2WVCA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
132
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDEDNPNDESKIAVLVVIYDGGQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 32
structure length 132
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvcA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvcA02
2CAXA 3BKFA 1NLAA 2JXIA 1Q5YA 2CAJA 3QOQA 2FGCA 1MYKA 2BJ8A 1BDTA 2WVDA 2JXHA 2BJ9A 2GPEA 2BSQE 2WVBA 1PARA 2NZCA 2HZAA 2BA3A 3FT7A 1ARQA 2BNZA 2WVEA 2BJ1A 1IRQA 2CA9A 4HV0A 1P94A 2K9IA 2F1FA 1BDVA 3GXQA 4ME7E 3VW4A 1MYLA 3VEBA 2K1OA 3BKTA 2RBFA 2K29A 4FXEA 2CADA 2BJ3A 1Q5VA 1B01A 3OD2A 2K5JA 1BAZA 1EA4A 3H87C 2BJ7A 2H1OE 3PHTA 1ARRA 2PC6A 1U9PA 3BKUA 2BNWA 1B28A 2AY0A 3QSIA 2WVFA 1QTGA 2JXGA 3VEAA 4D8JA 3LGHA 2CPGA 2KELA 1MNTA 3FMTA 2Y3YA 2WVCA 1X93A 2HZVA 2K6LA
chains in the Genus database with same CATH superfamily
4A8YA 3PEHA 4CNYA 4PXDA 2AEFA 4DFJA 1HNXJ 2EFOA 3WHIA 1JLCB 3C16B 1M1KT 3T5LA 3TRGA 2BE7D 3QRRA 1N0VC 2HNYA 2RDIA 3DRRA 4IKAA 1EZZB 2QIFA 4QR2A 4TXSA 4DHVA 1VJWA 1LW2A 4DQIA 3HDSA 2RD5C 1U26A 4WU2A 2DNOA 3CWJA 2LVWA 4PEOA 2XCPA 3NNEA 4L76A 2DH8A 1S57A 3EVWA 2GQQA 4DL7A 4LR9A 3BKUA 1LK7A 1DZ5A 1URRA 2HZCA 1DFDA 4WFBQ 3G82B 3WX8A 5I42B 1OMSA 1XNRF 4H4MA 2KXNB 5CCMA 2RKIA 1VRTA 2Z2ZA 1FTCA 2RIJA 2ZWPA 4LF7J 2WVCA 4E0DA 3L7UA 3NCRA 5GVQA 2PA3A 3POTA 4OX9J 5LJ5Y 3NLCA 4QOTA 5RUBA 5D0GA 2RQCA 3PW5A 1LKZA 3M2UA 1FKOB 1NKBA 2WVEA 2Y1RI 2Y8WA 2B7CB 3N6LA 3A13A 2EVZA 2O01C 5DQHA 3W66A 1UTAA 2VHGA 3CJKA 3U1LA 1U47A 1FKPB 1D9AA 3ILLA 2MGZB 1Q5VA 3T5HA 5SZTA 1TKXA 1ZZFA 2H5EA 4DL0C 1YRXA 3MCOA 2BJ7A 2GFFA 1OG7A 1YQHA 4LF9F 1ARRA 1TKTB 3T6JA 1RP5A 2VICA 2F63A 3MCNA 1HNZJ 5J2QB 4FYWB 2E1MC 1S99A 4NMLA 2HQCA 5IWAJ 2MJNA 1WTBA 4X4NA 2HKEA 2N7YA 3AXMA 3KLGA 4MH8A 2ZD1B 3V4MA 2WTFA 2RB7A 3GV5B 2XG8A 1XNQJ 3QT6A 1EX8A 2XTJP 2HZVA 1T95A 4WFYA 2F7VA 3G9CA 3M2RB 2DHXA 3PKMA 2CZ9A 3W5XA 4EBCA 4DPTA 2KB2A 5AXLA 3MECB 3UDCA 5C42A 2HRTA 4A48A 1CJTB 1S0VA 2UXDF 2ASYA 2U2FA 3PRDA 4IO1A 4XDDA 1OIAA 2QX0A 4HT5A 5DM6Q 1HW8A 4K4VA 1AZSB 4MK7A 1RT7A 1DTTB 2Q3PA 5HBMB 2KJVA 4K4ZA 2HK2A 4DSKA 3OHBA 2CFXA 3PW7A 1GTHA 2YQ3A 1G1XA 4ZVRB 4X4OA 1UVKA 3GE9A 2KZMA 4NEYA 5ETLA 4XDCA 4IFVA 4MT1A 4LQ3A 2QO3A 3Q23A 1WF1A 3OVAA 4TU9A 5H9FK 2K1RA 1XC9A 3THPA 4B3OB 2BKPA 1U1NA 3LANA 5H1SV 3TAMB 2E29A 2KT3A 3HZGA 1CULB 2YKNA 2GMLA 2JSXA 2ZH2A 2J7WA 3EZUA 1HD1A 1REGX 4C0HA 4ED4A 2N4CA 4DPUA 4OYOA 5D3GB 5KFTA 4FYYB 4U96A 1MN9A 4MKYA 3OSPA 1UA0A 1BQNA 2AIRB 3TQEA 2IBKA 1YX2A 1U6ZA 2BANB 3H25A 2V34A 4DR3J 3MUVP 3KLHA 5ETMA 2XY5A 2ZOMA 2EFNA 2ZBQA 3G86A 2Q1LA 2H1OE 1Z1ZA 4I2PB 1VCTA 1CJKA 1Q81T 4NI2A 5LXYA 2KM8C 8ATCB 3DM2B 5BYSA 3BGRB 4RBTA 3LP1A 5KT4A 3GZ7A 2ABYA 2V9KA 3UVJA 4CM0A 5F0WA 3BKFA 1U1MA 2M8HA 4RZRA 3N4WA 4ECWA 3I9ZA 1CBKA 4J91A 2C1EB 2ZE2A 3HVTA 1S7HA 4HTJA 2VG5B 1OQ6A 3ICLA 1QE1B 4OZ5A 4Q7AA 2O67A 2OPRB 1FCAA 3E8OA 2D3ZA 4RW6A 2NXNA 3D66A 5A6PA 3Q8PB 3MEDB 4JB8B 4DEZA 4ZP7A 4K0KJ 3C6TB 4LVNP 1U7LA 3PNIA 3DLKB 2YKOA 1S6QB 2HS3A 1HNIB 2OKQA 1SC4B 1DLOB 5KOWA 4DQRA 2V67A 3VALA 2VPYB 3T19A 3CMQA 2ZH1A 3HHLC 4OHYA 3QATA 3M2VB 3K5PA 3R97A 2JEJA 3NKYA 1K8AT 2DHGA 2IIHA 1IR2A 2F65A 3SSSA 3D1HA 4FZVA 2CIMA 4G1IA 1HWLA 1ZM4A 3KK3A 2CXEA 1MNTA 1XEZA 2RUSA 3GIMA 1RLCL 3OUYB 1X93A 5T41A 4A8WA 3CMES 3LA0A 2EBGA 1XNQF 2PMWA 3IR6B 2DPIA 4OJ3A 4QWDA 1V3SA 1VQSA 1UJ4A 3O2IA 4RW4B 1S48A 2IVMA 2YH1A 3SV3A 3IR7A 2XNRA 2QLWA 1RAAB 1RWOB 4ZPAA 1U4BA 2AHOB 3B8HA 2CRLA 2VDIA 2H3EB 4ZPCA 2HPUA 1SIWB 4Y6IA 3BKTA 4GVLA 1WC6A 1YDLA 4RR5A 2DISA 4DSFA 2ADCA 2P6SA 2DCUB 2PD1A 3EXYA 4WK3A 1R43A 4DX6A 3S7RA 2C3OA 5HVHA 3H98A 3M8SA 3G6YA 4F25A 2DGXA 5HQLA 3LPYA 2AY0A 2R2TA 3OV7A 1HBNB 3GIKA 3KK1A 2ZOFA 1WC4A 2WB4A 1IR0A 3DLGB 2PA8D 1R6VA 4X62J 3A3OB 4B3TJ 2RDDA 1RT5A 4DQSA 3BJYA 1RT2A 2QZ8A 5HMZA 4OLPA 3H42A 4OZ2A 2LECA 3JSMA 3IWLA 3CDEA 2HIQA 2XSJA 3D4JA 3KLIB 4OZNA 1CG2A 4Q45A 1NU4A 2HHPA 4OI2A 2W2OP 4A8FA 3VVUA 2L41A 3K5LA 5KFFA 4DR7J 2FLLA 1P94A 2DNHA 4HACB 4NRUA 3EUNA 3CD0A 3GJRB 1NKEA 2ZD1A 2DY9A 4WP8A 4B02A 3H7HB 2J7KA 4JUZA 1N5SA 4DR3F 2DNPA 3QNWB 4ZA1A 2JFDA 