 2V67A 4CO0A 2WVEA 2CJAA 3OL7A 3PFOA 2YNHA 4J90A 3SQOP 1HHQA 1RAJA 4JBCA 4ZPTR 3W63A 3G8SA 4IR9A 1HNIA 4L3KA 1OQ3A 1CQNA 4LRBA 2AJFE 2RAQA 3I4HX 4Y2AA 5G4DA 5HJXA 1Z1ZA 2LQ5A 1LW0A 2EWHA 1N36F 3KTQA 2BANB 1D8YA 2AEJA 4I2QB 1C1BB 5ADZA 3K58A 5HVGA 1UPPA 2GAGC 4K4ZA 1RAHB 2FHMA 2GQQA 3DLGA 4MJKA 3O44A 2XCAA 5GAEU 2U1AA 1MMDA 1IVZA 3OXFA 4IQMA 2YKOA 5CYQA 2ZH5A 3TJ8A 3VEBA 2A3JA 1SJ1A 2RRBA 3OTEA 1DTQB 2E29A 3JS9A 3KNGA 2OPSB 3K89A 4IG3A 2B43A 2ALZA 1Z4UA 4TY9A 3UVJA 2BJ8A 1VFJA 1WKKA 2DT9A 5K14A 5HO4A 4XDDA 1KVJA 4PPDA 2KJWA 2BE2B 1HI1A 2UUAF 1N32F 4RBUA 5KT2A 1A9NB 3I0RB 2QGFB 3DN9A 4PG5A 4DR2F 1E6VB 4ZPBA 1YJ9S 2VD3A 4DR4J 1R27B 1TUVA 1IKXA 1WC6A 1J27A 1PSDA 2VDIA 2YWEA 4UZBA 1RT6B 1RWOB 3GSDA 3HSGA 3M4XA 1CJUB 4PYAA 4TU7A 5A6PA 4J9LA 1JX4A 1NAQA 2DIUA 3GJQB 2H48B 3H87C 3ADAC 3QNWB 1RABB 3QBCA 3TJ9A 2H5IB 3OLBA 1H6KX 1SC1B 2E1AA 2XHCA 4LF2A 5DG7A 4G1IA 2BOAA 5IT4A 3C3LA 1DAXA 2J8AA 3P8BB 2DHHA 4P71A 3ONQA 4KY3A 5KFSA 4C3LA 5HJYA 1PIEA 2CQ4A 2J9DE 5DM7Q 2B4VA 1H2TZ 4L76A 2F8EX 2IRYA 2JBVA 2C2NA 4OX9F 1ZTWA 4JB8B 2XSJA 4Q43A 4ETXA 4KGXB 1X0PA 3CF5Q 5L1JA 1I94J 3CCWA 4ZS6A 2V9KA 1WORA 3GZ7A 3QO9A 1S6UA 5FIIA 3RR7A 1FDBA 1OY9A 2HNZA 3D6TB 3DDIA 3FMBA 2VPYB 2GIRA 2LQ9A 3PXGa 1NB7A 4N8NA 1DJ0A 3V5RA 2B7BB 2E7VA 3GQCA 1MMNA 2CQIA 4A8WA 4GO7X 2DGSA 3IBFB 3N0VA 4RLEA 4AXJA 5AXKA 3UWTA 1LK5A 4QIEA 3CDUA 3W2WA 1LW0B 2GFFA 2QRRA 3A12A 3AQPA 1FEHA 3KLIA 1Q4RA 3DRRB 4RW9A 3SCJE 3PEHA 1V3SA 2C2OB 2MMYA 2KYXA 2RT3A 1RAFB 4YR0A 1SKWA 1XR6A 2H9ZA 1MNEA 5KFKA 1UWAA 1ZOTA 4WJBA 1LXJA 2EK6A 2W9CA 2JH3A 4J9SA 4DSLA 2YWGA 5KOXA 3L4BC 3FSYA 3DOLB 1Y5NB 4CRJA 1IXKA 3HHLC 2HNDB 4OZ2A 1S9EB 4DV0F 3MM5B 4F25A 2EFGA 3OVBA 3DU5A 4I64A 1N5SA 1X4FA 4M63A 4A46A 1GMWD 3AJDA 4QR1A 1R31A 1FXDA 1VMBA 3MURP 4GKJJ 4G3IA 1FX2A 1MYLA 4JI8F 2HHXA 2HLUA 2ACMA 4ID5A 2ZD1A 3Q86A 5BR8F 2R2RA 2XLKA 4JI3F 1HHSA 1WKLA 3FRYA 3FZBA 2EFQA 1UW4A 3GG0A 2H3EB 5DDPC 5CZVA 1S0MA 1ZAXA 1B0PA 3R97A 5J2NA 1N34F 2P9CA 1D9FA 4ZHRB 4N47A 3EUNA 4ZCLA 2K8GA 4YQWA 2W25A 2CPIA 1ARRA 4JI7F 2QA2A 3MR3A 1FT8A 1H2UX 4ZLNA 4DN0A 1S0OA 1TKZA 1H38A 2OFGX 2B3TB 2MZSA 4YP3A 4C11B 4OJGA 1TK0A 3EGVA 4LF6J 2R7XA 2AY0A 3ZFVA 5EWFA 1FRJA 1SVDA 2BVZA 4USWA 1RT2A 2V8PA 2G9OA 2KT5A 2LU1A 4X2BA 1RTJB 2CZ9A 4F4KA 1EA4A 1M1HA 4DLGA 1LKZA 2YNGA 3E51A 4EBEA 3H5YA 2Z8QA 4ZVQB 4C8NA 2CADA 4B3RJ 3MMCA 2AKWB 4WTYA 4FF2A 2WVFA 3H0PA 4QYZJ 4LSLA 2ZH7A 4KT0C 3T6BA 5IC4B 1XNRF 1B3TA 2MKYA 2X1BA 1EETB 2VUGA 3WZ0A 3OTDA 4FBTA 4LF9J 3T5JA 3IWLA 3EVWA 1TKXA 3MEEB 3C19A 1RTJA 3M1VB 3KLFA 4LRCA 2UXBJ 2FHOB 2MY7A 3EGNA 1U47A 4IFVA 4URSA 1U48A 2DPJA 3VGVA 2UXCF 4TQRA 3HFVA 2CQ3A 4HH1A 4DV1J 4DV7J 4IFVB 1DQAA 3CSKA 3MEEA 3D5MA 4NLTA 4HTJA 2EFOA 1WC1A 1KWMA 2LFVA 3DDKA 4OX8A 5HMYA 4HHUA 1JLEA 1SL0A 2YTCA 4FYDA 3OFGA 1WEXA 4DR3J 2C22A 5KFWA 3KHRA 1PGZA 2X1GA 1N33F 2VQEJ 1R6VA 1DQ8A 1YG0A 3QJJA 1QAIA 3HI9A 1JLQB 3S8SA 2KO1A 4C2MA 1IKVA 2OPPA 1IBLF 4B3OB 2XYPB 5CAAA 1BE4A 2KN4A 3LA0A 2BA3A 1VHFA 2CNNB 4ECWA 2YBVA 1YJNS 1HBOB 3FBBA 1T03A 3DLLQ 4KE5A 4I7FA 3O6QA 3W3SA 5KT5A 3BKFA 2M70A 1UMJA 1FKPA 4JI5J 5HROA 1CC8A 4B9LA 3BN7A 2WVBA 4QIFA 4ID8A 4KIAA 4TN2A 2DITA 1TAUA 4PWDB 3N01A 4KC5A 2V2ZA 2ZBPA 4IR1A 2VC1A 2B0GA 3NBPB 2W9CB 4NI2B 2W7PA 2HWIA 1UWBB 2OPQB 3HD1A 1PCAA 2QMXA 2YKMB 1FWLA 2W01A 3AY0A 3QSYB 1TQLA 2K1RA 1TL5A 1U7LA 2GVDA 2J7UA 3HVRA 4Y6IA 3DRRA 3BO2A 2BJ9A 3IA0A 2HHVA 4JI3J 2BZ2A 2C3OA 1VQ8S 1M90T 3HMJG 3J80U 3AB2B 2HAFA 1M5SA 2XS2A 1RWXB 2CQBA 2ZKUA 1OJ4A 2N7CA 4CZCA 3F73A 2ZBQA 3M8PB 2ASDA 1E6YA 2ROPA 1X4CA 2XLJA 1U0HB 3JYTB 1NEEA 2CDQA 3IR5B 4OYIA 4YB7A 5F8IA 1X9WA 4YOEA 2BMBA 2P5VA 1R43A 1OSCA 5D15A 2OSRA 3M2UB 1TKDA 4J9OA 4LRFA 4Y00A 2AZ3A 2W4PA 3DLHA 8RUCA 4NEZA 4WP9A 1T3NA 2J0WA 2FZGB 1CS4A 2M5YA 4RO0A 4DSEA 5B0FA 1UZHA 1KOHA 4HLBA 2V9WA 4A8FA 1SV5A 1NK7A 3NG8A 4FYWB 1NM2A 3POTA 5A8RA 4M95A 3JYTA 1WC0A 2G0IA 2ILYA 2NSBA 3KHHA 4IH7A 1ZTTA 3M7VA 1Y3KA 2DNRA 4X4RA 2ABYA 4YB5A 5BYRA 3NGDA 1RWPB 3VAKA 2WHOA 2VZ9A 3FCHA 1CJUA 2QE5A 1HD0A 2CPZA 2CRLA 3DLKA 2LLZA 2DGTA 3A4TA 2R3VA 3I0SB 4PYDA 1TUWA 2LQBA 4KO0A 1YWXA 2FTRA 4WFNQ 5CD4A 3PR5B 5D4LA 4K8RA 2XSJB 4DR5J 3R2DJ 5LMUJ 5IQQA 1FRXA 1G7CB 1RHJB 3SMZA 4JYAF 1TUGB 4IG0A 2IRUA 5DO2A 5AT1B 1XR7A 5IZHA 5EWEA 4W4MA 1K44A 3HD2A 2IVFB 5I42B 1QVFR 3BEGB 3W61A 2J8SA 4C8KA 1A7GE 1NLKL 1Y9OA 2AJ4A 2JZ5A 3P49B 3R7NB 2MLXA 2OH2A 4RWXA 3KKFA 1TZ0A 4WXWA 1O51A 4ECXA 3O5TB 3LTOA 1NSPA 4KB7A 1D1UA 1UAWA 4MK9A 2YWFA 4P72A 1MROA 5AE3A 5DQIA 4J91A 3VR1A 1FE0A 2CJQA 2LP4A 2W4DA 3VAJA 2NYIA 1NDKA 2KT3A 2ZBRA 3HX9A 4OX7A 2QFJA 2ZBIA 3M2RB 2E1PA 3CWJA 1KR4A 3A3NB 5E7OB 1N5QA 4DUYF 1D8ZA 3UVJB 2JLGA 3MTKA 3THTA 1NSKL 1GX5A 2CQ1A 1LXNA 1YRTA 2P2CB 3GONA 3K57A 3ILIA 1RWVB 4A8SA 1HPZA 5D4NA 5I3UA 4YDDB 4B3TF 1RT5B 3MPYA 1Q81T 4F8RA 3IWXA 3MPVA 4NLDA 1S79A 1OQ6A 4NLWA 1R0BG 3DLGB 3PZPA 1RUSA 4FN5A 1U1KA 4C4WA 2C2KB 4PXDA 2XY7A 2FUG9 3TVYA 2Y8YA 3GU0A 1HNZJ 5GAGI 4ICLA 2G2YA 3TVKA 4ZP8A 4ZLLA 2V4JA 2HGLA 5I4MA 5K8MA 3I4PA 4ER8A 1KN6A 3M32A 4DFKA 1IWGA 4FDFA 1UCNA 5D78A 1MN7A 2OEKA 1YJ7A 1F60B 3IGVA 4MK7A 1S9GA 3V81A 3M9NB 2Y9HA 1NJZA 2K1OA 2H54B 3SSSA 2MXYA 3W1YC 5C42B 2HIQA 1RHMB 2UUTA 3H4DA 2VQFJ 3HJVA 1F5CA 3M2VA 3PYGA 4HACB 4UOGA 2MQLA 1NK4A 3LGHA 3R2CJ 5F8JA 3HULA 5LJ3Y 1VBKA 4K2XA 4F4WA 1RAAB 2JL9A 4JOUA 3T1YJ 4PXCA 2E9RX 4C3KA 1VQ7S 5J1EB 4YDXA 1T9WA 2UVRA 4WKRA 1CBKA 2DNPA 5HBMB 4NRUA 2KU7A 2VKRA 4U67Q 2HNYA 2A6MA 3MOZA 2QYGA 4Y2KA 5AXNA 5ETNA 1VOMA 2CQGA 4KBIA 3TAMA 1SUQB 3QAUA 2JEFA 2RU3A 1WF0A 4DX6A 3GTYX 1S7HA 2W1BA 1IUJA 2EFNA 3ENVA 3EZOA 3UCGA 4X66J 4BCAA 4HDGA 3U02A 5C2GA 2IA6A 3CCSS 1FCAA 4I2PB 4CM2A 2XZTB 4WCEQ 2BV3A 3ZTRA 3IC1A 3H5SA 4KGMA 2X3GA 5DQGA 5GAEI 1S10A 4LF4F 3LP0B 3BREA 2GGPB 5EGYA 4QWDA 5IOLA 2M4MA 1SBRA 3ILLA 1YX2A 2MPUA 4K2JA 4RW4A 4A47A 4CDIA 4DUZJ 2CJKA 2VPXB 3MD3A 4RNHA 5HI7A 3EPIA 2ZJRQ 5AJ3J 5KG6A 2HZAA 3CCTA 2ZFHA 3GMGA 5CH7B 4YR3A 5HLFB 3G8QA 4BC7A 3IFEA 4N56A 2E5IA 4Y28C 3FMTA 1HPZB 2JXHA 2XMVA 2C3MA 5I3UB 1RHRB 1SV5B 3QSIA 2B5JB 4I68A 1SIWB 3W8GA 2CQDA 2Z2ZA 3WBZA 4G6VB 2FPHX 2HFZA 4DV5J 3Q8VA 4QWAA 1RT7B 4B17A 2LECA 1FKAF 1VRUB 2EPIA 4RKUC 2HS3A 5K8PA 5F9NA 3E8OA 3NAHA 1RTDB 4ZP9A 5F0WA 5EX0A 1FI4A 4WXOA 3OHAA 2E9ZA 4IQXA 3CXCR 5KT4A 4RZRA 5KFNA 5LMUF 4QU7A 3PJWA 3KFWX 5GVQA 5KFBA 3ILOA 4P7VA 2IC3B 3ZNJ1 3OSNA 3MECB 3ZZZA 5DG9A 3B8HA 3KK1B 4LF5J 3V4IB 2HRYA 3UQSA 4DL5A 1TK5A 4WZMA 2BQRA 3L09A 3HHLA 1SIWA 3M6WA 1WEYA 3M8YA 1QTMA 1UVLA 1NLAA 3D3CJ 3CJSA 4ZVSB 1RTZA 2R8IA 2DH9A 5HP1A 4UY8T 3A3OB 2UUCF 1TTHB 2OO4A 4I7FB 2CPJA 4DU8A 3Q24A 5EHHA 1HBNB 3MR5A 1URRA 1YBAA 4LR8A 4OZ1A 4EYHB 4MJWA 2WZ1A 4RW7A 4ZA1A 1HWLA 3TR5A 2GGPA 1RT6A 2OAUA 1I3OB 2IYIA 7FD1A 4O23A 2GW8A 2EG2A 5D4PA 1FDDA 1I51B 3I87A 2HFSA 3T19A 1RWWB 1X7VA 2XTJP 2DTJA 3EDRB 3FBCA 3M8ZA 1GFWB 2HFUA 3JQKA 2HHQA 4G1QA 3MGJA 3MTJA 4CLKA 1AROP 2DGUA 4GVLA 4RL1A 2LEPA 4ZIVA 3JSMB 4F3OA 1WHXA 1ZETA 2Q66A 4K4UA 2FZCB 4B9SA 1LWXA 2FDNA 2VKZG 2ZM6J 2ASJA 2F4VF 4RWWA 4CT9A 2DH7A 1IKYB 1N6QA 2HVHA 1C2PA 1JJHA 4KV8B 2JFDA 3KLGA 2K9IA 1QVGR 4J7CA 4NPOA 4HI2A 4ES1A 1EP4B 1ZM4A 2DBBA 3M8PA 2NR0A 1P9YA 1KBRA 1U45A 3MEKA 1RA6A 3GYXB 4C9DA 2MHEA 2FLPA 2CVEA 3G6XA 4I56A 2GVZB 2NUHA 3J7ZT 3V6JA 2QJ3A 2A1BA 4LIWA 3DLEA 3WC2A 2HLTA 3HVTA 1PYTA 1NSQA 4ECYA 4DFMA 2BACA 4I6YA 2GS8A 2AN7A 4X4TA 2HBRB 1FFWB 1U6BA 4YUDA 2IJFA 4M5KA 4ZN3A 1TVRA 4HI1A 4Y65A 1G3OA 2KRBA 2V8DA 4LBPA 4LSNA 3N5FA 1K8AT 4C8LA 3GCWP 1WTBA 5K9FA 4RPFA 1Y00A 1KQFB 1RU2A 1HI0P 3E3XA 4ZHRA 2POKA 4PUOB 5GAGU 2DR7A 3UNGC 3H40A 2Z2MA 1GTEA 1RU1A 3JTPA 5ETTA 4X66F 2NXJA 2D69A 3LP1B 4FXEA 5E3CA 1VBYA 1UETA 3SFGA 2HFOA 2W2PP 3C14A 2VASA 1S6PB 2HQFA 3MUVP 3NS5A 2FLNA 3HSZA 3ZXWA 5CZXA 4LBIA 3KDOA 4QIWD 2CQHA 1U2RA 4MKAA 4IO9Q 1PJ7A 4YB6A 5RUBA 1NXIA 2DKOB 3M05A 4H4OB 3MAAB 1VGYA 4ZPWR 2BXJA 1FX4A 4C8YA 4O44B 1A6LA 2W2QP 3RB4A 3H8YA 4HEA9 5K5MA 1YJWS 1RZMA 3U27A 5AJ3F 1LWFB 4LFCF 4YS2A 2GHWA 4PWUA 4LF6F 2PFFB 1WC5A 1Q0NA 3KG1A 2DO0A 1GEHA 1PC5A 4LVNP 5T41A 3BH6B 3UFCX 5AE1A 5KFJA 3BDEA 1U49A 2E5LJ 1L3SA 4O3PA 2DGXA 4LSLB 1N0UA 4TY8B 