4NZ0A 4O23A 3VGTA 1JLEB 1UZHA 2A6MA 1U9PA 5KT2A 1XR6A 3QBCA 1SH3A 3UR0A 3SSRA 5KFYA 3WIVA 4PPDA 3B78A 3RAMA 2XMVA 3BREA 5KAKA 1J5OA 3S6EA 4ZITA 2L9DA 3SCLE 3M32A 1RLDA 5F8HA 4NLQA 2DR8A 1RHJB 3PTWA 3NGKA 4YB1P 1P9YA 4IOCQ 1VC0A 3OTCA 4A8OA 4LF8F 2JBVA 1X9MA 3QT8A 3G8TA 4JI0J 2YBVA 4OI0A 3HT3A 3DLEA 2KTQA 1K0VA 4EFAC 5HJXA 1X4DA 3O6QA 3DOMB 4TLQA 2EEYA 4OJGA 2KYXA 1RAFB 2DEJA 2ZBPA 2D9PA 2QV6A 5C24B 3KK2A 4L3KA 2Z0GA 2GAHC 4O0NA 1N5TA 2IAJB 4UY85 3TUPA 5CZXA 2CNLB 3V6JA 1YJUA 3KDOA 2ALYB 3V5RA 2P9GA 4OZ0A 1H3DA 3PR5B 1W25A 4KFBB 4MKBA 4LIWA 4ZJLA 3Q0AA 5A8WB 1RWNB 2G0IA 4N5SA 5A8RB 1RHRB 4C8KA 1SL0A 4ZN3A 3GPAA 1S1WA 1AFJA 3F41A 1OY9A 1Z4UA 4YOEA 4WFZA 1F3VA 3OJUA 5D8HB 3MAHA 3MEEB 1ARQA 3ZZZA 4B9SA 2B43A 5KG0A 1LFPA 1FFWB 2XHCA 3FSYA 1BD6A 4F0HA 2OTLS 3VR1A 5KFIA 4UQGA 2VQFJ 4WKRA 2F4VF 2W2NP 3FNNA 2W25A 3MPDA 1FF2A 3JQJA 3PXGa 3OD2A 3MAAB 2UUWA 4DZ6A 2DGVA 3OLAA 1RWKB 1X4GA 2H4WB 3GTYX 2XLKA 2VG5A 2Z2YB 2ILYA 4NLOA 5KFNA 3ELHA 1DTQB 2ZM6F 2VPXB 2Y9HA 2BACA 2I0XA 2ZZTA 3J7YI 1CJVB 1VMBA 4I4BA 2KL8A 2G0CA 3HXMA 4EO8A 1HNIA 3QT7A 2WW8A 4ANCA 1DLOA 1RWVB 1T05B 1SKWA 1LV5A 2Q66A 3W65A 5HROA 4RBUA 2JLFA 3AY0A 5J2PB 2FHJA 1K1SA 2H3AA 1T9VA 3D1OA 2H5IB 3WQPA 3LJPA 1TKDA 1RISA 3C15B 3ISNC 1RYSA 2DIVA 3OUYA 3MM7B 4NEZA 2W2PP 3CDUA 2GVDA 1NZAA 1FDDA 1T9XA 3JQMA 2G2YA 2A6OA 4ETZA 2GO9A 2XWXA 3Q24A 2FJEB 3NS7B 3I4PA 1VISA 1RT3A 2P2CB 4DFMA 3DXSX 4CH7A 4AE5A 2BQRA 3CJ5A 2G2OA 3H20A 3H0PA 4DV1J 3CJTA 1KNZA 4CWBA 4KGZB 1R8PA 2AJQA 3GV7B 3CD5A 1TV6B 2QEXS 5CHCB 4ZCIA 4UT4A 4B9MA 4LF6F 2FHKA 3ULHA 2CQ0A 2DKOB 4CYUA 3LQVA 2XS5A 1JXVA 2J9DE 3P5TL 1S97A 3PIPQ 1LFWA 4UF4A 4NLGA 1C4AA 4QJVA 2VU5A 1U49A 2BBEA 2I38A 1WKLA 1X31C 5EGYA 4JI0F 1FDAA 5IT9Y 1VBZA 1VHFA 1CJUB 2K7KA 3C14A 5LMUJ 4FVMA 2R2RA 2ZH9A 3G8QA 2ZBRA 1VHIA 4NLSA 1P6TA 1WNEA 1YK9A 1HI1A 1XMBA 2J5AA 3KLIA 2UXCJ 2HVEA 2NSCA 5I3UA 4HH1A 2IM2A 3V6DA 1RA7A 2W4DA 3HVAA 5J1NA 3QLHB 3U02A 4HACA 4C4WA 3V81A 2X1AA 1GMWA 2V4JB 2QMWA 4IUFA 1K73T 4RJVA 4USTA 2DCLA 2MQPA 1D1UA 4PG6A 5EN1A 4OFZA 3BYRA 5KT5A 1JLEA 5LMNJ 8RUCA 1GT8A 3CCMS 2Y8YA 4ECZA 3G6VA 1TK8A 1RT1B 1QD1A 1N88A 2IM3A 4U8YA 2ZH7A 1PGZA 1C0TB 1JIHA 2KM8B 1S12A 3BQ1A 5FDLB 3ILJA 2V8DA 3P45B 2CNNB 4AXIA 2YNGA 4FF4A 2NXCA 2JC1A 4LF2A 4DPOA 4LIRA 2VQFF 3CCJS 2ASLA 5MAOA 2MZ1A 4PYDA 2BMBA 4N56A 1LW0B 1FJGF 3GJSB 2W8LA 3TJ9A 4RUHA 5K20B 4RW9A 4D3HA 1RAIB 2AJ1A 3M8ZA 3UQSA 1RU2A 3FBCA 1WOPA 3MM8B 3HULA 1SL1A 2JHEA 3DLBA 1U8SA 1G2EA 1FFGB 1SJQA 2LQBA 2HW3A 5KG6A 4LFAJ 3UI3A 1KOOA 2L9NA 1X4CA 3BM7A 1RTHB 4IFYA 2FQQB 3M8QA 4NWBA 5C24A 5LSLA 4DUTA 4B3RJ 5JUMA 2FVCA 3IAS9 1S9GB 2HG4A 3HHLB 2W7AA 4ECVA 1VBKA 1PILA 4CTAA 1Q8BA 5AT1B 3QZ7A 1RGVA 3FRZA 4KE5A 2VL1A 2ACYA 3NNCA 4O0IA 2RBFA 1YIJS 3EZOA 3BBCA 4OI1A 4CLSA 3GJQB 5C2GA 1S1XB 2Z30B 2J6TA 2QSFA 5J1EA 2DD8S 4WFNQ 4FF3A 3CCUS 3PW0A 3M9NB 4ZVUB 3TJ8A 1Y4ZB 4PYAA 1SCJB 3ETOA 1Q95G 3G6XA 2CQCA 4ECRA 3F73A 4C0BA 3JQKA 1RI7A 3RJMB 5CQGA 3NNHA 1V6HA 3G96A 1G7CB 3VGUA 2Z57B 4JI6J 2HHHJ 3OFHA 4F2RA 2MEWA 2FLPA 2NYHA 2P9EA 4Z2XA 1DARA 4H4OB 2W01A 5DM7Q 3UNGC 1NH8A 3GP9A 3I32A 3DRSB 3MPYA 3ZTSA 2CVEA 2BEFA 4O4RA 2E44A 3NEKA 1OO0B 3NGRA 5ETTA 4RNMA 4U9RA 1VRUA 1CQNA 2F40A 3ENVA 4NXNF 4WBFA 5G0RA 2CG4A 3PVXA 1T03B 1SC3B 1JLAB 3TUIC 2UV8G 1WD6A 6FDRA 3C66A 2WSFC 4X65J 1VS3A 3PJ9A 2IVFB 3HVRA 1IBMJ 4F26A 1HWIA 4Z37A 2Z56B 4MK8A 1R7IA 1LEOA 2BRKA 4OV6A 1WKJA 4Y0FA 1LWCB 1D8YA 4YEAA 2UXCF 2YWFA 1ZA1B 2V8GA 2UXBJ 2CPDA 2WCXA 3FSXA 4K4XA 4B3SJ 1YBTA 5GAHI 2UP1A 1HIYA 2PT0A 2C3MA 3C15A 1EETB 1S9EB 3BGOP 2DHHA 2MQ8A 3OL9A 3I0RA 1J2VA 2YNIA 2HK3A 4DF8A 2HVHA 2VODA 4KGKA 4YFUA 3GYGA 4WP9A 2CJAA 4JI8F 3F56A 3EVOA 1PAEX 2J0QD 5HP1A 4I0WA 1DQAA 2GGPA 2BDPA 5B0DA 3SIPB 5LMNF 4TKTA 1T3NA 2M0GB 3HHDA 1XTZA 5IS2A 1XR7A 1J5EJ 2YXLA 1S1TA 2M8DB 2E5JA 1CEZA 2E9ZA 4QCLA 2Q43A 3RR7A 3OR2A 7FDRA 1HWUA 3KUHA 3H87C 4USUA 1MN7A 3MF5A 5KFEA 4IH7A 3UE2A 2M5YA 2C2OB 4HR2A 5DGBA 1Y5NB 2BV3A 2GHWA 3RB4A 4P9SA 2VDHA 3G2XA 2XLJA 5JXSA 1RWXB 1UVJA 1KC8T 2KZZA 4D8JA 1XJWB 2CQBA 1ULRA 1KRPA 4OHWA 2MKCA 2NPIA 3QIPB 2XWYA 1C1CA 2BM1A 4NYZA 4LFAF 3T6BA 3M9MB 2GX8A 1Y3JA 5KG2A 1TFWA 1MWQA 5KFKA 2XGQA 3H8YA 1PIEA 1MSWD 1UVLA 1UW9A 3KG4A 3UPFA 2ATCB 3ZZYA 1QM9A 1ZS6A 3EXCX 2UUBF 4ED8A 1GEHA 4KV8B 1KEKA 3P4UB 1Q4RA 1IKYB 5BR8J 2JEGA 2ZKUA 3C6UB 2L3MA 2R7SA 2W9CB 3QO9B 5J2MB 3HD1A 3DLJA 2WOMB 4JV2A 2EWHA 4RO0A 2VIHA 4RU9A 2DJWA 4MJKA 5SUHA 4NLXA 4DPYA 4YY3F 1OJ4A 4YUDA 2V8PA 1QSLA 3UD3P 4NZ7A 1XK8A 4EWTA 1Q8KA 2VFVA 4EBEA 4HT7A 1RTJB 3VEAA 4PQAA 4ZDNA 2YNFB 1C0TA 1FX4A 2AGOA 2B7BB 4BWJA 4KSEB 4MAKA 2BQ3A 2HHHF 4DZDA 1MROA 4ED2A 3IWXA 3J81j 3OL6A 5KFVA 5AXKA 4A4JA 4LVOP 5GMEA 3X3UA 1SQFA 4K5RA 2BA3A 1WACA 1RTDA 1NK9A 2ADLA 4ITSA 1DRZA 4U6PA 2QJ3A 5HMXA 4GVBB 4UQTA 4IH6A 3THTA 3EM1A 4CLFA 4OYXA 2OPPB 3FK4A 3W3SA 4ZCLA 1W2BR 4K4WA 3BO4A 4P2SA 2RT3A 4OLOA 1SKRA 4X64F 4X65F 4FBUA 2HURA 3OR1A 4NCBA 3QSYB 1JLQA 3HHLA 2RNEA 3ZZUA 3SYZA 1F5BA 4X66J 2B4UA 2PE8A 1X9WA 1WC0A 2F9DA 2VZ9A 3GB0A 5IC4B 2VFRA 3PRVA 2UXBF 1UP1A 4NCGB 4B3SF 1I94J 5F8IA 3SCKE 2BW7A 1WEXA 3ZC4A 4RNHA 1ROFA 3KHHA 1OSDA 4IRKA 2WONA 2B9WA 1NSQA 2HHSA 1NHUA 4PQUB 3QAEA 1T94A 3DDKA 4YHHF 4ED6A 4MIBA 3SBMA 2C3UA 4P71A 4PXCA 1WEZA 2FVQA 1UFWA 4CH0S 4ME7E 2A2CA 1MYLA 3W63A 1V9OA 1DURA 1J5EF 1IKXB 2QFJA 1RWWB 3RBXA 2ZHBA 2HIYA 1FEEA 2EK6A 2Q79A 1RT4B 2V68A 1FNOA 4CCHA 2PEHA 1X5OA 3I55S 3T5JA 3I6PA 2XLIA 2JRSA 1U0HB 5A0YA 3QFHA 3KLVA 3TUJC 4IRDA 2VG6A 4L72B 3C3LA 3IM8A 2M7SA 3KLFB 4OV1A 3TA2A 3PV8A 3U7JA 1P9QC 2E9TA 1TMJA 3V4IB 2NXUA 4CLWA 4MFBA 1EP4A 5J2NB 2MHEA 1RTIB 3FVYA 2EFGA 1Q7YT 1KN6A 2AT1B 3EX7B 2HGLA 4RW8B 5THWA 4ES2A 2RRAA 2GMJA 3JAMU 1TL4A 5LJ3Y 3HFKA 3SDEA 2WSCC 3VTIA 1T9YA 4OZLA 1HBOA 4HHJA 4U7UD 2BOAA 5BR8F 3P8BB 3CJQA 3W2VA 3KUEA 3HHEA 4PCQA 1ACMB 3K5NA 4ICLA 4LF4J 1IM4A 3IBFB 2X1BA 4FF2A 1VQNS 4YB6A 3DGPA 3EDQB 2BNWA 1HHTP 3NS5A 3EJMA 1MU2B 4DV2J 4HI2A 1QTGA 3A3NB 2YNHB 7AT1B 2YWWA 2F5GA 3MD3A 3HKZD 3E3XA 4C8NA 4RUBA 2OPSB 1NLAA 3TWZA 1HBMA 4ZJQA 1LOUA 3QOQA 1OSCA 1YG0A 1MYKA 5E0OA 3CPWR 2J9EA 1XIQA 5DQGA 1J27A 2EFVA 2B6AA 2GIRA 2IPOB 4S0MA 1VR6A 3GILA 2BX6A 5KG1A 2R7UA 3J81Y 5L9NA 3CJSA 2LXIA 2XNQA 4GKJJ 1LWFA 2HQIA 4M5IA 5HJYA 2MSTA 4USIA 2ASJA 5LOQA 4V19J 4F4YA 1Q7LB 3VW4A 4O3PA 2MKIA 3D6TB 2LEAA 4QWEA 3MUTP 3ADAC 3ET6B 4ZHRA 3RBDA 4DI6A 4J9SA 3SFGA 4AFFA 2DT9A 3B54A 4XTTA 2UVUA 4EYIB 3MFIA 1KWMA 3HM9A 1KOHA 4CNZA 1HI8A 2YX7A 1R8AA 3OTBA 4K2JA 1QLNA 4LRVA 1SVDA 4WZQA 1SL2A 2XI2A 4DX8H 1GH8A 3RB3A 1SKSA 1ITPA 4WP3A 2JEIA 2KU7A 3D5MA 4QWBA 1GNKA 4GO5X 3QO9A 3TEGA 3OJSA 1I1GA 4K4TA 1I94F 3CCVS 3CE8A 1X4BA 3DHWC 4W90B 1C1BB 2KHDA 5L46A 2DGTA 1YJ7A 3EGWB 2ZH8A 4DX5A 1L3SA 3W62A 4MKVA 1LQ9A 1KP6A 1TL7A 3IFEA 3JTPA 3NMAA 3ZZRA 2E66A 5DRKA 2A1BA 1NDPA 4ZPBA 2GVZB 2IFXA 2KHCA 4TQRA 1RE1B 3M7VA 1VBXA 3EVMA 1EAYC 1OHNA 4CLZA 2XMKA 2B8QA 1E6YB 5KFMA 5KFOA 1IJEB 3CCQS 3RRKA 2RH3A 4NA1A 2D1CA 3TYTA 2DTJA 4TLRA 4ZMMA 1IR1A 4ALZA 3SV4A 2LFVA 4OHXA 2A2DA 2M9KA 4PG7A 1S1UA 3DGVA 3DMJB 2R8IA 5CCLA 2XQCA 5K8PA 3I5CA 2GO8A 1JKHB 2WHOA 3GR0A 2OGUA 3GMGA 1S4EA 3TNVA 3BSOA 1TL5A 1T9WA 3G5OA 3T9ZA 4ZLJA 4RW7B 2DH7A 3I4HX 3W5YA 1QDUB 3ZNJ1 4JI2J 4DWIA 4AAIA 4E98A 1PJ6A 3D3CJ 1RHQB 1QJHA 3LW5C 3R27A 2AN7A 3LAMA 2FVRA 2XO6A 4C8ZA 1LXJA 3W60A 3JYTB 2HFVA 2AGQA 4DR4F 5HI7A 3FMBA 4PR6A 5IFMA 2UUCJ 2BJDA 4QU7A 3I5AA 3IN5A 1KLNA 5KG7A 2ZC4A 1XQIA 2DNQA 4TN2A 2B3TB 1I6JA 5CYMB 4EUVA 4ES1A 4B08A 2AP6A 2FPHX 2OSQA 5AJ3F 1NRKA 3GJTB 2ZJPQ 2GJIA 2PO4A 4O44A 3OVBA 5CZVA 3US5A 4XIUA 2YWGA 5IXUA 3VWSA 3K8WA 4NE9C 2APOA 4KHPF 1OY6A 4OZ1A 5C2CA 4DL5A 4QPTA 1FO1A 1HD0A 1ICEB 1U0HA 2HNDA 1FNXH 1V5VA 4GKJF 3NRBA 2GCFA 5CYQB 3CIZA 2G0JA 1WC1A 1S10A 1LK5A 2Y0BB 3UCZP 1VDHA 5HMYA 3MM9B 4A8QA 1C0UB 4NASA 3BS9A 2ZUGA 3DRPA 1N6QB 4Y2CA 3HK2A 2DY1A 3M30B 4MKAA 2CJ9A 2WVFA 4RUCA 3MD1A 4OQJA 4OYPA 4LBHA 2HFZA 4PUOA 1XMOJ 3E01B 1WOSA 2B56A 3KHGA 4HL9A 1FRKA 3TA1A 5KFJA 1X0FA 1X4HA 1FJ7A 3AD7C 2F3JA 3EWGA 4ZVOB 1IKVB 1JNRB 1TKZB 1EQMA 1YLXA 1KVKA 4G6VB 1U0SA 2XCAA 1CS4A 3BO3A 4I64A 1NHVA 3KKFA 1Q1KA 1N33F 3TZZA 3M8PB 4C3LA 1L3UA 1ZBTA 2R3VA 1UL3A 4DV0F 4FKXA 3GXQA 4X4UA 1RDRA 2P9CA 3I0SB 2BM0A 5K5MA 3KYLA 4DS5A 2RAQA 3MMCA 4KPCA 3AD8C 2J7UA 1R3NA 2BOPA 3GYXB 