3MAHA 2O3DA 5B0AA 4DL2A 2B4UA 3PM9A 1U1OA 1S1UA 4ELVA 3K2YA 1EIYB 1NK8A 3T9ZA 2V69A 4KV8A 1X4GA 1H73A 1OG7A 1JIHA 4F7VA 1PBUA 2B6AB 2N7YA 4LMZA 2ZJPQ 2UV8A 3IMQJ 1NHVA 2LA6A 2WSFC 4ME7E 2X3DA 4DS5A 1NK6A 4FF1A 1S48A 1GXTA 2J9EA 2DNGA 2Z57B 3N6MA 4MYUA 1JLBA 2DD8S 1QAYA 4FPRA 4OYOA 4Y0FA 2MKHA 4MIBA 3BGRA 3R6LB 5E3QA 4Q0BA 1CVJA 4CP5A 4FS1A 1T9UA 2G13A 2VQFF 1T05A 2F5GA 4X4QA 2M8HA 2WB1D 3I0SA 3ITHA 3EX7B 4IFYA 4Y2IA 5E3PA 3PW5A 1S0NA 2HZVA 1I5OB 3KUGA 1TL3A 3DGVA 1BQNB 1JNRB 2I2YA 5KFCA 1PJ6A 2CG4A 2UU9F 4ZLJA 3OJUA 3T5LA 4GRSA 5BXIA 3HHNB 1REVA 1D3WA 4LF5F 1X8DA 3GJSB 2CJBA 2IBOA 2NSCA 2QEXS 1D09B 4ANEA 4RNOA 3DGPA 2I5JB 2DISA 4KKOA 1C1CA 3OR2A 3W64A 3MM5A 3OTBA 4ZDNA 2I6WA 1KHWA 2RQCA 4DFPA 2KG0A 3MM9B 5DDRC 1P1TA 3BQ0A 2QL9B 4DV4F 4B3SJ 3I9ZA 3ZZ0A 4P9SA 4WFBQ 4PQUA 1R8HA 3TAPA 5D8HB 1X9MA 4CNZA 1FK9B 2ZZTA 5CYQB 5T14A 3MECA 2BM0A 5F8MA 4JI0F 4CT8A 2FHJA 3CPWR 2F40A 3NCRA 3PHEA 1BUXA 3D9BA 4XDCA 2ACYA 2XMJA 3HVWA 3KLEA 1Q82T 2QC3A 5JVHQ 1WHYA 4M94A 3DRPA 3P5TL 1VQ4S 3PRBA 3R7BB 4WZQA 3PTWA 3SCIE 1NPPA 4I69A 5GAHI 2ZHBA 3DOMA 4ZITA 3VAMA 4OJHA 2HNZB 4JI7J 1Q78A 1MNTA 3IRXA 1HNIB 4H4KC 4JI6F 4URQU 4FPIA 1NH8A 1PILA 1UWBA 4EWTA 1FRHA 2P8IA 3U7JA 1ICEB 3RAMA 3CD0A 4YHHF 2EK1A 2XZDB 5IFMA 4NCAA 3V6KA 2HBQB 3UCUP 1B7YB 4FYXB 2XO7A 1XNQF 4JP8A 1HQEA 5ETPA 2KHDA 4B3MF 4CQ1A 4RJVA 3VZHA 2NZ4A 3B82A 1WHWA 3AJ1A 4ES3A 4D8JA 3LWMA 1M1GA 1XK8A 4NYPA 5LJ5Y 1CJVA 1OMSA 1VQMS 1WNEA 4NCGA 4QR0A 1KONA 4BLGA 4RU9A 2XB2D 3RBXA 5A8KA 3IBWA 1B01A 3CDWA 4WPAA 1JLQA 2OFHX 4IFYB 6FD1A 3QIDA 3CCVS 4FF3A 3KDNA 3D1OA 3PYDA 1JLAA 5C7PA 3FT7A 2F9DA 2RBFA 1F2HA 2AP6A 3I0RA 4O4GB 3BH7B 2UP1A 1KNZA 2ZBCA 1GH8A 5K20B 5BJRA 3KLVA 3CVKA 2AGQA 4IUFA 1SC3B 4R8UB 3A8IA 4V1Ak 3TA0A 5HSPA 4FP9A 1HW9A 2D3ZA 2VFTA 5DLGA 3M8RA 4R8UA 3D1HA 4HHJA 1XMOJ 1JXEA 2FJEB 2R7QA 1L3VA 3K0JA 1JLFB 2F8HA 1KSPA 4O4GA 4LR7A 1VQ6S 1JQGA 1VDHA 4KGVB 1YITS 1W26A 1SUQA 1BD6A 2B7CB 2M0GB 2MSTA 2MKKA 3LAMA 1QSSA 1UEUA 5LSLA 2RHSB 5LOQA 1HQUA 3NRBA 3SQGA 2Q3PA 1SJ3P 4WTOB 3TX0A 4B9MA 2UXDF 4E98A 4Y2MA 1XMOF 4RNMA 1K1QA 5CYMA 2NXEA 2DNHA 3RUBL 1Z2ZA 1R0AA 1JJ4A 1KLMB 2CQPA 3DM2A 1RBAA 4ZVPB 2VJVA 3TQ1A 2A0FB 4IOCQ 3BN4A 3MZIA 4PG7A 3TVZA 4ETZA 3FMWA 2JNJA 2PGCA 4NLPA 2RD5C 1AUSL 3NNAA 5KG1A 2LQJA 2CA9A 3MMBA 4M5GA 4NMXA 1DTTB 2UVUA 1UW9A 2JLEA 3CCRS 2BQUA 1VISA 1N48A 1TU0B 3NXZA 4DS4A 1LW2B 1NK0A 2BOPA 1BXNA 2RVJA 3ISND 3SXLA 2X7IA 3MM7A 3PRVA 1G4CA 3N79A 1WSVA 4G65A 4USHA 3MFIA 2PSZA 1NKCA 2RF2A 3TWZA 4LRVA 5J2NB 1CJKA 1NHKL 5F41A 1RKJA 2GHVC 1M5PC 2L9NA 1LFWA 1NSAA 3Q8SB 3IG1B 1S1XA 3BQ1A 3PG9A 2YX1A 3I32A 2K7KA 5L9XA 3BGOP 3FZ2A 4ID5B 3QGIA 2W8KA 4MTPA 3NGKA 2ZNYA 4KSEB 3F56A 2JHEA 4N5SA 4J9RA 2VG5B 1R0CB 2RH3A 5G0RB 3PW7A 1RB0A 3MXHP 1KEKA 4F26A 4ILMA 2EBGA 4QW8A 1RQ0A 3CIZA 3GIJA 4U8VA 2FJXA 3CEDA 2I1RA 4HL9A 1Q8LA 2MKIA 4EZ9A 3PNIA 3CCQS 2DYAA 3CJ5A 5B09A 1XMQF 2MDAA 4KFBA 2W2OP 4F4YA 4KAIA 3ZZOA 3G96A 2VOOA 1NU4A 3UPFA 4NL5A 5DQHA 4ED1A 3WX4A 5GADU 1NJWA 1T9TA 1NCLA 1VC0A 2PEBA 4TYBA 2HGMA 3ZTOA 1LOUA 2RU9A 4RW9B 4EO8A 4XO0A 4CLWA 2BQ3A 1RAOA 2MZRA 2BEFA 2GNKA 4P75A 1SPBP 1KLNA 4IKAA 3SCLE 2HEKA 5DJBA 4CO4A 1YVFA 2WSCC 4DR5F 1U1PA 4DF8A 4P73A 1JLGB 1M5OC 2RE1A 5I42A 4FKXA 2GJIA 4ZJOA 3OVAA 2J7WA 5KFOA 2WB4A 4DLEA 2BJDA 4DV2F 2BYCA 4DXLA 4AQYF 4MAKA 3SFUA 5KFIA 4M5MA 2DO4A 2BJ1A 1TP7A 3KK2A 4BDPA 2JXGA 2HG4A 2WBRA 3AA9A 3BBCA 3C16B 5BYQA 3CO9A 4DDFA 4DX8H 4P2MA 3Q83A 4QIGA 4WWSA 3TJAA 5M2UA 4AXIA 4TQSA 2XS7A 2COLA 3DRSA 1LQ9A 4OI3A 5J2PB 2VFUA 1IWAA 1YSJA 3DLBA 4ZVOB 3AD7C 5B0GA 2FJAB 1FXRA 1Q53A 1HWUA 1ZBTA 4OI2A 3RBZA 1ZPVA 4DV2J 2XY6A 3HXMA 3V6HA 4JI6J 1AT1B 2NPIA 4DFJA 2G4BA 4LT6A 4F67A 1CULA 1LV5A 1FERA 1XEZA 2PI4A 1X4EA 1FHTA 3TEGA 3KLHB 3HPOA 2HBZB 4H4OA 5GADI 2QA1A 2ZUGA 3GV8B 5IWAJ 4A8MP 1NKEA 4KYZA 1N5VA 2R9LA 4FS2A 3TNVA 4AL6A 3EXCX 3W65A 1K73T 3AQOA 1K1SA 4BS2A 1WDTA 4P2FA 3M2UA 1RA7A 3CT9A 3BJYA 1X93A 2M3DA 2V0NA 2HYIB 4HHHA 4RNNA 1S5ZA 2QL5B 1PKUA 4Z7YA 1SL1A 5HVFA 2JC1A 1N88A 5ETVA 1E6YB 3JSRA 1H3DA 1U2CA 2HWHA 2WAQD 3QYYA 4CO3A 3Q8RB 1XC9A 3V6DB 3W2VA 3HVAA 1SH2A 3GJTB 4WE1A 2H5EA 2YKNA 4JYAJ 4DHVA 1QTNB 1ZAVA 1P27B 3Q8QB 4MFBA 5DLFA 3M30B 2OTLS 1O6XA 4EFAC 1EKSA 1GXUA 1S1TB 2R8JA 5D0RA 1XTZA 2CPHA 4NLXA 4WK3A 5FLXY 1VC6A 1D0EA 2J6UA 5AE2A 2UU9J 1HNWJ 2KFNA 5FJ4A 2RIJA 3PX6A 2VJUA 2IY5B 1VBZA 5F3TA 3QZ8A 3MPDA 4NXNF 4DL7A 2DGVA 4TKTA 5E3RA 3MM8A 1U1LA 1KVIA 1UPMB 3IO1A 3SBMA 1VQKS 1DURA 2JVOA 3GFXA 1U26A 4M5DB 3QFWA 4YR2A 4C98A 1OSDA 2UUAJ 2XYGB 1Y7PA 1T95A 4X4PA 5B0CA 3AODA 5CCLA 4U7UD 2NUUG 1S57A 4ERDA 4OX6A 3JTNA 4CO5A 4LREA 1WI8A 4Q7AA 2V94A 4O3OA 4JV5J 1S76D 1NBEB 4BBYA 1TL1B 3ENAA 1IKYA 3MPUB 1YLXA 3J80Y 2DJWA 4CLFA 4WKYA 3OPKA 1VC5A 3PDNA 2HQDA 2RDDA 4JV0A 2NZCA 3CW2C 2ALYB 4DG1B 4AQYJ 2HS0A 4YB1P 1VQ9S 3K8WA 3BF4A 3NOCA 4MIAA 1JNZB 1MWZA 1T02A 1T9XA 2L3MA 2A18A 3IR7B 1RT1B 2GQCA 1J5EJ 1FDNA 2IJRA 1TKXB 3MFHA 4IRDA 3IM9A 1SC4B 4WU3A 4LQ3A 3KG4A 1I94F 3M6UA 8AT1B 2B8PA 2NPFA 4GMKA 3PIPQ 4C8ZA 2NQPA 6AT1B 5E0OA 4F50A 2ZDPA 3A1YG 4N8OA 2IM1A 2F4VJ 4ELUA 3NCPA 1IBCB 1KP6A 2NS1B 4OV6A 3VV2B 4DCJB 3C6UB 3J81U 1TL7B 1NUEA 3K5PA 3U1NA 3QPIA 5DS7A 5KOWA 4AD6A 1X5PA 4UF4A 1HMVB 4EBDA 1IJFB 2V63A 2HSEB 2V8VA 2Y0BB 3HHLB 2AGOA 4K4XA 2H4WB 2DY9A 3H59A 3PEJA 4A48A 3O2IA 4C11A 5KAKA 1UZDA 3A13A 1R6YA 3ISZA 3LP2B 3V81B 2J6TA 3I56S 4ZIWA 4TLRA 3D0IE 2JEGA 3M32B 2JVRA 4USTA 3OL6A 2YVSA 2B8QA 2ROGA 1QAJA 1N5TA 3QT8A 2DNOA 3FSXA 4KHPJ 2XEXA 4DUTA 1SKSA 1MWYA 3NKYA 3W9HA 3K5MA 2QLFB 1BQMA 1BMQB 4DQRA 2FC9A 2QT7A 1FWPA 4J37A 3ZZUA 3KLEB 2E44A 2XLIA 2BM1A 3G9CA 3IAS9 4NLYA 3WQPA 5KFQA 1T0TV 3QGPA 4DR3F 3SZ2A 1FFGB 3ZTSA 1U09A 4WP8A 9ATCB 2CIMA 3RB6A 1RTHA 2CJ9A 1F3VA 2Y1RI 4JI2J 1U02A 1PYOB 1X31C 4DU7A 3BKTA 4J9KA 1C1CB 3OR2B 2I9SA 3AA8A 1OYEA 1BGXT 3VAFA 2FJWA 1FRLA 2E66A 3CMAS 3FEYB 3W5YA 3LPYA 1H74A 2WBMA 3LW5C 1U1NA 2ZWOA 4KGKA 3DRXA 1IBKF 2R8KA 3W2WB 4ED7A 5J2PA 2CNKB 1NDPA 2J76E 3TANA 2OPRB 5EUHA 3ENWA 3FC9A 3G82B 1RWNB 3PV8A 1YBTA 3IAM9 4RUAA 3R27A 2IYGA 1UFLA 3SDEB 4ZVHA 2FGOA 2JC0A 3QO9B 4Q2LA 5DRKA 1RISA 3D68A 4W98A 4CO1A 4OHYA 4USKA 5HL7Q 1HL6A 4DV5F 3R5CA 2HQIA 4A8QA 2DNYA 1HYSA 2FVRA 2KDOA 3T1YF 2XO6A 4GVBB 3QGHA 5B0BA 2HFNA 3VQSA 1YQHA 2IDLA 2NXUA 2BKPA 4NX9A 3KJVA 1JXVA 4ZK7M 4B9VA 1Q8KA 2ZJQQ 2HNYB 4ITSA 1JK9B 2XMKA 3QATA 1Z2LA 4S0MA 3JSYA 4H4MB 3SEOA 2V4QA 3QQCD 4NASA 1IBMF 4F0HA 1N33J 3RB0A 4PXEA 4X62J 2HHUA 3WIUA 3HT0A 1IKXB 2EFVA 4PQAA 2FLOA 1W7WA 2M7SA 2Z2LA 5T7LB 3OUYB 1F1BB 2HFVA 1OPIA
chains in the Genus database with same CATH topology
1MYKA 3QSIA 2NZCA 2BNZA 2WVBA 2K6LA 1IRQA 1U9PA 1PARA 2CPGA 4ME7E 2BNWA 2K1OA 3BKTA 2CA9A 2BJ8A 1Q5VA 2WVEA 2BSQE 2AY0A 1BDVA 1NLAA 1BAZA 2Y3YA 2K29A 2JXHA 2BJ3A 2BJ1A 2WVDA 3GXQA 2JXGA 1X93A 3LGHA 1EA4A 4D8JA 1BDTA 2JXIA 1P94A 1QTGA 2K9IA 2KELA 2CADA 2BJ9A 2K5JA 3QOQA 2PC6A 2GPEA 1MYLA 2HZVA 3VW4A 3PHTA 2WVFA 2H1OE 3BKUA 3H87C 1B01A 2CAXA 4FXEA 2BA3A 3OD2A 1B28A 2FGCA 2HZAA 2WVCA 3FT7A 4HV0A 2CAJA 1ARQA 1MNTA 2BJ7A 2RBFA 1Q5YA 3BKFA 2F1FA 3FMTA 3VEBA 1ARRA 3VEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYK A;  3QSI A;  2NZC A;  2BNZ A;  2WVB A;  2K6L A;  1IRQ A;  1U9P A;  1PAR A;  2CPG A;  4ME7 E;  2BNW A;  2K1O A;  3BKT A;  2CA9 A;  2BJ8 A;  1Q5V A;  2WVE A;  2BSQ E;  2AY0 A;  1BDV A;  1NLA A;  1BAZ A;  2Y3Y A;  2K29 A;  2JXH A;  2BJ3 A;  2BJ1 A;  2WVD A;  3GXQ A;  2JXG A;  1X93 A;  3LGH A;  1EA4 A;  4D8J A;  1BDT A;  2JXI A;  1P94 A;  1QTG A;  2K9I A;  2KEL A;  2CAD A;  2BJ9 A;  2K5J A;  3QOQ A;  2PC6 A;  2GPE A;  1MYL A;  2HZV A;  3VW4 A;  3PHT A;  2WVF A;  2H1O E;  3BKU A;  3H87 C;  1B01 A;  2CAX A;  4FXE A;  2BA3 A;  3OD2 A;  1B28 A;  2FGC A;  2HZA A;  2WVC A;  3FT7 A;  4HV0 A;  2CAJ A;  1ARQ A;  1MNT A;  2BJ7 A;  2RBF A;  1Q5Y A;  3BKF A;  2F1F A;  3FMT A;  3VEB A;  1ARR A;  3VEA A; 
#chains in the Genus database with same CATH topology