1C2PA 5A8KA 2IM0A 4N7TA 2CJXB 3IGVA 1HPZB 2RILA 1H74A 4DN9A 1JLGB 1T02A 1HL6A 4KH1B 1BY9A 3ZXWA 2QGFB 4KQZA 4OJHA 1U1PA 3W7BA 4C7QA 5KFLA 2W9BA 2BUNA 2BA9A 2HRUA 4BWMA 3PY8A 3HD2A 3D6FB 3IS9B 2XY7A 2ZHAA 3E51A 3MMAA 1YHQS 1T11A 1YJWS 3U1NA 5A6WA 2XY6A 3MAQA 3HI9A 4NMXA 4AYBD 5DO2A 3UN5A 2MLXA 8AT1B 3IWNC 1U1QA 4UOCA 2F8HA 2IM1A 1FK9A 2J0SD 5K8MA 3PYFA 4FYVB 3HT0A 4C2MA 2VBWA 1QVFR 4EMDA 9RUBA 1A6LA 1O0PA 2XZTB 1L3TA 4Z7YA 4JI2F 2EFQA 3UR3C 3JTNA 3VAGA 3W1YC 4ZK7M 3K17A 3DRXA 3OFGA 3DOKB 3B82A 1GXUA 2IYGA 4CLKA 4DSLA 4H54A 4X4PA 2ACMA 1HLWA 4Q2LA 3QJLA 1HYSA 2JJ4D 2VFTA 1Q8LA 1T8EA 5B0AA 2DGQA 2GVZA 2XC9A 2RQMA 4I69A 1WHXA 1KD1T 4TY8B 2A10A 3ZTPA 1YJRA 2WVBA 2JL9A 1HQEB 3FEXB 3WC2A 3CCSS 3R5DA 4FP9A 3P5BP 1Y10A 3CJ3A 1IKWB 1KTQA 2CQ1A 2IVYA 2OEJA 1NB7A 4LJMA 1TL1A 1WDTA 3I56S 1Q0NA 3TUZC 2FY8A 1B64A 3IR5B 1Y3KA 3H5SA 2LQ5A 1JJHA 1UEKA 1ZM3A 4QWAA 3NOCA 3BPSP 4NA2A 4NXMJ 2D69A 3TOQA 4F3OA 1H38A 2DK2A 1JKHA 4RNNA 3D6MB 3J7AN 3KTQA 3D0GE 3VAJA 2XMMA 2YKAA 3HJVA 2OJ3A 1TR0A 5LT5A 4NLRA 3LOUA 4WYWA 3JSRA 2KN4A 3AAWB 2MZRA 3K2YA 2UXDJ 4KKOB 2ZZMA 4FN5A 4CO1A 4J9NA 1QUPA 2CG8A 1XMOF 5D78A 5ETKA 2K8GA 2UZAA 3OFFA 4MYTA 5DGAA 3H59A 4G1QB 2MB0B 3OBIA 3ITHA 4USMA 2J76E 3QGHA 1VYAA 1U2RA 2XS7A 2MKKA 2GJFA 1BQMB 3I87A 3BQ0A 2OELA 1YJ9S 4ES3A 2EK1A 4NPOA 4ELUA 5AE2A 2ZH6A 4P75A 5EX0A 2VPWB 1GXTA 2I9SA 1U1RA 1TZ0A 4M8LA 2O3DA 5CYMA 3J7A1 2B5JA 3A1YG 3MM6B 2VA3A 5M2RA 2FIUA 3N01A 2R7QA 4NLPA 1XWLA 4ZPVR 4LFCF 1X7VA 2CQGA 4DFPA 4F67A 4USVA 4DOZA 1CQMA 4B9TA 4NLYA 3MEGA 4Q8EA 3SEOA 1HBUB 3UD5A 5CYQA 3GQCA 4UOFA 1P27B 5K14A 1FE4A 2DH9A 4ZN1A 4QYZJ 2W4CA 1U2FA 3FCVA 1LWEB 4LREA 2Z8QA 3R2DJ 1WELA 3Q8SB 2N4DA 4UY8T 5D15A 3CVKA 4DX7A 1H72C 1TVRB 5IQ6A 3B4MA 3QPIA 4DL2A 2VFSA 3P96A 4QPXA 2A0FB 4R8UB 2FJXA 1ZZNA 1L3VA 4KO0B 2AYEA 4WXWA 1Q79A 5IV4A 1ZPWX 2KKEA 2HNZB 3E2EA 1KS2A 1X8DA 5F8MA 3IO1A 1M1GA 2BE2B 2OMOA 2VG7B 4IRCA 4IYQA 4Z7CA 5IT4A 1YRTA 4R5PA 3NGUA 3RR8A 1RCOB 2RMLA 4ECTA 3IA0A 3IM9A 2R8KA 2HBQB 4YDDB 2FZGB 3H40A 3IRXB 2YWEA 4ED3A 3QAUA 5KFDA 1RUSA 4P72A 4TYAA 1ZM9A 3RB0A 9ATCB 1UJ6A 2VOPA 4P7TA 1HWJA 2H48B 3LP0B 5C25A 2J6SA 2Z4PA 5HLFB 1JLFB 3QFWA 4I7FA 3DU5A 3RRHA 3PR4A 3M8RA 4JP8A 3ILOA 4M5MA 2R42A 2K3IA 2XHWA 4J9RA 1JLBA 3NOGA 1X4EA 4NXMF 3GIIA 2MTLA 5I3PA 1RSCA 3FMWA 5EX3A 1HNVB 2VBXA 3I82A 4ZPTR 1OPZA 4O3RA 4CLTA 4ERDA 4K4UA 2G1HA 5KFGA 1QVGR 2QLBB 4C98A 1Z2ZA 2AX0A 1HNWJ 1MMNA 4M5GA 3OVSA 3D0HE 2I2YA 2ZVSA 1RHUB 3NGDA 2CWXA 1FRMA 1TFYA 2FVPA 4MMOA 4FPIA 5CD4A 1FJCA 2ZDPA 3DOKA 4TU7A 2JOQA 1E6VB 3EZ5A 1RAEB 3U1MA 2XMAA 4LBPA 3MZIA 5FIIA 2W8KA 2HHQA 2W2QP 4CO0A 4UW2A 3A8KA 1NJYA 2AYMA 2UUAJ 3KDNA 2E5GA 3DYAB 3MMJA 4DXLA 1SUQB 2HHXA 3N5BA 3RW7A 2UU9F 1SBRA 5JJBA 2MLYA 2IBOA 3KLEA 4I56A 2GV1A 4TY8A 3R7NB 1VK8A 1R0AA 1HMVA 1YZ6A 3EGNA 2Q6BA 3EYZA 3OTOF 1IKWA 5IM0B 1SH0A 4RU2A 4NYOA 4DG1B 5H9EJ 3FFIB 2NREA 4J37A 4CDIA 5DZ7A 2MKSA 1S1VA 2HWHA 1EKRA 2CPEA 5GAGU 5CYJA 4J9QA 1NK7A 1ZAVA 4CLPA 2JWNA 1UVIA 1SJ1A 2BYCA 3AT1B 2HVZA 3KJVA 1U45A 4HV0A 4OYBA 3OXFA 4Y2IA 4WZMA 4FBTA 1NH7A 2C2DA 3SSQA 3MM5A 3T41A 1UPMB 4HLBA 2VV5A 1KVIA 1KHVA 1B7FA 1RWUA 2CQ3A 4QZVB 4CT8A 1S6PA 1R27B 3OL8A 4LFBF 2ZHOA 1VJQA 1UFKA 2Q2KA 4RNOA 4LSLB 2ZH3A 4FYXB 3FZ2A 2DO4A 2FLOA 4J5OA 4NLUA 2Z2LA 1IM6A 2E9RX 2FTRA 3S1TA 1CC8A 4K59A 2FVSA 1Q16B 2KRBA 3RRGA 3W2WA 3DOLA 1KKHA 5BXIA 4PWDB 3DCAA 4O4GB 3GIJA 4X4VA 4N8NA 1S0OA 4ECUA 2CNOB 4LF8J 1TQLA 2WZ1A 4DL6A 4C11A 2HVDA 2QRRA 1M5PC 5FLXU 1WTFA 1RWPB 2FZKB 2XM3A 2KT5A 2RF2B 4WK1A 3KUGA 2DB1A 4E2FB 2EG2A 5L1IA 1JMTA 2NLWA 3KG0A 2YKMB 1VQ8S 3MR7A 1N32J 1HR0F 2ZNYA 2HWIA 1KQSR 4FS1A 3CC7S 3TAQA 2LA4A 4DV6J 2QSWA 3Q2SC 4IDKB 4ZPWR 3AOCA 2PSZA 1NK0A 4WE1B 2X51A 2H4YB 3GFZA 2DVIA 4DMZA 1KFSA 5DG7A 1JLCA 1B0TA 2K1OA 3C16A 3BGLA 3J7YU 2GIFA 1UVMA 3T9NA 4DR1J 1Y11A 2RRBA 1KTVA 1X5TA 2FJDB 2XMJA 3CB4A 2OUGA 4OYZA 4USHA 3N28A 4EI2A 3AA8A 2R8GA 3L7PA 2R2UA 4QWCA 2GIQA 3LWMA 4MIWA 1TTHB 1XMQJ 1FWKA 1WC5A 3VAKA 3LTOA 4QU6A 2NS1B 2E5HA 1HNWF 2MQNA 3G82A 1PJ7A 5I42A 4E8UA 2DRBA 2F4VJ 4LF1A 3LF0A 2J0WA 1RZMA 2EG1A 2DXDA 5T7LB 5M2UA 2P8IA 2V8VA 1QAXA 2VG7A 2EPIA 2HMIB 4USJC 3MTKA 1RACB 3SQGB 1NNDA 1RU1A 3OHAA 3K0JA 5DDQC 2ADBA 1NLKL 4Y00A 2HBRB 2ZM6J 2V0NA 3TP2A 4LRBA 4ECYA 5E3RA 2UVRA 2R7TA 1S0MA 2UUAF 1RT6B 1FKOA 1SPBP 4DDFA 1IWAA 1GMVA 2CQ4A 4LSZB 1S0NA 1W7WA 5L9XA 1F0XA 1M5KC 3UDVA 4JI5F 1FKPA 2MGZA 4G65A 1VGYA 3RYLA 4L74A 1HA1A 4WFXA 3LP0A 4BDPA 5I4MA 4UOGA 3HFVA 1FDNA 1TKTA 1V5IB 3K58A 4RKUC 3DFEA 3UD4P 4F4AA 4XPCA 1T7PA 2HYIB 2XS2A 3WDOA 5J2QA 3IGNA 2HNYB 4DR2F 3DRRB 4FXDA 4F2SA 1FXLA 1WWHA 3UCGA 4M5LA 3K7RA 1LW2B 4J9LA 3JXOA 4BHQA 4F0MA 1HNVA 3DNCA 4N41A 1N5YB 1Y00A 4FPRA 2JLGA 3M2RA 3M9OB 1RHKB 1BQXA 1T9UA 3MECA 3AQPA 5DS7A 4B3MF 2HFNA 2IC3B 3AH6A 2C2EA 2AJ0A 1CJTA 2RQ4A 2V9WA 1NDLA 3PO4A 4H4MB 5I3QA 3R6GB 2RKIB 1BHNA 1LWXA 2FC8A 3CDBA 3CJRA 1AZSA 3KXDA 3HSJA 1DTTA 2RUGA 2AJ4A 5HBMA 3TARA 3D9BA 1WSRA 2LU1A 4LF6J 2RRNA 1N0UA 1D0EA 3POTB 1RAHB 2YVSA 3LALA 4Q44A 4G1PA 1S4FA 3MR5A 4MK9A 2OAUA 3AJDA 1ZYQA 1ZH5A 2AGPA 3OW2R 3T3FA 4QYZK 4O3NA 2CNKB 4YR0A 3M2UB 3DYAA 3EDRB 2ZVIA 1PO6A 2EBEA 4ZVQB 4A47A 2YX4A 5CD4H 4DR5F 1U48A 2BJ8A 2JEFA 3QGPA 1RK8A 3CJKB 4B3OA 2VBZA 2PEBA 5GAGI 3H5XA 3U27A 3C19A 1N32F 3H2LA 5GADI 3TAMA 1SQGA 4DSIA 1CULA 5IM0A 4I68A 1TKXB 4DV6F 2NYIA 3BBFA 1SC1B 2K9IA 2RQKA 3L4BC 5GAEU 2H51B 1BDVA 4D3GA 4ER8A 1CPZA 4NRTA 4KYZA 3EE3A 3VGVA 5D3GA 2GMHA 1A9NB 3OXGA 1FKAF 1VQOS 3K59A 2QFIA 4BCAA 4PABA 3JB9k 3H5YA 1P1LA 3LH2S 4DR1F 2BANA 2E7WA 2AD9A 2LDYA 1FJEB 2DNGA 3KNGA 3AFGA 4JV5J 2ATLA 3C2PA 2F4FA 1NPKA 1BWVA 2LP4A 2CPGA 5KFQA 1VQKS 3O8WA 5C42B 3R6LB 5KG5A 1RCXB 4I2PA 5JVHQ 3TANA 1U1OA 2XMTA 4AD6A 1XMQF 4UOHA 1F60B 3DM2A 1B4SA 3BGRA 3Q8VA 3LO3A 1Y9OA 4K50A 1RT7B 4QIEA 3G4SS 4J9OA 1JXEA 3KHRA 1B0PA 2CQIA 4NLWA 1FJGJ 4O3OA 2XEXA 1WDDA 2BE9B 2CPZA 4AUKA 2CZVC 1MG7A 5M2PA 4LRDA 4YR2A 4KGMA 4C8OA 4J9KA 1HI0P 4IFVB 5B0BA 3OFEA 2B8PA 1QE1A 3ZTRA 1WOOA 2OPRA 2M4MA 1RBAA 2K1RB 4ZIVA 1VQLS 3TX8A 1FVQA 3X1LB 5B0EA 3MEDA 4NX9A 3ENAA 4EYHB 3HLUA 1FI4A 3C6TA 3R3TA 3DLKA 1S6QA 2MZJA 1S5ZA 2O5DA 4I1TA 3MPWA 1RKJA 4YR3A 4C0OC 2LA6A 2R7VA 1NHKL 2ZOGA 2V63A 3FCWA 1LNQA 1NSKL 2BW2A 2LEPA 4WE1A 4NCAA 5JVGQ 3QT5A 1TMMA 4K4SA 3H2UB 3I96A 2CKWA 3M2VA 2RS2A 2PFFB 1UCNA 4IH5A 3PX0A 2CQHA 2P5VA 2XULA 4F50A 4DV7F 1BQNB 1VQPS 4DPXA 1QSYA 2KH9A 1VC5A 1PARA 3KLHB 1YRUA 3AOAA 3BGUA 4CO4A 2MQQA 2BJ1A 5KFHA 1IRQA 2CA9A 3MHYA 5D77A 3LWLA 2DGUA 3KJNB 4WTOB 3DI6B 1VLOA 1CJKB 4KGXB 5IC6B 2IDLA 3NXZA 2KG1A 4NI2B 4RW4A 2Z2MA 4I6WA 4I6AA 4DR6F 2D9OA 5GAHU 4MIAA 3LP1B 4IO9Q 5HVFA 3CCTA 3SXLA 1VI7A 4U7UK 4KIAA 5A76A 2Y0SD 1SIWA 3EGZA 1R0CB 5E7OB 1OPIA 3VAIA 5H9EK 3VVTA 1F6TA 2ZE2B 4F0KA 3SZ2A 2NXJA 1JNZB 1FRXA 2DXEA 5AXNA 3HVTB 2R7XA 4RNFA 3MXHP 5F8NA 2ZFHA 3MGJA 2QTWA 1NXIA 1A7GE 4NXNJ 4RW6B 1ZAWA 4F36A 1PC4A 4UZBA 4K8RA 1RT6A 1WSVA 3J80U 4ZVSB 1HBNA 2PDAA 2AF6A 3L9ZA 2O66A 1NUEA 3DLGA 5L1KA 5KG4A 3Q89A 4QR1A 2WAQD 2G4BA 2M2BA 1PYSB 3PEJA 5HMWA 1KHWA 2OFHX 2HGNA 4J9UE 4PWUA 2YX1A 1GMUA 4KJIA 3A8EA 1FRHA 4F3MA 5FD1A 3RTVA 2KVIA 2LQJA 1Z2LA 2AEJA 2QMXA 3GSDA 2FJAB 2D3UA 4ECXA 3TEHB 3KK3B 1QTNB 3AJ1A 2EW9A 3NAHA 1M0SA 4F3QA 1KR4A 3KMQA 2DEIA 3N6MA 3MOJB 2VH7A 1QAIA 4JI8J 3HSZA 1N5YA 4JV5F 2AEMA 3DLHA 2JFKA 2IC3A 3RB6A 4R0JA 2W9AA 1TUVA 3IR7B 4L75A 2YWHA 2CDRB 3NBPB 1YJVA 4WYLA 2CPJA 5CA5A 4P52A 2G2ZA 4UUWA 1RTZA 3PACA 1P8GA 5B0FA 2C3PA 3HZEA 1JQGA 1SV5B 3NG8A 2BR0A 3VCDA 3OXLA 2M52A 5FLXY 3T1HF 1WG1A 1WC3A 5E3QA 5GAEI 1Q78A 4ID5B 5KFUA 4OHVA 2DYAA 3RAXA 2DRAA 3CIMA 1NBEB 3I5BA 4JI7F 3KK1B 5E3CA 3GSIA 4OYIA 1Q82T 4OX8A 3DOMA 1RT5B 6FD1A 1OWXA 3NCPA 1G4CA 5D0HA 1RT2B 5U47A 4URGA 1UWBB 2QLXA 3JSMB 2MQOA 4U8VA 2PIIA 2V2QA 2XSJB 2IAJA 4RBVA 2MY7A 2XO7A 3QWPA 4CM2A 4ZVPB 2UUBJ 2CAXA 3P6YC 2MMYA 4DPWA 2FGCA 4NLVA 4FXWA 1RAGB 1QTMA 2QYGA 4KFBA 4GMKA 3MR2A 4OYAA 4HH0A 1C4CA 3BB5A 2QA2A 1JB0C 5A8WA 3W61A 2YTCA 2QA4G 5T14A 3MEKA 2FJVA 5KFWA 5A8RA 3S8SA 3UWTA 4ILLA 3BO2A 2DNYA 1N34J 3MR3A 4YY3J 2VF3A 2G9OA 2EKNA 3DDNA 2KOEA 2QN6B 2LQ9A 5B0CA 3MR6A 4K4YA 2NXEA 2XYHB 3MEEA 1MNEA 1FHTA 2OSRA 3CMAS 2ERRA 1J5OB 3UNYA 2AU0A 5KTQA 2B4PA 3M32B 2VFUA 4WPAA 3GFYA 4YQWA 2FJBB 3KG1A 4OIXA 3O44A 1FERA 2FHJD 1N56A 2HFSA 1AFIA 