 2KOE A;  3MAA A;  3ZTQ A;  4HVZ A;  5D4O A;  1K0T A;  1UVN A;  4UQT A;  1YRU A;  2H65 B;  3BYR A;  2M9K A;  3Q8Y A;  4NLV A;  1C4C A;  2AW0 A;  4F0K A;  3GLJ A;  1IJE B;  1EQ0 A;  4IG3 B;  2EXU A;  4X65 F;  3NL0 A;  4OZL A;  3DC2 A;  3RZA A;  3DHW C;  5C24 B;  1WTF A;  2GA7 A;  4A8O A;  1AXQ A;  4EBC A;  5C25 B;  1HNV A;  2OD4 A;  3MMJ A;  2D3O 1;  3M8S A;  3LP1 A;  2KVI A;  3AD9 C;  1H72 C;  3ZO7 A;  4P10 A;  4JV5 F;  2GC8 A;  4OYA A;  3OTC A;  3R6G B;  2QA4 S;  1GT8 A;  3HJF A;  3LF0 A;  3MI7 X;  1LK7 A;  1CJK B;  1WG4 A;  3ELH A;  5KFZ A;  4E2F B;  1FES A;  1YIJ S;  4EZ6 A;  1HIY A;  1JKH A;  2CQ0 A;  2YQ0 A;  2WTF A;  1DRZ A;  1FDA A;  3CJ2 A;  1L3K A;  2GQ2 A;  1HKA A;  3R5J B;  1PO6 A;  4DSK A;  2XG8 A;  2VBZ A;  3AFG A;  3DOK A;  4DR4 F;  2F1F A;  2YKM A;  3EE3 A;  1DLO B;  3I5A A;  3DXS X;  1SB6 A;  1CSJ A;  2F9J A;  1AB8 A;  5KG7 A;  2Z30 B;  4ZOS A;  3BSA A;  4X84 A;  2WOM B;  1RXO B;  2UUB F;  4C3M A;  5KFP A;  3CJ4 A;  3S6E A;  2XMT A;  2BSQ E;  1FD8 A;  2QYC A;  1R8A A;  3GCX P;  3M2R A;  4ED3 A;  3RRG A;  1OIA A;  3LAK A;  1MN9 A;  1HBU B;  3HF5 A;  1KLM A;  3HVT B;  3Q8P B;  1TL7 A;  3RG6 A;  4F2R A;  3FKB A;  1UVJ A;  2C3U A;  3SYZ A;  1XNQ J;  1F0X A;  2PFD A;  3BBF A;  2A10 A;  2A2D A;  4J9Q A;  4JV2 A;  2J9D A;  4YHH J;  2H1O E;  2H1Y A;  1I1G A;  3AXM A;  3M8Q A;  4UW2 A;  1GXL A;  4K0K J;  1IKW B;  4KGZ B;  3G87 A;  3C46 A;  1URN A;  1MSW D;  1RTI A;  2ZOF A;  4EYI B;  1JLE B;  4ED5 A;  4KPC A;  2XSF A;  5I3P A;  1CPZ A;  1JLF A;  2VFV A;  1VRQ C;  3HFK A;  3QLH A;  2EKN A;  2GIF A;  3HT3 A;  3MEG A;  3QGG A;  4IG0 B;  4F36 A;  4MYT A;  1RJJ A;  2AF6 A;  1S6O A;  4X4S A;  3ZZT A;  3VAL A;  2R7S A;  4LR9 A;  4LVO P;  5J1P A;  1N56 A;  3FDS A;  2CWX A;  3KJF B;  3H2U B;  1U24 A;  2FZK B;  4NYZ A;  4ZVG A;  4U7U K;  4OLP A;  3CD7 A;  2F7V A;  4RW7 B;  3CJ3 A;  2B56 A;  3UD5 A;  3I31 A;  4A8X A;  3EDQ B;  3GV5 B;  3HM9 A;  4OYZ A;  2BUN A;  3TYT A;  4USV A;  3RBD A;  1HBM B;  4JI2 F;  2Q43 A;  2QV6 A;  1WOP A;  1BQX A;  4QPT A;  2VIH A;  3CB4 A;  4ANC A;  2PII A;  3ILJ A;  3IS9 B;  3VGU A;  1RT4 B;  1ARQ A;  1B70 B;  3FQK A;  3MM8 B;  2G1H A;  4RW8 A;  5ETR A;  6FDR A;  4CLU A;  3KMS A;  3KJV B;  4DQI A;  2MSS A;  1N5Y B;  2H4Y B;  4RX6 A;  3OL8 A;  2P6T A;  4ED4 A;  3RTV A;  4JI8 J;  1IRQ A;  1RGV A;  1L3T A;  2W2N P;  4N76 A;  2J6S A;  1A0O B;  3DU6 A;  3MAQ A;  1LWE A;  2CFX A;  2QLW A;  4ECZ A;  1RHK B;  1B0T A;  4NLU A;  1S1T A;  5J2Q A;  1JJC B;  5F8L A;  3OR1 B;  4DZD A;  5F8H A;  4DUY J;  1AA1 B;  2E5H A;  3AT1 B;  4J5O A;  1M5H A;  2YKA A;  3W2V B;  4LFA J;  3KLG B;  4ECQ A;  1KHV A;  2DXE A;  3V6D A;  1S97 A;  2UUC J;  3KNA A;  2KT2 A;  1H7W A;  5A0Y B;  3VZI A;  5DM6 Q;  4Q45 A;  4H4K A;  3RW6 A;  2FB0 A;  3PCO B;  1RK8 A;  1B7F A;  4M1K A;  5DGB A;  2VON A;  3DI6 A;  1VI7 A;  1RT7 A;  3DRY A;  3GJR B;  4DSI A;  2GZO A;  5D3G B;  2AD9 A;  4OMF G;  2MGZ B;  5HMW A;  1U4B A;  5FDL B;  1L3U A;  5KFY A;  5ITH A;  4NXM F;  4OQJ A;  1S9E A;  2B5J A;  4DQP A;  5FDL A;  1HFE L;  2IMW P;  1AYE A;  2IDE A;  4KR0 B;  2FD2 A;  2OJ3 A;  2YWK A;  3BGF A;  5B08 A;  2RRN A;  5G0R A;  1RI7 A;  3IRW P;  2QX0 A;  1ELO A;  4Q5V A;  3AOA A;  3N4W A;  3QT5 A;  5MAO A;  1GAO A;  2Y0S D;  1QDU B;  3PRD A;  7FDR A;  3OT9 A;  2PD1 A;  4DV6 F;  3TZY A;  2ZH6 A;  3CJK A;  2ZDO A;  3T6J A;  4KHM A;  4C0H A;  1RLD A;  3LP0 A;  2G1D A;  1R8C A;  2F3J A;  1VJW A;  2DGW A;  2DEJ A;  3TI0 A;  1JJ2 R;  2YQ1 A;  2UVV A;  3PW4 A;  2YNI A;  1SJ4 P;  1JLB B;  4DV4 J;  4B3S F;  2GHP A;  1NME B;  4TVA B;  5ETL A;  5BYS A;  2NRE A;  1N54 B;  1IQT A;  2DRA A;  2WSE C;  3DMJ A;  2OD6 A;  3KUE A;  3T1A A;  3UDV A;  3FEZ A;  3W66 A;  3CC7 S;  3C66 A;  3MEG B;  3D6H B;  3KJN B;  2QSW A;  4BWJ A;  1FNM A;  4B9T A;  2R7T A;  1RT4 A;  4DV3 J;  2KXF A;  4F4X A;  4DMZ A;  5CAB A;  4JI4 F;  4F4A A;  4WF9 Q;  4DSF A;  1UJ5 A;  5K8N A;  2MB0 B;  1EHW A;  2YPZ A;  1EQM A;  2YNF B;  3D4J A;  4DQS A;  2CVI A;  2C3P A;  1UVI A;  4F0M A;  2UUB J;  1X9S A;  4OZ0 A;  1YHQ S;  4DJB A;  1P9Q C;  2YNG B;  3D0H E;  2OIH A;  1X4H A;  2E1C A;  4G1P A;  2CPD A;  2HVE A;  2HWT A;  1RCX B;  4JI1 F;  3BO4 A;  1SQG A;  3CJQ A;  4GC7 A;  2ATL A;  3G4S S;  3R7S B;  1TK8 A;  3LPE A;  3CE8 A;  2UUW A;  1H0H B;  2FVC A;  2XBP A;  2XI2 A;  2K06 A;  4UUX A;  5K14 B;  3MR6 A;  3LOU A;  4FZV A;  1QJH A;  2JX2 A;  2EFP A;  2GV1 A;  3N5B A;  3A8J A;  1DLO A;  2GO8 A;  4M8L A;  3W7B A;  3DOK B;  4ICL B;  2PI5 A;  5HQ8 A;  4O3S A;  2CZ4 A;  2JSX A;  4JI1 J;  4K0K F;  2F65 A;  3Q89 A;  3BR9 A;  4CCH A;  3GYN A;  3L7O A;  3RB3 A;  4F4Z A;  3LGN A;  3MCO A;  1ZZF A;  3BKU A;  3I9V 9;  5F3Z A;  3PVX A;  1S0V A;  2IFX A;  1SJR A;  3NLC A;  1U1Q A;  4OX9 J;  2HPU A;  3NCQ A;  4Q2M A;  5LSO A;  3VVT A;  2HMI A;  2BKO A;  2ZEJ A;  1UEK A;  1VQO S;  2I0X A;  1RT5 A;  1QE1 B;  2EG1 A;  4NLO A;  1B64 A;  4R5P B;  4I0W A;  5C2C A;  4GO5 X;  3G86 A;  1OY6 A;  1Q8I A;  3DYA B;  3IXQ A;  2DHS A;  3CJT A;  3L7P A;  1TAQ A;  3VCD A;  5AXL A;  2BNZ A;  3PX0 A;  2GAH C;  4CLS A;  2BAB A;  4ED2 A;  1TVR B;  4K4S A;  2CDR B;  5JXS A;  4DV7 F;  1Q95 G;  1JLC B;  2VL1 A;  4R5P A;  4ED6 A;  2BJ3 A;  3DM2 B;  2K3I A;  3O3L A;  3DLE B;  2ATC B;  3DOM B;  1H98 A;  4FVC A;  5KFV A;  3G6Y A;  2LEB A;  2HMI B;  5F8N A;  2W7A A;  1P94 A;  5KFH A;  3GE9 A;  2EC2 A;  1Y10 A;  3HO1 A;  1X60 A;  2LDY A;  3F44 A;  5E5N A;  4OZ5 A;  4P6Q A;  3D67 A;  2AGP A;  1J5O A;  2D41 A;  2OEJ A;  5IT0 A;  1PBA A;  1WJ9 A;  2MQN A;  3MPW A;  4DV0 J;  1HQU B;  3GIK A;  3VGS A;  3DDN A;  2JJ4 D;  4ATN A;  2C2D A;  3MF5 A;  3P5B P;  5H9E J;  3H5X A;  2XMW A;  4ZCI A;  2WVC A;  3J7Y U;  2KI2 A;  3U1M A;  1V6H A;  3LO3 A;  3FSI A;  2R7W A;  4RW6 B;  3US5 A;  3PO4 A;  3PR4 A;  3G6V A;  3Q2T C;  4DR1 F;  3P45 B;  1NKB A;  2E5G A;  4UY8 5;  2P9E A;  3FEX B;  3B54 A;  3UR3 C;  4F3M A;  4EK2 A;  3CD5 A;  3KLH A;  3WHI A;  4XTT A;  2FC8 A;  3CNQ P;  1KQK A;  2IVY A;  1VRT B;  3NO7 A;  2YPY A;  1MU2 A;  2RKI B;  4XK8 C;  4YME A;  5L9N A;  1RAG B;  2APO A;  3JAM Y;  2P9G A;  2ZM6 F;  2FVS A;  3X1L B;  3H5U A;  4MKY A;  3CUN A;  1GMW A;  4C0O C;  2RRA A;  4PR6 A;  2GML A;  1IR2 A;  1GMV A;  3F0N A;  2CKW A;  3UN2 A;  2CJX B;  1P1L A;  2NXC A;  4ZKA A;  2KTQ A;  1KRP A;  1CG2 A;  1X4D A;  2QIF A;  3NNE A;  3QMQ A;  3QRP A;  5DG8 A;  1S4F A;  1UEV A;  2DHX A;  2ZKT A;  5D77 A;  4ENO A;  2IHR 1;  1RKI A;  1KVK A;  3MED B;  3DHX A;  3ZZY A;  5KT6 A;  4O0I A;  1RYR A;  1MYK A;  1CS4 B;  1S6Q A;  2WW8 A;  2HBY B;  2OTJ S;  1PC4 A;  1Q7L B;  1U9P A;  3MMA A;  4DCO B;  5U47 A;  2HRT A;  1EAY C;  2MZQ A;  4PZV A;  1V3Z A;  5A6W A;  4J9P A;  2GX8 A;  5GMD A;  2ZOG A;  3G71 S;  2FVQ A;  4I6A A;  2PT0 A;  5IV3 A;  3TA1 A;  3C15 A;  1UFK A;  1C0U A;  4P52 A;  3J81 Y;  2AYB A;  2OPR A;  1C1B A;  3FFI B;  3D6F B;  5KFD A;  1REG X;  2XY5 A;  2N3L A;  2ZHA A;  1IQZ A;  3FFI A;  5DDO C;  2VOD A;  1TV6 B;  1OPZ A;  2K7J A;  2WON A;  1FK9 A;  2LVW A;  2B9Y A;  3EXY A;  3I82 A;  3MCN A;  1EZZ B;  5KTQ A;  3CCJ S;  1O0P A;  3OR1 A;  4NLG A;  3QJP A;  4DR7 F;  5J2M A;  2DCU B;  4KFB B;  4QYZ K;  4EO6 A;  5E33 A;  2MZT A;  5IXU A;  2ZH4 A;  2V4R A;  5J1N A;  2W9A A;  4OJ1 A;  2MGZ A;  2OEM A;  4L3N A;  2D3U A;  2XI3 A;  1WEL A;  2VG7 A;  1O8B A;  4HTI A;  4USU A;  4F3Q A;  2DNM A;  1R89 A;  2DNL A;  2LEA A;  5HMX A;  3DI6 B;  3C14 B;  4PCQ A;  2R8H A;  4DR7 J;  2FIU A;  4WFZ A;  2D7S A;  2MJU A;  4DPO A;  2DPI A;  4E0D A;  4C8M A;  1TMJ A;  2V68 A;  3GIL A;  1VQY A;  4KRW A;  4CNY A;  1FJG F;  4DL3 A;  4QIV A;  5ETM A;  1T94 A;  1DFD A;  1RWM B;  4DQQ A;  3Q22 A;  2ZE2 A;  3PJX A;  3ZNU A;  3L7U A;  4HV0 A;  2XM3 A;  4LFA F;  2GO9 A;  1WG1 A;  3BSO A;  2L48 A;  2RIL A;  3OJS A;  4DR2 J;  1F9H A;  2HHS A;  2R42 A;  2OGU A;  1N32 J;  2V2Q A;  3HHK A;  2AYM A;  4DUZ F;  4BC9 A;  3RBE A;  1F3F A;  1LWC A;  3KK3 A;  2ZWP A;  2ASY A;  3IGN A;  3U1L A;  3NOG A;  3ISN C;  2BE9 B;  5CYJ A;  2MZJ A;  2GVZ A;  2ADC A;  2ZHO A;  4O3Q A;  4TLQ A;  2ZC4 A;  1NJX A;  3FJ2 A;  2VC0 A;  5J1E A;  1X0F A;  3ET6 B;  5E41 A;  2OKQ A;  4L73 A;  3RAX A;  4V19 J;  1U8W A;  2IJN A;  3EIC A;  3JXO A;  1J5O B;  2VG6 A;  4IYQ A;  3ET6 A;  3JSB A;  4K5R A;  4AT1 B;  2XHW A;  2KH9 A;  2DH8 A;  1LWF A;  3HSJ A;  4MKB A;  3Q2S C;  1RP5 A;  1CJT B;  2KFZ A;  2V8H A;  3EGW B;  3HP6 A;  3FK4 A;  4D3G A;  1SJQ A;  5MLC V;  2L9W A;  3M8W A;  2QZ8 A;  4IDK A;  3J81 j;  2MLZ A;  3KK3 B;  4LSZ B;  3PIO Q;  2C1E B;  4KTQ A;  1QLN A;  5IT9 Y;  2B9W A;  4AAI A;  2MHN A;  2KM8 B;  1KS2 A;  4KH0 B;  3JSM A;  1XJW B;  1C0T B;  1VLO A;  3EM1 A;  5E3A A;  2BA9 A;  1GQE A;  7AT1 B;  1WAC A;  1I6J A;  1K0V A;  2IM0 A;  1TL1 A;  3H2L A;  3WC0 A;  3F41 A;  3T1H J;  4UQG A;  1S6P A;  1M0S A;  1WF2 A;  3GV7 B;  4LF7 F;  2HVD A;  1RBO B;  1RWK B;  3BBB A;  4ZCK A;  2AT1 B;  1WEZ A;  3UW1 A;  4A4J A;  1YBU A;  5LL6 d;  1NH7 A;  4CM0 A;  5B0D A;  4I1T A;  2CWK A;  5L1I A;  2JOQ A;  1YDL A;  4YY3 J;  4DBQ A;  1ZA2 B;  1XR5 A;  1KFS A;  1NO8 A;  2EKY A;  4MH8 A;  4TNO A;  4OHV A;  1UA1 A;  2I8E A;  2E7X A;  3H20 A;  1WKJ A;  2IAJ A;  2XMU A;  2LXI A;  2FJD B;  1VQP S;  4DL0 C;  1ZYQ A;  3C6T B;  3G5O A;  2LMI A;  2V2V A;  2KJV A;  4LJM A;  1C0T A;  2HVZ A;  4E8U A;  4PG4 A;  3H4B A;  4DF4 A;  5KFX A;  1XIQ A;  1X5T A;  4PPZ A;  2EBE A;  2KKE A;  4FXW A;  1FXL A;  3GXQ A;  3CDB A;  5JJB A;  1OO0 B;  3UN5 A;  2CPF A;  1YKW A;  2O5D A;  4M5L A;  2YKN B;  3GB0 A;  4QOT A;  5D0E A;  3Q0A A;  4NA2 A;  1MRO B;  2WON B;  3D0G E;  4BHQ A;  2XCP A;  3RAQ A;  2IVM A;  3C2P A;  5D0G A;  2J0Q D;  5IV4 A;  4Q44 A;  3GP9 A;  2VG6 B;  3R5D A;  5KG3 A;  1QSY A;  4C48 A;  2VDH A;  4NML A;  3SIP B;  1R7I A;  2AX1 A;  4BWM A;  5LMN F;  4UUW A;  3I96 A;  4U7C A;  1C0U B;  1AFI A;  2XNQ A;  1X4B A;  2LCW A;  3GWC A;  1G2E A;  1B4S A;  3MCS A;  3RU0 A;  3UN3 A;  1NZ8 A;  2KRR A;  5KG5 A;  3B6B A;  2D9P A;  4ECU A;  1U1M A;  4PAB A;  4ZVF A;  2AJ0 A;  1OWX A;  4RBT A;  1FE4 A;  3MMA B;  4ZVU B;  2BKN A;  3D6M B;  4CI0 B;  4G1Q B;  1Q5V A;  1PAU B;  3DGP B;  1M1K T;  5T7L A;  3OUY A;  4WU2 A;  3PYE A;  5L8R C;  3MED A;  4Z37 A;  2HKE A;  2GMH A;  4K7Q A;  3LWL A;  1KD1 T;  2U2F A;  3NWR A;  3TAR A;  1BDT A;  1REV B;  3SDE A;  1ZH5 A;  2D3O R;  4LF9 F;  4XIU A;  1YJU A;  2RQK A;  1UKU A;  2X1A A;  4HKQ A;  2OI2 A;  3OFH A;  1TL3 B;  4X62 F;  1WG5 A;  3EMT A;  1XMQ J;  2A2C A;  5HQM A;  1V9O A;  2UZA A;  3AAW B;  3ITH B;  4FKY A;  2CJY B;  3OXL A;  4OZN A;  1NRK A;  1AW0 A;  4MMO A;  2C3Y A;  2MQ8 A;  3HHE A;  2Y1L B;  3KK2 B;  2BE2 A;  5D6G A;  1WWH A;  4C8O A;  1VRT A;  2IIH A;  3UD4 P;  4ZVE A;  4EI2 A;  3CMQ A;  3TZZ A;  4HYK A;  2OPS A;  2YH0 A;  5EWG A;  4XPE A;  4C97 A;  3GIR A;  4WYW A;  4USJ C;  2RUS A;  2HK2 A;  2KB2 A;  1CEZ A;  5J2M B;  2JEI A;  3TAM B;  4RW6 A;  2FYX A;  3I6P A;  1MWQ A;  4WK1 A;  1RE1 B;  1U0H A;  2VPZ B;  2DHA A;  2JXI A;  1PJ5 A;  2LKZ A;  4I4B A;  2JLF A;  3QOQ A;  2QO3 A;  1U8S A;  3MD1 A;  4NOH A;  1XER A;  4TY8 A;  4WP3 A;  5KFR A;  2N3O A;  1FNX H;  1GNK A;  1RBL A;  4CLP A;  3BO3 A;  3PO5 A;  1YGY A;  2AV5 A;  4UOC A;  1S1X B;  3TOQ A;  2MQQ A;  1H7X A;  1VIO A;  1F9E B;  5KFF A;  3VVU A;  2GVD B;  4X4O A;  2Z0G A;  3ZZR A;  2XMA A;  1TR0 A;  1KOO A;  1VLY A;  4UOF A;  4P74 A;  5HAN A;  3GFZ A;  5ETK A;  2CZV C;  3X3U A;  5F9L A;  1Y5L B;  1LW2 A;  4LFB J;  3BGL A;  2Q79 A;  3GIM A;  4M5H A;  4OHZ A;  1JLC A;  2B9E A;  3K17 A;  3LAL A;  1VK3 A;  1Q79 A;  3ENQ A;  3LP2 A;  2ADB A;  1NK9 A;  2VH7 A;  3CJR A;  3CUL A;  2LXF A;  1SQE A;  2LYV A;  3BYP A;  1OHN A;  4B9U A;  1NB2 A;  2MKS A;  3PX4 A;  3UDE A;  2CPY A;  5HLF A;  1VYA A;  3S7R A;  3J7A N;  1VQ5 S;  2VA2 A;  1YK9 A;  1W2I A;  2FY8 A;  2PO4 A;  3EVO A;  4QWB A;  2J0S D;  2LA4 A;  5CA5 A;  1HW8 A;  4RW4 B;  1DHM A;  5F0U A;  4UT4 A;  1HBM A;  2CPX A;  4MKV A;  1TMM A;  3JAM U;  4NXM J;  4B3O A;  1WSR A;  2KKH A;  3T41 A;  3OVS A;  4Z2X A;  1EX8 A;  3EVM A;  2DXD A;  1HA1 A;  4U96 A;  4ZP6 A;  1AFJ A;  1C4A A;  3PW0 A;  3M6V A;  4CLZ A;  3QIP A;  4CYU B;  4RUC A;  4AL7 A;  3VGT A;  4EU0 A;  3K5L A;  4B3M J;  2BJ7 A;  2FVP A;  1N52 B;  4O0N A;  4J9N A;  2O01 C;  1KKH A;  3FQL A;  2P6S A;  2R2T A;  3IR7 A;  4OFZ A;  1FFS B;  2G0C A;  4NYO A;  2FJB B;  3Q8U A;  1HR0 F;  1LFP A;  2E5J A;  1QAX A;  3QWP A;  3SCK E;  4QBU A;  2EW9 A;  2HK3 A;  3RRK A;  4A8K A;  3HHL D;  1K9M T;  3AHP A;  4NEY A;  1HMV A;  5DDQ C;  4DG1 A;  1RT3 B;  3BM7 A;  3QLH B;  1YJV A;  3UCZ P;  2VPW B;  5M2R A;  1R0A B;  3VAH A;  3OL9 A;  3CIM A;  1FF2 A;  1RTI B;  2H3A A;  1JLA B;  2CUY A;  4LF1 A;  5BR8 J;  1CQM A;  4K59 A;  4ZPV R;  1VBX A;  4TYA A;  3DFE A;  5IS2 A;  1HR0 J;  4I67 A;  3M8Q B;  1VHI A;  2YNF A;  2ADL A;  1EJ7 L;  4F2S A;  3L3C A;  1FRM A;  1TKT B;  3I55 S;  2NLW A;  1CJV B;  4LF4 J;  1ULR A;  4X4V A;  2OMO A;  2KZM A;  4JI4 J;  4PRF A;  4O3N A;  2LXU A;  3BPS P;  3O1L A;  2AEF A;  3UE2 A;  1V5I B;  1ZM2 A;  5C42 A;  4IH6 A;  1FJG J;  2GJ2 A;  4OV1 A;  3KHL A;  3UD3 P;  3TW0 A;  2KFY A;  1KTV A;  3DMJ B;  4CH0 S;  1AZS B;  3SSQ A;  3NEK A;  3NAI A;  2PMZ D;  4DPX A;  3VQT A;  4RNF A;  3VAI A;  4DL6 A;  2UXD J;  4X4N A;  2A2B A;  5HAO A;  5J2Q B;  3DYA A;  3IM8 A;  2UVW A;  2WVD A;  2HIY A;  4B3R F;  2YNI B;  3GII A;  5LMN J;  1KQG B;  2QL7 B;  2RS8 A;  1VQL S;  1F2G A;  1VS3 A;  1JKH B;  3ZC4 A;  1RYS A;  5IQ6 A;  1RAI B;  2VBW A;  4OJ3 A;  1TFW A;  4K5S A;  1XBW A;  1G6B A;  2H5J B;  2VF3 A;  3R5G A;  3T5H A;  4L72 B;  2R7U A;  1RAD B;  1SH3 A;  3MR7 A;  4CO2 A;  1DAR A;  1ZM3 A;  4ZPD A;  3TUZ C;  3JQJ A;  1S72 S;  3T3F A;  2DK2 A;  2O66 A;  4L74 A;  2C28 A;  1JB0 C;  3PY8 A;  1RAE B;  3NS7 B;  1S77 D;  2VG7 B;  2HND A;  2RB7 A;  3LGM A;  3UI3 A;  3NGR A;  2RS2 A;  1HNX F;  3OFF A;  3DXB A;  2UV8 G;  3V4I A;  1FJC A;  5B0E A;  4DCP B;  3BGU A;  3GR0 A;  4ZVT B;  4ZCM A;  4OYW A;  4KKO B;  2GCF A;  2J0X A;  4ZPA A;  3W9I A;  4MFB B;  1HNW F;  2F4F A;  2DNZ A;  2VQE F;  1WD6 A;  2DNN A;  5IM0 A;  2QFI A;  3AD8 C;  4ZPC A;  5GAH U;  2AWZ A;  1VR6 A;  1TV6 A;  4OHW A;  2AJ1 A;  1IM6 A;  4R25 A;  3DRP B;  1HAR A;  1XWL A;  2Y1J A;  4O4R A;  4CLL A;  1N36 J;  4R0E A;  2HGN A;  1TFY A;  4QW9 A;  3UR0 A;  3OD2 A;  2LU2 A;  5HMZ A;  4LF7 J;  3MOJ B;  2W9B A;  2HW3 A;  3EYZ A;  5KFL A;  2DVI A;  2HS4 A;  4ED8 A;  2DY1 A;  1HLW A;  2KHC A;  2OPQ A;  4TXS A;  3C16 A;  3CGI A;  3UNY A;  4C6A A;  5DGA A;  1WC4 A;  3BGR B;  3NBP A;  1J2V A;  2PDA A;  4H54 A;  4PEO A;  4Q0B B;  3W60 A;  3LQV A;  2XGQ A;  4CTA A;  2K6L A;  4I6W A;  1P8G A;  2J7K A;  1VIX A;  5THW A;  3N28 A;  3RW7 A;  2AYE A;  5HRO B;  2FY1 A;  1HYS B;  2K29 A;  2YX4 A;  3P4U B;  4KO0 B;  1U25 A;  1HD1 A;  5KFE A;  4V19 X;  1Q86 T;  4FVM A;  2BW7 A;  3IS9 A;  1Q7Y T;  1J5E F;  2DB1 A;  3KXD A;  2DRB A;  2YWW A;  2V6A A;  2R8G A;  1ZM9 A;  3CTR A;  3CJK B;  4FNH A;  2CAX A;  3D54 A;  2BX6 A;  4MIW A;  4Q8E A;  2RUG A;  2RHQ B;  2Z2Y B;  4AND A;  2CXE A;  1E6V A;  2XWX A;  4B3T J;  1SKR A;  2QG9 B;  1T7P A;  4NCB A;  2E9T A;  4LFC J;  1APS A;  3CC2 S;  3TUI C;  1SKU B;  1NZA A;  1BWE A;  1LNQ A;  3TAQ A;  2GPE A;  1R8B A;  2LQ8 A;  2QLJ B;  3PYF A;  1ZS6 A;  3DCA A;  4B02 A;  5K8O A;  2N82 B;  2XC9 A;  1U6Z A;  2W8L A;  1JXL A;  5CXT A;  3J7A 1;  4JUZ A;  1BHN A;  2W24 A;  1T9V A;  4FYV B;  1DTQ A;  1LEO A;  1RDR A;  2V34 A;  1DBD A;  2XWY A;  2Z58 B;  3MM6 B;  2VFR A;  2VHG A;  2HHH J;  1FTR A;  1JLG A;  3GFH A;  5AXM A;  1HNZ F;  3J7Z 5;  3EZU A;  5B7W A;  1TEL A;  2ZOM A;  4P2S A;  1NPR A;  3B4M A;  1S1U B;  1QTG A;  2OML A;  3EWG A;  5EDW A;  3BR8 A;  4OI0 A;  2K5J A;  2AJ2 A;  4D3H A;  2W7O A;  2MQO A;  2ZNZ A;  2JFK A;  2VA3 A;  4J9V A;  1BQM B;  3BS9 A;  4PKD B;  4OYB A;  2D74 B;  3W62 A;  5JUM A;  1B0V A;  2V8G A;  4DX7 A;  3THP A;  3V4M A;  3TUJ C;  2JEJ A;  1S12 A;  4PUO A;  4ELT A;  4ILL A;  4M5N A;  5IM0 B;  3BZQ A;  1RLC L;  2AYG A;  4KQZ A;  2G0J A;  4WBF A;  2AX0 A;  2B51 A;  4LIR A;  3NWG A;  4PWW A;  3R9L