1I51B 3MAAA 4F4ZA 4FS2A 2CDQA 5D6GA 3AQOA 4DV5J 4L6V3 5F8LA 5ETNA 4L3NA 2I5JB 2HS4A 2MYFA 4KH0B 1DTQA 3DLEB 3VAMA 3PYEA 1VC6A 2AZ3A 1QY7A 1CJVA 2C22A 3A8IA 5IT9U 3DHXA 4OI3A 1FD8A 1RYRA 3OLBA 3KK2B 2PGCA 2V8HA 2KRRA 4ATNA 3A4TA 2VUGA 2OTJS 4X64J 1T05A 1X0PA 2F1FA 1N5VA 1JJCB 2CUYA 3OT9A 1NJZA 4MJWA 2IA6A 4HI1A 4ZVGA 3FRYA 1HNXF 4F02A 5J2PA 2OHDA 3RW6A 4M5DB 1U6BA 2DRDA 2VB6A 1REVB 1XR5A 2V5HG 3PX4A 4IG0B 2WSEC 3QYYA 3WIUA 3HO1A 4ED0A 2X3DA 2IMOA 1S1WB 3ZZTA 3MM7A 3M6XA 2DR5A 3ZZPA 5GMDA 1UA1A 3TAPA 2MZQA 3DI6A 5F3TA 1N4LA 1U1LA 1EARA 2BABA 4YHHJ 4KHRA 2B9EA 4FNIA 3OTDA 1EQ0A 3HSGA 5DG9A 4LT6A 4P7VA 2ASDA 3DKDA 5EHHA 3MCSA 2J8AA 3QIDA 3GG1A 2VKZG 2KXHA 2ZBIA 2ZJRQ 4ZVTB 2OFGX 3GWCA 3UDEA 3M1VB 2N3OA 3SFUA 3AA9A 4LF7F 4ILRA 1TV6A 2IMWP 2RDJA 5CXTA 3CJ0A 4OX9F 3PJXA 4DUZJ 2DGOA 5F3ZA 3M8WA 4KTQA 4ELVA 1NZ8A 4IR1A 2YKPA 4X4SA 1H6KX 3GCXP 1GMWD 3ZZ0A 1Q8IA 4HKQA 2C2KB 4PXBA 2BJEA 2KG0A 2GAGC 1FDBA 1CJUA 3C8YA 1BLUA 2QMUB 1FD2A 2C2NA 3FBFA 1FEHA 5IQQA 1U02A 2IRUA 4Q5VA 3TX0A 1SH2A 3DN9A 3IP0A 5HANA 5HROB 2VOOA 2GJ2A 6AT1B 2HLUA 2LXUA 3MTJA 2IJRA 4Q43A 3D28A 1HNZF 5LM7E 5IZHA 2B0GA 2L48A 1N48A 3TO8A 2DNLA 3F0NA 3QLHA 5DDOC 1TK0A 5IWAF 2YPZA 3H5UA 1PYTA 1VQ6S 2DIUA 2C2RA 3A12A 2R2SA 2E7VA 3B4DA 2VQEJ 5F9NA 2COLA 4UTGA 2GVDB 1EHWA 2V4JA 1WHVA 1SJFA 1XERA 1NK8A 1N34F 2CZ4A 2FY1A 1RT3B 1RT1A 1B3TA 1DQ8A 4OYWA 4NLDA 2JLEA 3NBPA 3FQKA 2K2PA 5FDLA 1PBAA 5LL6d 2W2MP 1HQUB 4XO0A 2KFNA 4N77A 2CJYB 1S79A 2Z58B 1GTEA 5EWGA 2B51A 2R7RA 1FWLA 3J7Z5 4HHUA 1LW0A 2HHWA 1SV5A 4DBQA 4CYUB 2WW4A 4JI1J 1OY8A 2AW0A 3A3PB 5EUHA 1S9FA 2RVJA 4ID5A 4IR9A 1SC6A 3MM8A 1N5QA 2B4VA 4DV5F 3MFHA 4BBYA 1T3OA 2HQFA 1H0HB 3C14B 2H9ZA 1R8HA 3PM9A 4YP3A 1VQ5S 3HX9A 2KFYA 4WWSA 2E1RA 2ZITA 2C3YA 1RTHA 3CCRS 4CT9A 1UWBA 2FB0A 2LKZA 3BN4A 1SJ4P 4YMEA 2JNJA 4WF9Q 2LCWA 5I3UB 2FDNA 1S9GA 1UAWA 3V6DB 4OI6A 3D67A 5D0EA 2FHMA 2IA0A 1M5SA 1FX2A 2PI4A 4R25A 4GC6A 2MKHA 3V81B 3HHNB 1S1XA 2HBYB 1YSJA 3QGGA 1MMLA 3TZWA 1R6YA 3CW2C 2IY5B 4C9DA 1HW9A 1HARA 2DR9A 1PAUB 1CC7A 2DITA 5ADZA 1HWKA 3MWBA 4V19X 2YNGB 1NK4A 2HFUA 1ZAXA 4ENOA 1X9SA 3EPGA 2W7OA 3R5CA 4H4OA 4WIIA 3IXQA 2JH3A 2OPQB 4Y65A 2KO1A 1TK5A 3CJ2A 3VHQA 4QYRA 4DFKA 3DRSA 3RZAA 4B17A 4L73A 2XGPA 1F5CA 4QW8A 1NEEA 2MSSA 4RW9B 2AZ1A 1OYEA 5F9LA 4LRAA 1N52B 2L9WA 1TELA 3IC1A 3H2VE 1UEVA 2DBBA 3J80Y 2BJ3A 2KVQE 2I5JA 4DSEA 1KVJA 1XN9A 4KC5A 2HWTA 1Y5LB 4DUZF 2CPFA 4DCOB 1S72S 1UETA 2GZOA 2KI2A 2IHR1 2IJNA 3LP2B 4NA3A 3GFHA 3R5JB 4IFYB 1Y7PA 2QL9B 3IBWA 3M8QB 1T03A 4K0KF 3LGNA 1JLAA 3QSIA 2OH2A 3GONA 2VKRA 4Y2KA 3TZYA 5F41A 3CT9A 1FVSA 3BSCA 3TJAA 2XZDB 4PG4A 4ID8A 4WCEQ 4CTAB 4M5DA 1G6BA 1LWCA 2E5LJ 2EFPA 1U09A 1X4AA 2JX2A 1REVA 2H1YA 1M1HA 2WRMA 5ETPA 1EETA 1TL3B 1S9EA 3D7SB 4IG0A 2UVVA 5J1EB 2LYVA 4J9PA 3TVZA 3MURP 3NWGA 2VQEF 2VC1A 4FXVA 4W92B 2FYXA 2V4RA 4DR4J 1R89A 4ZP9A 3VEBA 4N76A 1RXOB 1NSAA 2CADA 3BDPA 4AQYJ 2R8JA 1DBDA 2D3O1 2BZ2A 3R7SB 2NSBA 2ILZA 1OQ3A 1F2GA 1T9TA 1NJIT 2QL7B 5AJ3J 2DNKA 4NL5A 2JVRA 1RHMB 4WJBA 3L3CA 2HFOA 3M1VA 4X2BA 1AXQA 1D3WA 3RGIA 1ZM2A 3D3BJ 2JZ5A 1YJNS 3H4DA 4KHPJ 2WB1D 2BXJA 2X3GA 1RAJA 1MLAA 4CLLA 3N5FA 4JI1F 1VRUB 2CAJA 2YY3A 4JV0A 1YI2S 1O51A 5G0RB 4ZVHA 3QIPA 2ROGA 2W4PA 4EBDA 3AB2B 3FSIA 4X62F 2GQ2A 4B3TF 4C8YA 1FT8A 1HHSA 2R7WA 4F4WA 2MLZA 2UUTA 3QWUA 4ED5A 2BQUA 3CC4S 1BE4A 1UZDA 2CQDA 2E5IA 3MI7X 3MCMA 4J9VA 1OYDA 4KV8A 2HEKA 1IKYA 2AMCB 4A8KA 5MLCV 4DR7F 3C6UA 3I0RB 3JS9A 3EGVA 4C97A 2YNIB 3GG0A 4HDGA 2W9CA 2K7JA 2I6WA 5J2MA 2CQ2A 2WOMA 3GR1A 3N9UC 2FD2A 3EMTA 3HSDA 5DLFA 5D4NA 1S7IA 1N33J 2OD6A 5HP1B 2GGPB 1VK3A 4DV0J 2DNRA 3BF4A 4C8MA 2R8HA 1AUDA 2HVIA 3TVKA 1RTJA 2JXHA 2FZCB 2YNFA 2Q6CA 3CD7A 2H54B 1S1TB 1SJRA 5DLGA 1UFLA 1JXLA 1HQUA 2CPIA 2OIHA 1F9EB 3OR2B 3QRPA 4EO6A 3HHLD 4ZLNA 2ZNZA 3S01A 3M6WA 4J7CA 3V6HA 1KLMB 3FGVA 1R0BG 4FF1A 1UEUA 4PZVA 2XYPB 3LUYA 4NOHA 1N36J 3PHTA 3P3DA 3HHKA 5ETVA 1C1CB 3CUNA 2IYIA 4I67A 3NGSA 3FEZA 2LMIA 2ZWOA 4GVBA 2LDIA 2KXFA 1UWAA 2RE1A 5HL7Q 1HHQA 2OPPA 5KOXA 4UZCA 5CAAA 1TAQA 4PG5A 1BC6A 5KFRA 5A2QU 2NR0A 2M70A 2RU9A 1VQYA 4PPZA 1KSPA 4B9UA 2CPHA 