A;  1RCO B;  4DEZ A;  3OW2 R;  4IRC A;  4PWD A;  2BE7 D;  3MMB B;  3EGZ A;  3K5N A;  5HQL A;  3C6T A;  2VV5 A;  1W25 A;  3UDC A;  1FKP B;  3R8Y A;  2UXC J;  2RSQ A;  3QAE A;  1U1R A;  3OLA A;  5IT9 U;  2Y8W A;  3PAC A;  4PXB A;  4RW8 B;  2H51 B;  2BRL A;  1IR1 A;  1D9A A;  2IMO A;  3DLJ A;  3JTO A;  4HR2 A;  5DZ6 A;  4NWB A;  3ZZP A;  4QPX A;  1WUU A;  2BRK A;  1SQF A;  2YWH A;  3QRQ A;  1SCJ B;  3RR8 A;  2AU0 A;  1MW7 A;  4OIX A;  2PMH A;  4P7T A;  2W2M P;  4YN3 B;  1RSC A;  2DXF A;  2RQM A;  2MQM A;  2RF2 B;  1UJ6 A;  2VIC A;  4LBH A;  3H2V E;  4ECT A;  1PG5 B;  4QR2 A;  3R1L A;  2VBY A;  2M8D B;  4U9R A;  2NYH A;  4OZ3 A;  3CME S;  2CQ2 A;  5ETQ A;  3RJM B;  4ECV A;  1RT1 A;  2BBE A;  2AHO B;  3MM6 A;  1F9F A;  1GTH A;  1HI8 A;  1MG7 A;  1N0V C;  1RHQ B;  2HHP A;  5LXY A;  4ED0 A;  2BW2 A;  3WDO A;  1WHV A;  2BNW A;  4Y3C A;  4JI5 F;  1MLA A;  1G1X A;  1EKR A;  3HCX A;  3ZTP A;  5A8W A;  1BAZ A;  5KG4 A;  5L1L A;  5EX3 A;  3BV8 A;  5FD1 A;  3SV3 A;  1FTC A;  2M52 A;  2O1P A;  3AOC A;  4OYP A;  2B4O A;  2Y1I A;  3I5B A;  4K4T A;  1CJT A;  3AOB A;  5CYM B;  8ATC B;  4C7Q A;  3QFH A;  2L41 A;  1TKT A;  4NZ0 A;  3PHT A;  1IKW A;  2MTL A;  1YJT A;  2E1M C;  2ZZN A;  1ZPW X;  3HKZ D;  4QCL A;  3S01 A;  1WI6 A;  2WRM A;  2R4F A;  4U95 A;  4H4M A;  4NE9 C;  4NLR A;  2N4C A;  5ETS A;  2DHG A;  2CYY A;  3HHD A;  2XUL A;  4C0B A;  1R3N A;  3Q23 A;  3NS6 A;  1SL2 A;  1HNX J;  4FBU A;  4O3R A;  2XNR A;  1UJ4 A;  2HHT A;  4LF8 J;  3RRH A;  2EEY A;  3QWU A;  2X1F A;  3TO8 A;  4EGL A;  4DI6 A;  4K50 A;  4LRA A;  2X51 A;  3P96 A;  2AQ4 A;  2QN6 B;  1IM4 A;  1ACM B;  1Y3J A;  5SUH A;  3CD6 S;  4K4V A;  3MWB A;  1T9Y A;  4CTA B;  2UXB F;  1UP1 A;  4OYM A;  4Z7C A;  4HDH A;  2KXH A;  1FO1 A;  3CCU S;  1NND A;  1S7I A;  1U0S A;  3NGS A;  4OI4 A;  1Y11 A;  1DY3 A;  2V5H G;  4USI A;  2DGO A;  2IC3 A;  2A6O A;  2GIQ A;  2VBX A;  3DLK B;  1ITP A;  3MUT P;  1OYD A;  1FRK A;  2RDI A;  1W2B R;  3IR6 B;  3MHY A;  3T9N A;  4WE1 B;  4EMD A;  5L46 A;  3G82 A;  2OHD A;  3B78 A;  5HAT A;  2ZD1 B;  3CDA A;  3BSN A;  3R5A A;  4X65 J;  3FBE A;  4CIO A;  5EN1 A;  1WF1 A;  4LRD A;  4Y34 A;  1HBN A;  2DIV A;  4NCG B;  4W92 B;  4RUB A;  4YEA A;  4XPC A;  3DKD A;  4TU8 A;  3NMR A;  1B28 A;  3FCV A;  4DR1 J;  4OI6 A;  1T11 A;  2YY3 A;  2DR8 A;  3GSI A;  3FRZ A;  1RWU A;  5C24 A;  3BB5 A;  2ZIT A;  4HT7 A;  4KHR A;  3A8E A;  4CWB A;  1S49 A;  3DOL A;  1SIZ A;  2BDP A;  1QD1 A;  3LUY A;  4N7T A;  3MM9 A;  4AL5 A;  4KH1 B;  4WYL A;  5LXR A;  1S1W B;  1DQ9 A;  2XYH B;  3IRX B;  3G2X A;  2EI5 A;  4IRK A;  5D3G A;  4HH0 A;  3H90 A;  4PAA A;  4DZ6 A;  3NMA A;  2J5A A;  3VF0 B;  4DOZ A;  3C8Y A;  2V2K A;  2WW4 A;  3S1T A;  5A76 A;  1V3R A;  5M2P A;  2QA4 G;  2R7O A;  2QMU B;  4I2Q A;  4DPY A;  4MT1 A;  4MK8 A;  1RHU B;  5A0Y A;  1P6T A;  2PEH A;  3QT6 A;  4DL4 A;  1D9D A;  3BPD A;  1ZZN A;  2ZH1 A;  3C15 B;  3IBC B;  3KOA A;  2HAI A;  2ROE A;  2YNH B;  3DNC A;  2HHH F;  2ZH8 A;  4AFF A;  3H42 A;  5A2Q Y;  2KXN B;  4HT5 A;  2DRD A;  1JMT A;  1SC6 A;  2GJF A;  3CCZ A;  2R7R A;  4L75 A;  2G2Z A;  5CHC B;  1LWE B;  5KFA A;  1IBK J;  4GVB A;  1XNR J;  3NNH A;  3TP2 A;  2I5J A;  4ALZ A;  2V50 A;  4PQU B;  1BDV A;  1S6Q B;  3T5K A;  2IBK A;  2HVI A;  2B6A A;  3OHB A;  1T03 B;  5LT5 A;  4DV3 F;  3GG1 A;  1L5U A;  1GMU A;  3NGT A;  3PKM A;  1WC3 A;  3QZ7 A;  1DZ5 A;  4LQ9 A;  4OZJ A;  2CNO B;  3EJM A;  5HBM A;  4K4W A;  1HWI A;  2R7V A;  3G8T A;  4URG A;  2KYZ A;  4FNI A;  1ROF A;  4DN9 A;  1FRI A;  4L6V 3;  1T05 B;  3QJL A;  2DCL A;  4GKK F;  5H9F J;  1S9F A;  5L1K A;  4ZMM A;  3TZW A;  2CAJ A;  1IN0 A;  1MU2 B;  2RKI A;  1MML A;  1RT3 A;  1UVK A;  1FVQ A;  1S99 A;  3M2V B;  4HAC A;  5D0H A;  4EUV A;  3E01 A;  2R2S A;  3ICL A;  1AUD A;  1K47 A;  3OFE A;  4M5J A;  4Y2C A;  9RUB A;  4DR6 F;  4KHP F;  2HRU A;  4AUK A;  3GFY A;  2XGP A;  3K7R A;  3GPA A;  4DPT A;  3M1V A;  3IP0 A;  1QM9 A;  1RTH B;  2OP5 A;  1IBL J;  3D66 A;  2C2Z B;  4GKK J;  1WOO A;  4F04 B;  3QIP B;  3H7H B;  4NLQ A;  4CYU A;  3EZ5 A;  3CCE S;  1YI2 S;  1UL3 A;  2FLL A;  1WDD A;  2MLY A;  2VG5 A;  2YQ3 A;  1CC7 A;  3CJ0 A;  4YY3 F;  3KMQ A;  4GC6 A;  4ZN1 A;  3D28 A;  2BAN A;  3W8P A;  3OXG A;  4RUH A;  2VOP A;  1YZ7 A;  1QUP A;  2AIR B;  1SXL A;  2IRX A;  2JWN A;  1ZAW A;  3HLU A;  4ZJQ A;  4P2X A;  4CLT A;  5SZT A;  4N77 A;  4USM A;  2JRS A;  2WK4 A;  5E2Q A;  3MM7 B;  2D9O A;  1EAR A;  1KC8 T;  4O44 A;  5LM7 E;  1HBU A;  4DSJ A;  4RR5 A;  1X5S A;  4LSN B;  3I5C A;  3JB9 k;  1S9G B;  2DEI A;  1PAR A;  4QZV B;  3A3P B;  3LAN A;  3P3D A;  3PFE A;  2DGQ A;  3MCM A;  3RYL A;  3D1Q A;  5L39 A;  5CQG A;  3KHG A;  1ZA1 B;  2YX7 A;  1UVM A;  2IAJ B;  2C2E A;  4OL8 A;  3M30 A;  3MUM P;  1U6F A;  2MJN A;  2CPE A;  1QE1 A;  2XZW A;  4LFB F;  3WX8 A;  1H2V Z;  3BQ2 A;  4X4U A;  3C6U A;  4WFA Q;  3CCL S;  1F5A A;  3K5O A;  3PJ9 A;  2WCX A;  1YTY A;  2E1R A;  5IWA F;  1WOS A;  2E7W A;  1FKO A;  2GMJ A;  2AMC B;  2OLW A;  1B99 A;  2L08 A;  1EP4 A;  2QMW A;  3NP5 A;  4M5I A;  3PW2 A;  3ULH A;  4NRT A;  1SH0 A;  1HNV B;  5C25 A;  1Q16 B;  4IOB A;  4WII A;  1T8E A;  1Q5Y A;  2FQQ B;  3IN5 A;  1FJE B;  1YRX A;  1PYS B;  4X64 F;  1KFD A;  3CCM S;  1N6Q B;  2CG8 A;  1O5J A;  2IPO B;  2SXL A;  3KWM A;  4UZC A;  4Q8F A;  4ZP7 A;  2IM3 A;  1BWV A;  5H9E K;  5LSR A;  4OHX A;  5F8G A;  1VK8 A;  1Q1K A;  1YJR A;  4DPU A;  1IBM J;  2ZZM A;  3K59 A;  3E2E A;  3OQ2 A;  2LDI A;  2PN6 A;  4KPY A;  4ECS A;  3KYL A;  3FBF A;  4WFX A;  5JMN A;  2BR0 A;  3KLI B;  2N4D A;  1M5K C;  2G2O A;  2KEL A;  2D1C A;  1FA0 A;  1S1V A;  3AJ2 A;  2PC6 A;  3UO0 A;  2ZH3 A;  1VQN S;  4NZ6 A;  3VW4 A;  2ZVS A;  4QWC A;  4F02 A;  5KT3 A;  3W9J A;  2KZZ A;  5A8K B;  5H1S V;  3NNC A;  1KDN A;  4NLS A;  2J9C A;  3CJ8 A;  4QJV A;  4ZVR B;  3MR2 A;  4PG8 A;  1FJ7 A;  2L9D A;  1IR0 A;  2O67 A;  3R1H A;  5KFG A;  1KQS R;  2MYF A;  2FGC A;  3M9M B;  4N41 A;  4RU2 A;  2QTW A;  2Z56 B;  3GYG A;  4J9U E;  4M5D A;  3TX8 A;  3HFZ B;  4ILR A;  2M2B A;  4WIQ A;  4CLY A;  2DNK A;  3HZG A;  5FLX U;  3AB4 B;  3FVY A;  4ZJL A;  1HQE B;  1Y0H A;  3AXK A;  3KJQ B;  2ZUA A;  3FGV A;  3L9Z A;  5C5J A;  2MQP A;  1BLU A;  2CPG A;  1FEE A;  2Q2K A;  2MKC A;  2QSF A;  2NCK L;  2RML A;  2KG1 A;  2ZH2 A;  4IH5 A;  3TEH B;  3QRR A;  1VCT A;  3TQE A;  3KK1 A;  2MKJ A;  4DPW A;  4A8Y A;  1FNO A;  1R8P A;  5IC6 B;  2W9B B;  3OTO J;  5H9F K;  1VQS A;  3NY0 A;  3V2U C;  3ETM A;  3FNN A;  2IM2 A;  5GMK a;  2ZE2 B;  4AE5 A;  1SI9 A;  4RBV A;  4EEY A;  1NJY A;  2E5L F;  3KG0 A;  3TA2 A;  3TUP A;  3SI8 A;  1XMB A;  2Q6C A;  4J9M A;  2HUR A;  4IOA Q;  2XQC A;  3THV A;  1N4L A;  3HK2 A;  1S4E A;  2CNL B;  2I38 A;  4DX5 A;  1NDC A;  3RGI A;  2RDJ A;  1M5V C;  4OLO A;  3POT B;  5A8R B;  3CO0 P;  2QLB B;  3AH6 A;  1HQ2 A;  1HWK A;  2K1R B;  4QYR A;  3HZE A;  2PMW A;  3OTO F;  5HP1 B;  4XAK A;  4NZ7 A;  4K4Y A;  1NHU A;  1S1W A;  5HK4 A;  4OI1 A;  3SV4 A;  1GK8 A;  2F8M A;  2Z4P A;  3SSR A;  2ZH9 A;  3N6L A;  3LH2 S;  3K8V A;  1SJF A;  1RTD A;  4R0J A;  1CLF A;  1QUV A;  1BY9 A;  4CH7 A;  2PE8 A;  3BSC A;  2JDJ A;  2M88 A;  2AZ1 A;  3HDS A;  4LF8 F;  5KFU A;  3J7Y I;  3N9U C;  2PA3 A;  2ZC3 A;  2MZ1 A;  1Q16 A;  2R2U A;  5GME A;  3VAG A;  1CUL B;  2RQ4 A;  3FCW A;  5KFM A;  4NA1 A;  3HKW A;  4KJI A;  1HBO A;  1RAC B;  2RNE A;  2EVZ A;  1Q8B A;  4OYX A;  2NXN A;  2HHW A;  2VB6 A;  4NXN J;  3IG1 A;  2FJV A;  1BQN A;  2OUG A;  4QU6 A;  4NA3 A;  1IKV B;  2K2P A;  2OPP B;  4DV1 F;  3DRS B;  2XS5 A;  4FXD A;  3TZX A;  5JVG Q;  1VRU A;  2DR6 A;  2DR5 A;  4DR6 J;  4FYY B;  1X5O A;  3EPG A;  2KVQ E;  1Y4Z B;  2OSQ A;  4NI2 A;  1VJQ A;  3VHQ A;  5CD4 H;  3VEA A;  1AZS A;  1XQI A;  5HVH A;  4ECR A;  4ZLP A;  1OS5 A;  4I2P A;  3VTI A;  3BDP A;  1QSL A;  1V5V A;  4IO1 A;  2MEW A;  4QQB A;  4JV1 A;  1QY7 A;  4IDK B;  3O8W A;  2Y3Y A;  1T3O A;  1UFW A;  2QLX A;  4JI0 J;  2Q1L A;  1N5Y A;  4B9N A;  3M9O B;  2FHK A;  2HQ3 A;  2OEL A;  2PA8 D;  4U6P A;  3D2W A;  4W90 B;  2AEM A;  5KT7 A;  3VWS A;  2HQG A;  3G6E S;  1S59 A;  2YKQ A;  3T1H F;  1NK5 A;  3JQM A;  1F6T A;  1EB0 A;  3R5B A;  1NDL A;  2DNQ A;  2HZC A;  2C2R A;  2EC0 A;  5DZ7 A;  3MDF A;  1FVS A;  1X4A A;  5HN0 A;  3PKY A;  1S1V B;  3SQG B;  2FHJ D;  3MMC B;  4U8Y A;  3WIV A;  1HWJ A;  4ES2 A;  3W5Z A;  2B4P A;  4WFY A;  5I3Q A;  1NJI T;  2MY8 A;  1LWC B;  4GKJ F;  3P6Y C;  2BJE A;  3HSD A;  1N8R T;  3OV7 A;  5A8W B;  5ETO A;  2AJQ A;  2VU5 A;  3TRG A;  1N34 J;  1FD2 A;  1BC6 A;  2ZVI A;  3CC4 S;  3UDL A;  1GX6 A;  3ETO A;  2ERR A;  1KTQ A;  2HQC A;  3E01 B;  2DR9 A;  4DWI A;  2CQC A;  2F63 A;  2Q6B A;  3KUH A;  4FXV A;  5L38 A;  1TL4 A;  5A2Q U;  4TU9 A;  3QT7 A;  3KLF B;  2ASL A;  2ILZ A;  2K3K A;  1FWK A;  3FUY A;  1EET A;  1Y5I B;  3D7S B;  5KG2 A;  4YFU A;  1JWW A;  2V4J B;  3OBI A;  4LUB A;  3W5X A;  5CCM A;  3IWN C;  4UOH A;  5KG0 A;  3N6N A;  1UA0 A;  1FKO B;  4QWE A;  4PG6 A;  1NPK A;  3NGU A;  4B08 A;  1HHT P;  3CDE A;  3M6X A;  2W4C A;  4FF4 A;  5KFT A;  3H98 A;  3L95 X;  1PAE X;  1OY8 A;  2IA0 A;  4X64 J;  2C2M B;  3A8K A;  2RJZ A;  2XMM A;  3D3B J;  1XN9 A;  3LJP A;  4CH1 A;  1RT2 B;  2B9X A;  2YKP A;  4UTG A;  2KL8 A;  3H25 A;  3R3T A;  2YH1 A;  1U2F A;  2YXL A;  1UTA A;  1YZ6 A;  1F5B A;  1TKZ B;  1DTT A;  2VFS A;  3GR1 A;  4AYB D;  5DET A;  2KM8 C;  4DV6 J;  2C42 A;  3OSP A;  2WOM A;  3B4D A;  2V67 A;  4CO0 A;  2WVE A;  2CJA A;  3OL7 A;  3PFO A;  2YNH A;  4J90 A;  3SQO P;  1HHQ A;  1RAJ A;  4JBC A;  4ZPT R;  3W63 A;  3G8S A;  4IR9 A;  1HNI A;  4L3K A;  1OQ3 A;  1CQN A;  4LRB A;  2AJF E;  2RAQ A;  3I4H X;  4Y2A A;  5G4D A;  5HJX A;  1Z1Z A;  2LQ5 A;  1LW0 A;  2EWH A;  1N36 F;  3KTQ A;  2BAN B;  1D8Y A;  2AEJ A;  4I2Q B;  1C1B B;  5ADZ A;  3K58 A;  5HVG A;  1UPP A;  2GAG C;  4K4Z A;  1RAH B;  2FHM A;  2GQQ A;  3DLG A;  4MJK A;  3O44 A;  2XCA A;  5GAE U;  2U1A A;  1MMD A;  1IVZ A;  3OXF A;  4IQM A;  2YKO A;  5CYQ A;  2ZH5 A;  3TJ8 A;  3VEB A;  2A3J A;  1SJ1 A;  2RRB A;  3OTE A;  1DTQ B;  2E29 A;  3JS9 A;  3KNG A;  2OPS B;  3K89 A;  4IG3 A;  2B43 A;  2ALZ A;  1Z4U A;  4TY9 A;  3UVJ A;  2BJ8 A;  1VFJ A;  1WKK A;  2DT9 A;  5K14 A;  5HO4 A;  4XDD A;  1KVJ A;  4PPD A;  2KJW A;  2BE2 B;  1HI1 A;  2UUA F;  1N32 F;  4RBU A;  5KT2 A;  1A9N B;  3I0R B;  2QGF B;  3DN9 A;  4PG5 A;  4DR2 F;  1E6V B;  4ZPB A;  1YJ9 S;  2VD3 A;  4DR4 J;  1R27 B;  1TUV A;  1IKX A;  1WC6 A;  1J27 A;  1PSD A;  2VDI A;  2YWE A;  4UZB A;  1RT6 B;  1RWO B;  3GSD A;  3HSG A;  3M4X A;  1CJU B;  4PYA A;  4TU7 A;  5A6P A;  4J9L A;  1JX4 A;  1NAQ A;  2DIU A;  3GJQ B;  2H48 B;  3H87 C;  3ADA C;  3QNW B;  1RAB B;  3QBC A;  3TJ9 A;  2H5I B;  3OLB A;  1H6K X;  1SC1 B;  2E1A A;  2XHC A;  4LF2 A;  5DG7 A;  4G1I A;  2BOA A;  5IT4 A;  3C3L A;  1DAX A;  2J8A A;  3P8B B;  2DHH A;  4P71 A;  3ONQ A;  4KY3 A;  5KFS A;  4C3L A;  5HJY A;  1PIE A;  2CQ4 A;  2J9D E;  5DM7 Q;  2B4V A;  1H2T Z;  4L76 A;  2F8E X;  2IRY A;  2JBV A;  2C2N A;  4OX9 F;  1ZTW A;  4JB8 B;  2XSJ A;  4Q43 A;  4ETX A;  4KGX B;  1X0P A;  3CF5 Q;  5L1J A;  1I94 J;  3CCW A;  4ZS6 A;  2V9K A;  1WOR A;  3GZ7 A;  3QO9 A;  1S6U A;  5FII A;  3RR7 A;  1FDB A;  1OY9 A;  2HNZ A;  3D6T B;  3DDI A;  3FMB A;  2VPY B;  2GIR A;  2LQ9 A;  3PXG a;  1NB7 A;  4N8N A;  1DJ0 A;  3V5R A;  2B7B B;  2E7V A;  3GQC A;  1MMN A;  2CQI A;  4A8W A;  4GO7 X;  2DGS A;  3IBF B;  3N0V A;  4RLE A;  4AXJ A;  5AXK A;  3UWT A;  1LK5 A;  4QIE A;  3CDU A;  3W2W A;  1LW0 B;  2GFF A;  2QRR A;  3A12 A;  3AQP A;  1FEH A;  3KLI A;  1Q4R A;  3DRR B;  4RW9 A;  3SCJ E;  3PEH A;  1V3S A;  2C2O B;  2MMY A;  2KYX A;  2RT3 A;  1RAF B;  4YR0 A;  1SKW A;  1XR6 A;  2H9Z A;  1MNE A;  5KFK A;  1UWA A;  1ZOT A;  4WJB A;  1LXJ A;  2EK6 A;  2W9C A;  2JH3 A;  4J9S A;  4DSL A;  2YWG A;  5KOX A;  3L4B C;  3FSY A;  3DOL B;  1Y5N B;  4CRJ A;  1IXK A;  3HHL C;  2HND B;  4OZ2 A;  1S9E B;  4DV0 F;  3MM5 B;  4F25 A;  2EFG A;  3OVB A;  3DU5 A;  4I64 A;  1N5S A;  1X4F A;  4M63 A;  4A46 A;  1GMW D;  3AJD A;  4QR1 A;  1R31 A;  1FXD A;  1VMB A;  3MUR P;  4GKJ J;  4G3I A;  1FX2 A;  1MYL A;  4JI8 F;  2HHX A;  2HLU A;  2ACM A;  4ID5 A;  2ZD1 A;  3Q86 A;  5BR8 F;  2R2R A;  2XLK A;  4JI3 F;  1HHS A;  1WKL A;  3FRY A;  3FZB A;  2EFQ A;  1UW4 A;  3GG0 A;  2H3E B;  5DDP C;  5CZV A;  1S0M A;  1ZAX A;  1B0P A;  3R97 A;  5J2N A;  1N34 F;  2P9C A;  1D9F A;  4ZHR B;  4N47 A;  3EUN A;  4ZCL A;  2K8G A;  4YQW A;  2W25 A;  2CPI A;  1ARR A;  4JI7 F;  2QA2 A;  3MR3 A;  1FT8 A;  1H2U X;  4ZLN A;  4DN0 A;  1S0O A;  1TKZ A;  1H38 A;  2OFG X;  2B3T B;  2MZS A;  4YP3 A;  4C11 B;  4OJG A;  1TK0 A;  3EGV A;  4LF6 J;  2R7X A;  2AY0 A;  3ZFV A;  5EWF A;  1FRJ A;  1SVD A;  2BVZ A;  4USW A;  1RT2 A;  2V8P A;  2G9O A;  2KT5 A;  2LU1 A;  4X2B A;  1RTJ B;  2CZ9 A;  4F4K A;  1EA4 A;  1M1H A;  4DLG A;  1LKZ A;  2YNG A;  3E51 A;  4EBE A;  3H5Y A;  2Z8Q A;  4ZVQ B;  4C8N A;  2CAD A;  4B3R J;  3MMC A;  2AKW B;  4WTY A;  4FF2 A;  2WVF A;  3H0P A;  4QYZ J;  4LSL A;  2ZH7 A;  4KT0 C;  3T6B A;  5IC4 B;  1XNR F;  1B3T A;  2MKY A;  2X1B A;  1EET B;  2VUG A;  3WZ0 A;  3OTD A;  4FBT A;  4LF9 J;  3T5J A;  3IWL A;  3EVW A;  1TKX A;  3MEE B;  3C19 A;  1RTJ A;  3M1V B;  3KLF A;  4LRC A;  2UXB J;  2FHO B;  2MY7 A;  3EGN A;  1U47 A;  4IFV A;  4URS A;  1U48 A;  2DPJ A;  3VGV A;  2UXC F;  4TQR A;  3HFV A;  2CQ3 A;  4HH1 A;  4DV1 J;  4DV7 J;  4IFV B;  1DQA A;  3CSK A;  3MEE A;  3D5M A;  4NLT A;  4HTJ A;  2EFO A;  1WC1 A;  1KWM A;  2LFV A;  3DDK A;  4OX8 A;  5HMY A;  4HHU A;  1JLE A;  1SL0 A;  2YTC A;  4FYD A;  3OFG A;  1WEX A;  4DR3 J;  2C22 A;  5KFW A;  3KHR A;  1PGZ A;  2X1G A;  1N33 F;  2VQE J;  1R6V A;  1DQ8 A;  1YG0 A;  3QJJ A;  1QAI A;  3HI9 A;  1JLQ B;  3S8S A;  2KO1 A;  4C2M A;  1IKV A;  2OPP A;  1IBL F;  4B3O B;  2XYP B;  5CAA A;  1BE4 A;  2KN4 A;  3LA0 A;  2BA3 A;  1VHF A;  2CNN B;  4ECW A;  2YBV A;  1YJN S;  1HBO B;  3FBB A;  1T03 A;  3DLL Q;  4KE5 A;  4I7F A;  3O6Q A;  3W3S A;  5KT5 A;  3BKF A;  2M70 A;  1UMJ A;  1FKP A;  4JI5 J;  5HRO A;  1CC8 A;  4B9L A;  3BN7 A;  2WVB A;  4QIF A;  4ID8 A;  4KIA A;  4TN2 A;  2DIT A;  1TAU A;  4PWD B;  3N01 A;  4KC5 A;  2V2Z A;  2ZBP A;  4IR1 A;  2VC1 A;  2B0G A;  3NBP B;  2W9C B;  4NI2 B;  2W7P A;  2HWI A;  1UWB B;  2OPQ B;  3HD1 A;  1PCA A;  2QMX A;  2YKM B;  1FWL A;  2W01 A;  3AY0 A;  3QSY B;  1TQL A;  2K1R A;  1TL5 A;  1U7L A;  2GVD A;  2J7U A;  3HVR A;  4Y6I A;  3DRR A;  3BO2 A;  2BJ9 A;  3IA0 A;  2HHV A;  4JI3 J;  2BZ2 A;  2C3O A;  1VQ8 S;  1M90 T;  3HMJ G;  3J80 U;  3AB2 B;  2HAF A;  1M5S A;  2XS2 A;  1RWX B;  2CQB A;  2ZKU A;  1OJ4 A;  2N7C A;  4CZC A;  3F73 A;  2ZBQ A;  3M8P B;  2ASD A;  1E6Y A;  2ROP A;  1X4C A;  2XLJ A;  1U0H B;  3JYT B;  1NEE A;  2CDQ A;  3IR5 B;  4OYI A;  4YB7 A;  5F8I A;  1X9W A;  4YOE A;  2BMB A;  2P5V A;  1R43 A;  1OSC A;  5D15 A;  2OSR A;  3M2U B;  1TKD A;  4J9O A;  4LRF A;  4Y00 A;  2AZ3 A;  2W4P A;  3DLH A;  8RUC A;  4NEZ A;  4WP9 A;  1T3N A;  2J0W A;  2FZG B;  1CS4 A;  2M5Y A;  4RO0 A;  4DSE A;  5B0F A;  1UZH A;  1KOH A;  4HLB A;  2V9W A;  4A8F A;  1SV5 A;  1NK7 A;  3NG8 A;  4FYW B;  1NM2 A;  3POT A;  5A8R A;  4M95 A;  3JYT A;  1WC0 A;  2G0I A;  2ILY A;  2NSB A;  3KHH A;  4IH7 A;  1ZTT A;  3M7V A;  1Y3K A;  2DNR A;  4X4R A;  2ABY A;  4YB5 A;  5BYR A;  3NGD A;  1RWP B;  3VAK A;  2WHO A;  2VZ9 A;  3FCH A;  1CJU A;  2QE5 A;  1HD0 A;  2CPZ A;  2CRL A;  3DLK A;  2LLZ A;  2DGT A;  3A4T A;  2R3V A;  3I0S B;  4PYD A;  1TUW A;  2LQB A;  4KO0 A;  1YWX A;  2FTR A;  4WFN Q;  5CD4 A;  3PR5 B;  5D4L A;  4K8R A;  2XSJ B;  4DR5 J;  3R2D J;  5LMU J;  5IQQ A;  1FRX A;  1G7C B;  1RHJ B;  3SMZ A;  4JYA F;  1TUG B;  4IG0 A;  2IRU A;  5DO2 A;  5AT1 B;  1XR7 A;  5IZH A;  5EWE A;  4W4M A;  1K44 A;  3HD2 A;  2IVF B;  5I42 B;  1QVF R;  3BEG B;  3W61 A;  2J8S A;  4C8K A;  1A7G E;  1NLK L;  1Y9O A;  2AJ4 A;  2JZ5 A;  3P49 B;  3R7N B;  2MLX A;  2OH2 A;  4RWX A;  3KKF A;  