4IOBA 3KFWX 3DC2A 1QUVA 2EKYA 3CF5Q 1NM2A 1FRJA 2N82B 2E5LF 4KT0C 3L09A 3QJJA 4ED1A 3R9LA 4NCGA 3ONQA 1Q53A 3CEDA 1PJ5A 3NL0A 2AV5A 4CO3A 1Q86T 5HQMA 1SI9A 3HMJG 1M5OC 4JI4J 3TA0A 2N7CA 2XSFA 2QL5B 4FXEA 1TP7A 4EGLA 4PQUA 1GQEA 4J9MA 3JTOA 3D68A 4DLEA 3K5OA 3MPUB 2GS8A 1O5JA 2NUUG 3GFXA 4M63A 4AQYF 1NMEB 4CRJA 4U67Q 1O8BA 2V2ZA 2JC0A 4OHZA 1MROB 1UW4A 1JJ2R 4PG8A 1IKXA 2OPQA 4X4RA 4XAKA 3PYDA 2U1AA 3VQSA 4O3QA 1URNA 2AQ4A 2AYGA 2G13A 5C7PA 2GNKA 4JV1A 3BBBA 2MY8A 1IVZA 1NPRA 4N8OA 2Y3YA 1RT4A 1RTDB 3QQCD 3HJFA 1WJ9A 5LSRA 1BDTA 3J81U 1RADB 1NDCA 4GO7X 1I3OB 2VBYA 5AXMA 3CNQP 3LP2A 3K5MA 5HSPA 4TQSA 3CXCR 3EICA 2IDEA 3KLFA 3G71S 2FGOA 1WUUA 3V4IA 5DJBA 2O1PA 2MZSA 3FCHA 1B99A 1IJFB 5J2NA 4X4QA 2V94A 1RTIA 3R7BB 3OR1B 2R7OA 1NKCA 1JLQB 1D8ZA 4AL6A 5EWEA 2UVWA 4RW8A 4TYBA 5IT0A 2XMWA 1FRIA 2KT2A 1NK6A 2AX1A 4QIFA 2IJFA 1QAJA 2E7XA 3M05A 1DQ9A 5L1LA 1DHMA 4BS2A 1TL3A 1F3FA 1ZTWA 2OEKA 2OO4A 1K1QA 3LGHA 2WONB 3PW4A 4QR0A 2MKYA 1FFSB 4H4KC 4ETXA 3R5AA 4K7QA 3FEYB 5EWFA 2DGSA 1U25A 1MU2A 1P1TA 1WG5A 3V2UC 2HRYA 3V6KA 2ROPA 2YNHA 2BSQE 4I2QB 4QIGA 2HAFA 4K5SA 3NP5A 2HZAA 4ZKAA 5FJ4A 3NWRA 1ELOA 4J90A 4DV1F 2OPSA 3ZO7A 3G8SA 1AROP 1KQKA 4LFCJ 4DLGA 3RAQA 4RPFA 1IQTA 3UW1A 1F5AA 3K8VA 5DZ6A 3HFZB 3IG1B 5A0YB 4DV4J 2NZ4A 2A3JA 2PC6A 2VG6B 1N36F 3BR8A 4DU7A 1LXNA 4GRSA 4P10A 3BPDA 2LXFA 2V2VA 3ET6A 5LMUF 4HVZA 1VQ7S 3T1YJ 2XB2D 4MFBB 1U24A 1EP4B 2QYCA 1N54B 2LQ8A 4M5NA 5HQ8A 3MOZA 3CSKA 2DR7A 4HTIA 1CVJA 3RUBL 1YBUA 1ZA2B 3VF0B 5E33A 2XBPA 4ZCKA 5KFBA 2KDOA 1IWGA 4BC7A 4ZLPA 2YKQA 3D6HB 3ENWA 3SDEB 4RWWA 1A0OB 3FQLA 1HBOB 2M88A 1RB0A 4OZ3A 1FTRA 1RBLA 2CYYA 4A46A 3W2VB 3BGFA 1NO8A 4ICLB 3DRYA 1HFEL 1NAQA 1WEYA 2Y1LB 2VA2A 3DGPB 5HN0A 1C1BA 4C3MA 1M5VC 1WORA 4JI4F 1JX4A 3L7OA 5B0GA 4ZPDA 2NUHA 1MWYA 4KB7A 4OJ1A 3BV8A 3KWMA 3CJ8A 3AJ2A 3PIOQ 2QLJB 3H90A 4ZS6A 1WG4A 3M8YA 1HBMB 3VQTA 4JOUA 2Y1JA 4KAIA 2AKWB 1M5HA 2HQDA 5D0RA 3FUYA 2B6AB 1E6YA 2ZUAA 1VIOA 4YB5A 1KLMA 5HATA 3CCZA 4OX6A 1HKAA 3BQ2A 1PBUA 3VZHA 1FXRA 3CCLS 2RSQA 3RU0A 1LWFB 1QSSA 2V50A 3CJ4A 3HPOA 2GC8A 3Q22A 1MMDA 3ISND 3D1QA 5KT3A 3KNAA 3GLJA 1BUXA 4C3KA 3FBBA 3DMJA 4NYPA 4ZHRB 4URQU 2BNZA 3CO9A 4NLTA 1RABB 3CTRA 4XPEA 4ZP8A 3NNAA 3BN7A 3QJPA 3ILIA 1PKUA 3MDFA 4Y3CA 3JAMY 4B3RF 3PRBA 3VGSA 5IV3A 3CC2S 4RX6A 1YTYA 7FD1A 5KFCA 4RW7A 2FUG9 2MQMA 3I9V9 4M1KA 4DQPA 4FKYA 2ROEA 1IUJA 3Q8UA 4Y28C 2LLZA 4N47A 1FXDA 3DLLQ 1ZETA 4USKA 1DJ0A 1KONA 3UFCX 1CSJA 3RG6A 4LR8A 2K06A 2W1BA 3NMRA 3JYTA 3G87A 1EB0A 5J1PA 4NZ6A 2L08A 2QLFB 4CQ1A 2DPJA 2HSEB 1TL7B 5ETQA 3H4BA 3ZTQA 1XBWA 2E1AA 2ZEJA 4KHMA 2HQGA 2CWKA 4BC9A 2UU9J 1S49A 4JI6F 4ED7A 4OI4A 3DU6A 3GIRA 2AWZA 3FKBA 4UUXA 4WKYA 3B6BA 1FNMA 3OTOJ 3W8GA 2DNNA 1BWEA 3CCWA 3ZTOA 3FBEA 1W26A 3BSAA 2K29A 4LRFA 2XZWA 2J6UA 3JSBA 4YDXA 4PAAA 4RLEA 1Y5IB 1EA4A 4ZP6A 2J0XA 4DS4A 1TUWA 1S1UB 3L95X 3MMBB 4F8RA 3KHLA 4DV4F 4X4TA 1S6UA 5KFPA 1S77D 1G3OA 1PC5A 2POKA 1KQFB 4M95A 3CDAA 1B70B 2QA4S 2D3OR 5DQIA 1RAOA 2JVOA 2D7SA 3N79A 2E1CA 5ETSA 4P74A 2X1FA 3FMTA 2UV8A 4JI3J 3T1YF 2HAIA 3MM9A 1C0UA 4CLUA 2V69A 5L39A 2K6LA 1N6QA 1IBMF 1V3RA 1Q5YA 1S59A 3M30A 5AE1A 4Y2AA 4HHHA 2BJ9A 1YKWA 4LFBJ 1AW0A 3BH6B 4DJBA 1NJXA 3QRQA 3E01A 3THVA 4KGVB 3Q2TC 3D2WA 2D74B 2HQ3A 4ANEA 4F04B 1S6OA 1IKVA 1SKUB 2AJ2A 1TKZA 2AJFE 3C46A 3PKYA 2RHSB 5BYRA 3PCOB 5KG3A 3UO0A 2ZDOA 2XMUA 4CH1A 2XYGB 3M8PA 2C28A 1UMJA 5CH7B 4LRCA 4Q8FA 3KOAA 2JDJA 1NK5A 1GX6A 4I2QA 4DL4A 3I0SA 1KFDA 1X4FA 1YZ7A 2R9LA 3HF5A 3TVYA 2J8SA 4GKKJ 3Q8YA 4B9LA 1HR0J 1N8RT 2CQPA 3KJQB 2HHTA 4PRFA 1HPZA 4O44B 5GMKa 1JLGA 1SJ3P 1WF2A 1BGXT 2OD4A 4G3IA 5KFSA 4F7VA 2WBRA 3Q8QB 4ECSA 4CZCA 4CO5A 3IG1A 1TAUA 2I1RA 2HNDB 1BMQB 2ZH5A 2CVIA 1NPPA 1RJJA 4DV3J 2ZH4A 3M4XA 4WU3A 3LGMA 2MQLA 3IS9A 5A2QY 3NCQA 4HDHA 5HAOA 1SIZA 3BR9A 4ZVEA 3DRPB 4WIQA 3IMQJ 3TZXA 1X5PA 1S76D 1YVFA 1IBKJ 2M3DA 4WXOA 2PFDA 1BAZA 5L8RC 4PUOB 5HO4A 3ZZOA 3PX6A 1SB6A 4ZJOA 1L3KA 4MTPA 4ZLLA 4Q0BB 4CLYA 2H5JB 2LU2A 3EPIA 2CPXA 5E2QA 4AL7A 1AA1B 4OX7A 1IBLJ 2NPFA 2VD3A 1ZTTA 2XI3A 4KR0B 1CS4B 1RQ0A 2OI2A 4CIOA 2VONA 4O3SA 3FJ2A 1WI6A 4FDFA 1AYEA 