1TZ0 A;  4WXW A;  1O51 A;  4ECX A;  3O5T B;  3LTO A;  1NSP A;  4KB7 A;  1D1U A;  1UAW A;  4MK9 A;  2YWF A;  4P72 A;  1MRO A;  5AE3 A;  5DQI A;  4J91 A;  3VR1 A;  1FE0 A;  2CJQ A;  2LP4 A;  2W4D A;  3VAJ A;  2NYI A;  1NDK A;  2KT3 A;  2ZBR A;  3HX9 A;  4OX7 A;  2QFJ A;  2ZBI A;  3M2R B;  2E1P A;  3CWJ A;  1KR4 A;  3A3N B;  5E7O B;  1N5Q A;  4DUY F;  1D8Z A;  3UVJ B;  2JLG A;  3MTK A;  3THT A;  1NSK L;  1GX5 A;  2CQ1 A;  1LXN A;  1YRT A;  2P2C B;  3GON A;  3K57 A;  3ILI A;  1RWV B;  4A8S A;  1HPZ A;  5D4N A;  5I3U A;  4YDD B;  4B3T F;  1RT5 B;  3MPY A;  1Q81 T;  4F8R A;  3IWX A;  3MPV A;  4NLD A;  1S79 A;  1OQ6 A;  4NLW A;  1R0B G;  3DLG B;  3PZP A;  1RUS A;  4FN5 A;  1U1K A;  4C4W A;  2C2K B;  4PXD A;  2XY7 A;  2FUG 9;  3TVY A;  2Y8Y A;  3GU0 A;  1HNZ J;  5GAG I;  4ICL A;  2G2Y A;  3TVK A;  4ZP8 A;  4ZLL A;  2V4J A;  2HGL A;  5I4M A;  5K8M A;  3I4P A;  4ER8 A;  1KN6 A;  3M32 A;  4DFK A;  1IWG A;  4FDF A;  1UCN A;  5D78 A;  1MN7 A;  2OEK A;  1YJ7 A;  1F60 B;  3IGV A;  4MK7 A;  1S9G A;  3V81 A;  3M9N B;  2Y9H A;  1NJZ A;  2K1O A;  2H54 B;  3SSS A;  2MXY A;  3W1Y C;  5C42 B;  2HIQ A;  1RHM B;  2UUT A;  3H4D A;  2VQF J;  3HJV A;  1F5C A;  3M2V A;  3PYG A;  4HAC B;  4UOG A;  2MQL A;  1NK4 A;  3LGH A;  3R2C J;  5F8J A;  3HUL A;  5LJ3 Y;  1VBK A;  4K2X A;  4F4W A;  1RAA B;  2JL9 A;  4JOU A;  3T1Y J;  4PXC A;  2E9R X;  4C3K A;  1VQ7 S;  5J1E B;  4YDX A;  1T9W A;  2UVR A;  4WKR A;  1CBK A;  2DNP A;  5HBM B;  4NRU A;  2KU7 A;  2VKR A;  4U67 Q;  2HNY A;  2A6M A;  3MOZ A;  2QYG A;  4Y2K A;  5AXN A;  5ETN A;  1VOM A;  2CQG A;  4KBI A;  3TAM A;  1SUQ B;  3QAU A;  2JEF A;  2RU3 A;  1WF0 A;  4DX6 A;  3GTY X;  1S7H A;  2W1B A;  1IUJ A;  2EFN A;  3ENV A;  3EZO A;  3UCG A;  4X66 J;  4BCA A;  4HDG A;  3U02 A;  5C2G A;  2IA6 A;  3CCS S;  1FCA A;  4I2P B;  4CM2 A;  2XZT B;  4WCE Q;  2BV3 A;  3ZTR A;  3IC1 A;  3H5S A;  4KGM A;  2X3G A;  5DQG A;  5GAE I;  1S10 A;  4LF4 F;  3LP0 B;  3BRE A;  2GGP B;  5EGY A;  4QWD A;  5IOL A;  2M4M A;  1SBR A;  3ILL A;  1YX2 A;  2MPU A;  4K2J A;  4RW4 A;  4A47 A;  4CDI A;  4DUZ J;  2CJK A;  2VPX B;  3MD3 A;  4RNH A;  5HI7 A;  3EPI A;  2ZJR Q;  5AJ3 J;  5KG6 A;  2HZA A;  3CCT A;  2ZFH A;  3GMG A;  5CH7 B;  4YR3 A;  5HLF B;  3G8Q A;  4BC7 A;  3IFE A;  4N56 A;  2E5I A;  4Y28 C;  3FMT A;  1HPZ B;  2JXH A;  2XMV A;  2C3M A;  5I3U B;  1RHR B;  1SV5 B;  3QSI A;  2B5J B;  4I68 A;  1SIW B;  3W8G A;  2CQD A;  2Z2Z A;  3WBZ A;  4G6V B;  2FPH X;  2HFZ A;  4DV5 J;  3Q8V A;  4QWA A;  1RT7 B;  4B17 A;  2LEC A;  1FKA F;  1VRU B;  2EPI A;  4RKU C;  2HS3 A;  5K8P A;  5F9N A;  3E8O A;  3NAH A;  1RTD B;  4ZP9 A;  5F0W A;  5EX0 A;  1FI4 A;  4WXO A;  3OHA A;  2E9Z A;  4IQX A;  3CXC R;  5KT4 A;  4RZR A;  5KFN A;  5LMU F;  4QU7 A;  3PJW A;  3KFW X;  5GVQ A;  5KFB A;  3ILO A;  4P7V A;  2IC3 B;  3ZNJ 1;  3OSN A;  3MEC B;  3ZZZ A;  5DG9 A;  3B8H A;  3KK1 B;  4LF5 J;  3V4I B;  2HRY A;  3UQS A;  4DL5 A;  1TK5 A;  4WZM A;  2BQR A;  3L09 A;  3HHL A;  1SIW A;  3M6W A;  1WEY A;  3M8Y A;  1QTM A;  1UVL A;  1NLA A;  3D3C J;  3CJS A;  4ZVS B;  1RTZ A;  2R8I A;  2DH9 A;  5HP1 A;  4UY8 T;  3A3O B;  2UUC F;  1TTH B;  2OO4 A;  4I7F B;  2CPJ A;  4DU8 A;  3Q24 A;  5EHH A;  1HBN B;  3MR5 A;  1URR A;  1YBA A;  4LR8 A;  4OZ1 A;  4EYH B;  4MJW A;  2WZ1 A;  4RW7 A;  4ZA1 A;  1HWL A;  3TR5 A;  2GGP A;  1RT6 A;  2OAU A;  1I3O B;  2IYI A;  7FD1 A;  4O23 A;  2GW8 A;  2EG2 A;  5D4P A;  1FDD A;  1I51 B;  3I87 A;  2HFS A;  3T19 A;  1RWW B;  1X7V A;  2XTJ P;  2DTJ A;  3EDR B;  3FBC A;  3M8Z A;  1GFW B;  2HFU A;  3JQK A;  2HHQ A;  4G1Q A;  3MGJ A;  3MTJ A;  4CLK A;  1ARO P;  2DGU A;  4GVL A;  4RL1 A;  2LEP A;  4ZIV A;  3JSM B;  4F3O A;  1WHX A;  1ZET A;  2Q66 A;  4K4U A;  2FZC B;  4B9S A;  1LWX A;  2FDN A;  2VKZ G;  2ZM6 J;  2ASJ A;  2F4V F;  4RWW A;  4CT9 A;  2DH7 A;  1IKY B;  1N6Q A;  2HVH A;  1C2P A;  1JJH A;  4KV8 B;  2JFD A;  3KLG A;  2K9I A;  1QVG R;  4J7C A;  4NPO A;  4HI2 A;  4ES1 A;  1EP4 B;  1ZM4 A;  2DBB A;  3M8P A;  2NR0 A;  1P9Y A;  1KBR A;  1U45 A;  3MEK A;  1RA6 A;  3GYX B;  4C9D A;  2MHE A;  2FLP A;  2CVE A;  3G6X A;  4I56 A;  2GVZ B;  2NUH A;  3J7Z T;  3V6J A;  2QJ3 A;  2A1B A;  4LIW A;  3DLE A;  3WC2 A;  2HLT A;  3HVT A;  1PYT A;  1NSQ A;  4ECY A;  4DFM A;  2BAC A;  4I6Y A;  2GS8 A;  2AN7 A;  4X4T A;  2HBR B;  1FFW B;  1U6B A;  4YUD A;  2IJF A;  4M5K A;  4ZN3 A;  1TVR A;  4HI1 A;  4Y65 A;  1G3O A;  2KRB A;  2V8D A;  4LBP A;  4LSN A;  3N5F A;  1K8A T;  4C8L A;  3GCW P;  1WTB A;  5K9F A;  4RPF A;  1Y00 A;  1KQF B;  1RU2 A;  1HI0 P;  3E3X A;  4ZHR A;  2POK A;  4PUO B;  5GAG U;  2DR7 A;  3UNG C;  3H40 A;  2Z2M A;  1GTE A;  1RU1 A;  3JTP A;  5ETT A;  4X66 F;  2NXJ A;  2D69 A;  3LP1 B;  4FXE A;  5E3C A;  1VBY A;  1UET A;  3SFG A;  2HFO A;  2W2P P;  3C14 A;  2VAS A;  1S6P B;  2HQF A;  3MUV P;  3NS5 A;  2FLN A;  3HSZ A;  3ZXW A;  5CZX A;  4LBI A;  3KDO A;  4QIW D;  2CQH A;  1U2R A;  4MKA A;  4IO9 Q;  1PJ7 A;  4YB6 A;  5RUB A;  1NXI A;  2DKO B;  3M05 A;  4H4O B;  3MAA B;  1VGY A;  4ZPW R;  2BXJ A;  1FX4 A;  4C8Y A;  4O44 B;  1A6L A;  2W2Q P;  3RB4 A;  3H8Y A;  4HEA 9;  5K5M A;  1YJW S;  1RZM A;  3U27 A;  5AJ3 F;  1LWF B;  4LFC F;  4YS2 A;  2GHW A;  4PWU A;  4LF6 F;  2PFF B;  1WC5 A;  1Q0N A;  3KG1 A;  2DO0 A;  1GEH A;  1PC5 A;  4LVN P;  5T41 A;  3BH6 B;  3UFC X;  5AE1 A;  5KFJ A;  3BDE A;  1U49 A;  2E5L J;  1L3S A;  4O3P A;  2DGX A;  4LSL B;  1N0U A;  4TY8 B;  3MAH A;  2O3D A;  5B0A A;  4DL2 A;  2B4U A;  3PM9 A;  1U1O A;  1S1U A;  4ELV A;  3K2Y A;  1EIY B;  1NK8 A;  3T9Z A;  2V69 A;  4KV8 A;  1X4G A;  1H73 A;  1OG7 A;  1JIH A;  4F7V A;  1PBU A;  2B6A B;  2N7Y A;  4LMZ A;  2ZJP Q;  2UV8 A;  3IMQ J;  1NHV A;  2LA6 A;  2WSF C;  4ME7 E;  2X3D A;  4DS5 A;  1NK6 A;  4FF1 A;  1S48 A;  1GXT A;  2J9E A;  2DNG A;  2Z57 B;  3N6M A;  4MYU A;  1JLB A;  2DD8 S;  1QAY A;  4FPR A;  4OYO A;  4Y0F A;  2MKH A;  4MIB A;  3BGR A;  3R6L B;  5E3Q A;  4Q0B A;  1CVJ A;  4CP5 A;  4FS1 A;  1T9U A;  2G13 A;  2VQF F;  1T05 A;  2F5G A;  4X4Q A;  2M8H A;  2WB1 D;  3I0S A;  3ITH A;  3EX7 B;  4IFY A;  4Y2I A;  5E3P A;  3PW5 A;  1S0N A;  2HZV A;  1I5O B;  3KUG A;  1TL3 A;  3DGV A;  1BQN B;  1JNR B;  2I2Y A;  5KFC A;  1PJ6 A;  2CG4 A;  2UU9 F;  4ZLJ A;  3OJU A;  3T5L A;  4GRS A;  5BXI A;  3HHN B;  1REV A;  1D3W A;  4LF5 F;  1X8D A;  3GJS B;  2CJB A;  2IBO A;  2NSC A;  2QEX S;  1D09 B;  4ANE A;  4RNO A;  3DGP A;  2I5J B;  2DIS A;  4KKO A;  1C1C A;  3OR2 A;  3W64 A;  3MM5 A;  3OTB A;  4ZDN A;  2I6W A;  1KHW A;  2RQC A;  4DFP A;  2KG0 A;  3MM9 B;  5DDR C;  1P1T A;  3BQ0 A;  2QL9 B;  4DV4 F;  4B3S J;  3I9Z A;  3ZZ0 A;  4P9S A;  4WFB Q;  4PQU A;  1R8H A;  3TAP A;  5D8H B;  1X9M A;  4CNZ A;  1FK9 B;  2ZZT A;  5CYQ B;  5T14 A;  3MEC A;  2BM0 A;  5F8M A;  4JI0 F;  4CT8 A;  2FHJ A;  3CPW R;  2F40 A;  3NCR A;  3PHE A;  1BUX A;  3D9B A;  4XDC A;  2ACY A;  2XMJ A;  3HVW A;  3KLE A;  1Q82 T;  2QC3 A;  5JVH Q;  1WHY A;  4M94 A;  3DRP A;  3P5T L;  1VQ4 S;  3PRB A;  3R7B B;  4WZQ A;  3PTW A;  3SCI E;  1NPP A;  4I69 A;  5GAH I;  2ZHB A;  3DOM A;  4ZIT A;  3VAM A;  4OJH A;  2HNZ B;  4JI7 J;  1Q78 A;  1MNT A;  3IRX A;  1HNI B;  4H4K C;  4JI6 F;  4URQ U;  4FPI A;  1NH8 A;  1PIL A;  1UWB A;  4EWT A;  1FRH A;  2P8I A;  3U7J A;  1ICE B;  3RAM A;  3CD0 A;  4YHH F;  2EK1 A;  2XZD B;  5IFM A;  4NCA A;  3V6K A;  2HBQ B;  3UCU P;  1B7Y B;  4FYX B;  2XO7 A;  1XNQ F;  4JP8 A;  1HQE A;  5ETP A;  2KHD A;  4B3M F;  4CQ1 A;  4RJV A;  3VZH A;  2NZ4 A;  3B82 A;  1WHW A;  3AJ1 A;  4ES3 A;  4D8J A;  3LWM A;  1M1G A;  1XK8 A;  4NYP A;  5LJ5 Y;  1CJV A;  1OMS A;  1VQM S;  1WNE A;  4NCG A;  4QR0 A;  1KON A;  4BLG A;  4RU9 A;  2XB2 D;  3RBX A;  5A8K A;  3IBW A;  1B01 A;  3CDW A;  4WPA A;  1JLQ A;  2OFH X;  4IFY B;  6FD1 A;  3QID A;  3CCV S;  4FF3 A;  3KDN A;  3D1O A;  3PYD A;  1JLA A;  5C7P A;  3FT7 A;  2F9D A;  2RBF A;  1F2H A;  2AP6 A;  3I0R A;  4O4G B;  3BH7 B;  2UP1 A;  1KNZ A;  2ZBC A;  1GH8 A;  5K20 B;  5BJR A;  3KLV A;  3CVK A;  2AGQ A;  4IUF A;  1SC3 B;  4R8U B;  3A8I A;  4V1A k;  3TA0 A;  5HSP A;  4FP9 A;  1HW9 A;  2D3Z A;  2VFT A;  5DLG A;  3M8R A;  4R8U A;  3D1H A;  4HHJ A;  1XMO J;  1JXE A;  2FJE B;  2R7Q A;  1L3V A;  3K0J A;  1JLF B;  2F8H A;  1KSP A;  4O4G A;  4LR7 A;  1VQ6 S;  1JQG A;  1VDH A;  4KGV B;  1YIT S;  1W26 A;  1SUQ A;  1BD6 A;  2B7C B;  2M0G B;  2MST A;  2MKK A;  3LAM A;  1QSS A;  1UEU A;  5LSL A;  2RHS B;  5LOQ A;  1HQU A;  3NRB A;  3SQG A;  2Q3P A;  1SJ3 P;  4WTO B;  3TX0 A;  4B9M A;  2UXD F;  4E98 A;  4Y2M A;  1XMO F;  4RNM A;  1K1Q A;  5CYM A;  2NXE A;  2DNH A;  3RUB L;  1Z2Z A;  1R0A A;  1JJ4 A;  1KLM B;  2CQP A;  3DM2 A;  1RBA A;  4ZVP B;  2VJV A;  3TQ1 A;  2A0F B;  4IOC Q;  3BN4 A;  3MZI A;  4PG7 A;  3TVZ A;  4ETZ A;  3FMW A;  2JNJ A;  2PGC A;  4NLP A;  2RD5 C;  1AUS L;  3NNA A;  5KG1 A;  2LQJ A;  2CA9 A;  3MMB A;  4M5G A;  4NMX A;  1DTT B;  2UVU A;  1UW9 A;  2JLE A;  3CCR S;  2BQU A;  1VIS A;  1N48 A;  1TU0 B;  3NXZ A;  4DS4 A;  1LW2 B;  1NK0 A;  2BOP A;  1BXN A;  2RVJ A;  3ISN D;  3SXL A;  2X7I A;  3MM7 A;  3PRV A;  1G4C A;  3N79 A;  1WSV A;  4G65 A;  4USH A;  3MFI A;  2PSZ A;  1NKC A;  2RF2 A;  3TWZ A;  4LRV A;  5J2N B;  1CJK A;  1NHK L;  5F41 A;  1RKJ A;  2GHV C;  1M5P C;  2L9N A;  1LFW A;  1NSA A;  3Q8S B;  3IG1 B;  1S1X A;  3BQ1 A;  3PG9 A;  2YX1 A;  3I32 A;  2K7K A;  5L9X A;  3BGO P;  3FZ2 A;  4ID5 B;  3QGI A;  2W8K A;  4MTP A;  3NGK A;  2ZNY A;  4KSE B;  3F56 A;  2JHE A;  4N5S A;  4J9R A;  2VG5 B;  1R0C B;  2RH3 A;  5G0R B;  3PW7 A;  1RB0 A;  3MXH P;  1KEK A;  4F26 A;  4ILM A;  2EBG A;  4QW8 A;  1RQ0 A;  3CIZ A;  3GIJ A;  4U8V A;  2FJX A;  3CED A;  2I1R A;  4HL9 A;  1Q8L A;  2MKI A;  4EZ9 A;  3PNI A;  3CCQ S;  2DYA A;  3CJ5 A;  5B09 A;  1XMQ F;  2MDA A;  4KFB A;  2W2O P;  4F4Y A;  4KAI A;  3ZZO A;  3G96 A;  2VOO A;  1NU4 A;  3UPF A;  4NL5 A;  5DQH A;  4ED1 A;  3WX4 A;  5GAD U;  1NJW A;  1T9T A;  1NCL A;  1VC0 A;  2PEB A;  4TYB A;  2HGM A;  3ZTO A;  1LOU A;  2RU9 A;  4RW9 B;  4EO8 A;  4XO0 A;  4CLW A;  2BQ3 A;  1RAO A;  2MZR A;  2BEF A;  2GNK A;  4P75 A;  1SPB P;  1KLN A;  4IKA A;  3SCL E;  2HEK A;  5DJB A;  4CO4 A;  1YVF A;  2WSC C;  4DR5 F;  1U1P A;  4DF8 A;  4P73 A;  1JLG B;  1M5O C;  2RE1 A;  5I42 A;  4FKX A;  2GJI A;  4ZJO A;  3OVA A;  2J7W A;  5KFO A;  2WB4 A;  4DLE A;  2BJD A;  4DV2 F;  2BYC A;  4DXL A;  4AQY F;  4MAK A;  3SFU A;  5KFI A;  4M5M A;  2DO4 A;  2BJ1 A;  1TP7 A;  3KK2 A;  4BDP A;  2JXG A;  2HG4 A;  2WBR A;  3AA9 A;  3BBC A;  3C16 B;  5BYQ A;  3CO9 A;  4DDF A;  4DX8 H;  4P2M A;  3Q83 A;  4QIG A;  4WWS A;  3TJA A;  5M2U A;  4AXI A;  4TQS A;  2XS7 A;  2COL A;  3DRS A;  1LQ9 A;  4OI3 A;  5J2P B;  2VFU A;  1IWA A;  1YSJ A;  3DLB A;  4ZVO B;  3AD7 C;  5B0G A;  2FJA B;  1FXR A;  1Q53 A;  1HWU A;  1ZBT A;  4OI2 A;  3RBZ A;  1ZPV A;  4DV2 J;  2XY6 A;  3HXM A;  3V6H A;  4JI6 J;  1AT1 B;  2NPI A;  4DFJ A;  2G4B A;  4LT6 A;  4F67 A;  1CUL A;  1LV5 A;  1FER A;  1XEZ A;  2PI4 A;  1X4E A;  1FHT A;  3TEG A;  3KLH B;  3HPO A;  2HBZ B;  4H4O A;  5GAD I;  2QA1 A;  2ZUG A;  3GV8 B;  5IWA J;  4A8M P;  1NKE A;  4KYZ A;  1N5V A;  2R9L A;  4FS2 A;  3TNV A;  4AL6 A;  3EXC X;  3W65 A;  1K73 T;  3AQO A;  1K1S A;  4BS2 A;  1WDT A;  4P2F A;  3M2U A;  1RA7 A;  3CT9 A;  3BJY A;  1X93 A;  2M3D A;  2V0N A;  2HYI B;  4HHH A;  4RNN A;  1S5Z A;  2QL5 B;  1PKU A;  4Z7Y A;  1SL1 A;  5HVF A;  2JC1 A;  1N88 A;  5ETV A;  1E6Y B;  3JSR A;  1H3D A;  1U2C A;  2HWH A;  2WAQ D;  3QYY A;  4CO3 A;  3Q8R B;  1XC9 A;  3V6D B;  3W2V A;  3HVA A;  1SH2 A;  3GJT B;  4WE1 A;  2H5E A;  2YKN A;  4JYA J;  4DHV A;  1QTN B;  1ZAV A;  1P27 B;  3Q8Q B;  4MFB A;  5DLF A;  3M30 B;  2OTL S;  1O6X A;  4EFA C;  1EKS A;  1GXU A;  1S1T B;  2R8J A;  5D0R A;  1XTZ A;  2CPH A;  4NLX A;  4WK3 A;  5FLX Y;  1VC6 A;  1D0E A;  2J6U A;  5AE2 A;  2UU9 J;  1HNW J;  2KFN A;  5FJ4 A;  2RIJ A;  3PX6 A;  2VJU A;  2IY5 B;  1VBZ A;  5F3T A;  3QZ8 A;  3MPD A;  4NXN F;  4DL7 A;  2DGV A;  4TKT A;  5E3R A;  3MM8 A;  1U1L A;  1KVI A;  1UPM B;  3IO1 A;  3SBM A;  1VQK S;  1DUR A;  2JVO A;  3GFX A;  1U26 A;  4M5D B;  3QFW A;  4YR2 A;  4C98 A;  1OSD A;  2UUA J;  2XYG B;  1Y7P A;  1T95 A;  4X4P A;  5B0C A;  3AOD A;  5CCL A;  4U7U D;  2NUU G;  1S57 A;  4ERD A;  4OX6 A;  3JTN A;  4CO5 A;  4LRE A;  1WI8 A;  4Q7A A;  2V94 A;  4O3O A;  4JV5 J;  1S76 D;  1NBE B;  4BBY A;  1TL1 B;  3ENA A;  1IKY A;  3MPU B;  1YLX A;  3J80 Y;  2DJW A;  4CLF A;  4WKY A;  3OPK A;  1VC5 A;  3PDN A;  2HQD A;  2RDD A;  4JV0 A;  2NZC A;  3CW2 C;  2ALY B;  4DG1 B;  4AQY J;  2HS0 A;  4YB1 P;  1VQ9 S;  3K8W A;  3BF4 A;  3NOC A;  4MIA A;  1JNZ B;  1MWZ A;  1T02 A;  1T9X A;  2L3M A;  2A18 A;  3IR7 B;  1RT1 B;  2GQC A;  1J5E J;  1FDN A;  2IJR A;  1TKX B;  3MFH A;  4IRD A;  3IM9 A;  1SC4 B;  4WU3 A;  4LQ3 A;  3KG4 A;  1I94 F;  3M6U A;  8AT1 B;  2B8P A;  2NPF A;  4GMK A;  3PIP Q;  4C8Z A;  2NQP A;  6AT1 B;  5E0O A;  4F50 A;  2ZDP A;  3A1Y G;  4N8O A;  2IM1 A;  2F4V J;  4ELU A;  3NCP A;  1IBC B;  1KP6 A;  2NS1 B;  4OV6 A;  3VV2 B;  4DCJ B;  3C6U B;  3J81 U;  1TL7 B;  1NUE A;  3K5P A;  3U1N A;  3QPI A;  5DS7 A;  5KOW A;  4AD6 A;  1X5P A;  4UF4 A;  1HMV B;  4EBD A;  1IJF B;  2V63 A;  2HSE B;  2V8V A;  2Y0B B;  3HHL B;  2AGO A;  4K4X A;  2H4W B;  2DY9 A;  3H59 A;  3PEJ A;  4A48 A;  3O2I A;  4C11 A;  5KAK A;  1UZD A;  3A13 A;  1R6Y A;  3ISZ A;  3LP2 B;  3V81 B;  2J6T A;  3I56 S;  4ZIW A;  4TLR A;  3D0I E;  2JEG A;  3M32 B;  2JVR A;  4UST A;  3OL6 A;  2YVS A;  2B8Q A;  2ROG A;  1QAJ A;  1N5T A;  3QT8 A;  2DNO A;  3FSX A;  4KHP J;  2XEX A;  4DUT A;  1SKS A;  1MWY A;  3NKY A;  3W9H A;  3K5M A;  2QLF B;  1BQM A;  1BMQ B;  4DQR A;  2FC9 A;  2QT7 A;  1FWP A;  4J37 A;  3ZZU A;  3KLE B;  2E44 A;  2XLI A;  2BM1 A;  3G9C A;  3IAS 9;  4NLY A;  3WQP A;  5KFQ A;  1T0T V;  3QGP A;  4DR3 F;  3SZ2 A;  1FFG B;  3ZTS A;  1U09 A;  4WP8 A;  9ATC B;  2CIM A;  3RB6 A;  1RTH A;  2CJ9 A;  1F3V A;  2Y1R I;  4JI2 J;  1U02 A;  1PYO B;  1X31 C;  4DU7 A;  3BKT A;  4J9K A;  1C1C B;  3OR2 B;  2I9S A;  3AA8 A;  1OYE A;  1BGX T;  3VAF A;  2FJW A;  1FRL A;  2E66 A;  3CMA S;  3FEY B;  3W5Y A;  3LPY A;  1H74 A;  2WBM A;  3LW5 C;  1U1N A;  2ZWO A;  4KGK A;  3DRX A;  1IBK F;  2R8K A;  3W2W B;  4ED7 A;  5J2P A;  2CNK B;  1NDP A;  2J76 E;  3TAN A;  2OPR B;  5EUH A;  3ENW A;  3FC9 A;  3G82 B;  1RWN B;  3PV8 A;  1YBT A;  3IAM 9;  4RUA A;  3R27 A;  2IYG A;  1UFL A;  3SDE B;  4ZVH A;  2FGO A;  2JC0 A;  3QO9 B;  4Q2L A;  5DRK A;  1RIS A;  3D68 A;  4W98 A;  4CO1 A;  4OHY A;  4USK A;  5HL7 Q;  1HL6 A;  4DV5 F;  3R5C A;  2HQI A;  4A8Q A;  2DNY A;  1HYS A;  2FVR A;  2KDO A;  3T1Y F;  2XO6 A;  4GVB B;  3QGH A;  5B0B A;  2HFN A;  3VQS A;  1YQH A;  2IDL A;  2NXU A;  2BKP A;  4NX9 A;  3KJV A;  1JXV A;  4ZK7 M;  4B9V A;  1Q8K A;  2ZJQ Q;  2HNY B;  4ITS A;  1JK9 B;  2XMK A;  3QAT A;  1Z2L A;  4S0M A;  3JSY A;  4H4M B;  3SEO A;  2V4Q A;  3QQC D;  4NAS A;  1IBM F;  4F0H A;  1N33 J;  3RB0 A;  4PXE A;  4X62 J;  2HHU A;  3WIU A;  3HT0 A;  1IKX B;  2EFV A;  4PQA A;  2FLO A;  1W7W A;  2M7S A;  2Z2L A;  5T7L B;  3OUY B;  1F1B B;  2HFV A;  1OPI A; 
#chains in the Genus database with same CATH homology
 1MYK A;  3QSI A;  2NZC A;  2BNZ A;  2WVB A;  2K6L A;  1IRQ A;  1U9P A;  1PAR A;  2CPG A;  4ME7 E;  2BNW A;  2K1O A;  3BKT A;  2CA9 A;  2BJ8 A;  1Q5V A;  2WVE A;  2BSQ E;  2AY0 A;  1BDV A;  1NLA A;  1BAZ A;  2Y3Y A;  2K29 A;  2JXH A;  2BJ3 A;  2BJ1 A;  2WVD A;  3GXQ A;  2JXG A;  1X93 A;  3LGH A;  1EA4 A;  4D8J A;  1BDT A;  2JXI A;  1P94 A;  1QTG A;  2K9I A;  2KEL A;  2CAD A;  2BJ9 A;  2K5J A;  3QOQ A;  2PC6 A;  2GPE A;  1MYL A;  2HZV A;  3VW4 A;  3PHT A;  2WVF A;  2H1O E;  3BKU A;  3H87 C;  1B01 A;  2CAX A;  4FXE A;  2BA3 A;  3OD2 A;  1B28 A;  2FGC A;  2HZA A;  2WVC A;  3FT7 A;  4HV0 A;  2CAJ A;  1ARQ A;  1MNT A;  2BJ7 A;  2RBF A;  1Q5Y A;  3BKF A;  2F1F A;  3FMT A;  3VEB A;  1ARR A;  3VEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...