2ALZA 1QAYA 3OL7A 5KT7A 2DNZA 4CP5A 2CJBA 3MMCB 4OZJA 5D4LA 5ETRA 5F8GA 4JBCA 2EC2A 4C48A 5A8KB 4TY9A 4JI5J 1HQEA 3PDNA 2QA1A 4EZ9A 2K3KA 2J9DA 2K5JA 4B9NA 1EIYB 1JWWA 3Q83A 2W9BB 2G1DA 4ELTA 1SXLA 4DR2J 5KFXA 1X60A 1WKKA 4F4XA 2YQ1A 3MMAB 4LQ9A 3ZNUA 2KELA 5GADU 3FC9A 1NDKA 1V3ZA 4QW9A 3PW2A 3T5KA 4ANDA 3UCUP 2RHQB 3ENQA 4JI3F 2GW8A 4DSJA 3QGIA 4B3MJ 1FK9B 2DGWA 5KT6A 4V1Ak 2EI5A 4KKOA 4X66F 2B9XA 2C2MB 3W8PA 1H73A 4LF5J 4DL3A 5K9FA 5K8NA 1WI8A 3KJFB 1VQ9S 3JSYA 2GHVC 2FLNA 1K47A 1H2VZ 4G1QA 2ZBCA 5L1JA 1H7WA 4LUBA 3DXBA 4WTYA 1VLYA 1B01A 4DCPB 1BQMA 2X7IA 1M90T 2YWKA 4HEA9 3R8YA 1OS5A 1H98A 1HYSB 1D09B 3M6VA 4U7CA 2EXUA 4DR5J 3AXKA 2N3LA 3OTEA 3MUMP 2J9CA 2ZC3A 3MM6A 4X84A 2GA7A 4GKKF 3IBCB 1MW7A 3SCJE 3UDLA 4RL1A 2SXLA 3LPEA 2CJKA 3NY0A 2X1GA 1U6FA 3PO5A 2QG9B 4ZVFA 3SCIE 1TL1B 5ITHA 2NQPA 2WK4A 3VZIA 3K57A 2GPEA 2HHVA 3OPKA 2C42A 3MMBA 4P2MA 1F9FA 1HBUA 5KFZA 2CPYA 1IXKA 1F1BB 3AODA 1EKSA 3UN2A 4DV3F 1VQ4S 1KDNA 1LWEA 3O1LA 4CO2A 1VRQC 3ETMA 1UVNA 4F4KA 4FVCA 1K44A 2BKNA 3TQ1A 1TVRA 5G4DA 1H2UX 2VPZB 3TI0A 4B9VA 2I8EA 4OMFG 1UPPA 4R8UA 3GYNA 1IBKF 3VAFA 2E1PA 4LSNB 3SI8A 1U1KA 4KO0A 3IAM9 3Q86A 4DUYJ 1CLFA 3R5GA 1VIXA 5D4PA 2HLTA 3HKWA 2HNZA 3G6ES 4C8LA 2VASA 3W64A 3VV2B 2YH0A 2PMZD 1U8WA 1IN0A 3ITHB 2IRYA 1BXNA 1TU0B 2BE2A 4LF4F 3R1HA 2OMLA 3PHEA 1RWMB 4A8MP 1IBLF 1Y0HA 3M6UA 2HHUA 2JXIA 4EK2A 1GAOA 4URSA 3GU0A 3CDWA 2V2KA 4DQQA 4DN0A 1AT1B 5E5NA 4DV2F 3AB4B 4HYKA 3FT7A 2R4FA 3W9IA 4IG3B 2B5JB 3IRXA 4LR7A 3D0IE 3R5BA 5KFAA 2ZKTA 2C2ZB 1JJ4A 1F9HA 3PZPA 1YGYA 1RKIA 3CGIA 4CI0B 1FWPA 1JK9B 4DU8A 3BYPA 5ETOA 3NAIA 5CABA 3DDIA 3MEGB 1ZOTA 3BH7B 1NCLA 3AHPA 4GC7A 2D41A 3PYGA 5HLFA 4ZIWA 1JLFA 3KMSA 5K14B 4DV7J 1KQGB 4PWWA 4PXEA 2B4OA 3RBZA 4YS2A 4PKDB 1H7XA 1IBCB 5H9FJ 2A2BA 5B08A 1YBAA 3HP6A 1F2HA 2DXFA 3PFEA 3QZ8A 5E3AA 1W2IA 1PSDA 5E41A 4FNHA 1HQ2A 2WBMA 4LMZA 5EDWA 4DR6J 4TU8A 1K9MT 5B7WA 1SQEA 4W98A 5IOLA 2H65B 2BRLA 5D4OA 4Q0BA 5HVGA 2DHSA 2YPYA 1VRTB 4W4MA 3UN3A 3QMQA 2FC9A 3N6NA 4KPYA 3F44A 3PFOA 4LF5F 5DG8A 1AUSL 2AYBA 5BYQA 4EU0A 4WFAQ 1PG5B 3BSNA 3N0VA 5B09A 1PCAA 2DNMA 4R5PB 5JMNA 2EC0A 1E6VA 2MXYA 3CULA 4JYAJ 2GQCA 4AL5A 5F8JA 2ZZNA 3AOBA 4DF4A 2F8MA 2ZJQQ 4AXJA 1ZPVA 1SUQA 4M5KA 4A8XA 1FA0A 4USWA 3HVWA 1GX5A 4P2FA 3I31A 4RUAA 3O5TB 4Q2MA 4KRWA 3IRWP 3K89A 2Y1IA 3CD6S 5C25B 3TW0A 2LEBA 4DG1A 2NCKL 4RWXA 3OSNA 3Q8RB 4I7FB 4M5HA 2DHAA 1NB2A 3FFIA 4OL8A 1RA6A 1KBRA 3ISZA 4QQBA 4P73A 1JLBB 4DCJB 5AE3A 3KLGB 1T0TV 3SMZA 3PG9A 1GK8A 5BJRA 4QIWD 4KBIA 3MPVA 1YJTA 1FE0A 1PYOB 2RS8A 3FZBA 2PI5A 4Y34A 1B0VA 4YB7A 1MWZA 1D9FA 1TUGB 2F8EX 4TVAB 3O3LA 3AD9C 1XNRJ 1WHYA 4K2XA 5F0UA 2FHOB 3BZQA 2KYZA 2PMHA 2BVZA 3NS6A 3SQOP 2F9JA 3WX4A 1YITS 4DUYF 1WHWA 3W9JA 4LSLA 2W24A 4ZCMA 3BEGB 2IRXA 4ZOSA 4MYUA 1GXLA 4LBIA 5DETA 2KJWA 1Q16A 2HGMA 4IQXA 1AB8A 1WF0A 2P6TA 4QBUA 3NGTA 4PWDA 3T1HJ 2V6AA 4H4KA 4O4GA 2YQ0A 4EEYA 2WVDA 4XK8C 5HK4A 2QE5A 2V4QA 4TNOA 4OYMA 2UUCF 1IQZA 4FYDA 2KKHA 4JI7J 1K0TA 4YN3B 2RF2A 1R8CA 3PJWA 4C6AA 3J7ZT 5LSOA 1L5UA 3KLEB 4IQMA 4EZ6A 2YKMA 1R0AB 1HMVB 4I6YA 4U95A 3GCWP 3HCXA 3T1AA 3WC0A 1D9DA 2YKNB 4ECQA 2DO0A 4IOAQ 2FJWA 1VFJA 2CJQA 4IDKA 4LF9J 2VJUA 2MHNA 2KFZA 2QC3A 1I5OB 1GFWB 3NO7A 2A18A 5C5JA 2BKOA 1APSA 3RBEA 1R8BA 1S1VB 1B28A 2OEMA 2OP5A 5K8OA 1EJ7L 4QIVA 2JXGA 2PN6A 4KY3A 3LAKA 1NJWA 5E3PA 1B7YB 3ZFVA 3W9HA 2W7PA 3VAHA 4R0EA 5DDPC 3CCES 1RBOB 1FESA 2MJUA 3KJVB 1UKUA 4M5JA 2VJVA 1DAXA 4A8SA 1NSPA 3P49B 3MM5B 1DY3A 2MPUA 3D54A 2MDAA 4ILMA 1O6XA 2NZCA 4LSNA 2HS0A 1S6PB 4BLGA 1U2CA 1UJ5A 3A8JA 2HBZB 3OQ2A 1FRLA 1X5SA 4M94A 2GHPA 2VC0A 2DR6A 1YWXA 3UVJB 3W2WB 3DOLB 3TR5A 5T7LA 2RU3A 3R2CJ 5DDRC 1VBYA 2HMIA 3WZ0A 2MZTA 3SQGA 3WBZA 4Y2MA 5LXRA 4C11B 3W5ZA 3BDEA 2MKJA 4AT1B 4JYAF 2B9YA 3GV8B 1VQMS 4P2XA 5L38A 4IG3A 1R31A 2RJZA 2OLWA 3FDSA 1VOMA 1H2TZ 3CO0P 3R1LA 2QT7A 4P6QA
chains in the Genus database with same CATH topology
2CAXA 3BKFA 1NLAA 2JXIA 1Q5YA 2CAJA 3QOQA 2FGCA 1MYKA 2BJ8A 1BDTA 2WVDA 2JXHA 2BJ9A 2GPEA 2BSQE 2WVBA 1PARA 2NZCA 2HZAA 2BA3A 3FT7A 1ARQA 2BNZA 2WVEA 2BJ1A 1IRQA 2CA9A 4HV0A 1P94A 2K9IA 2F1FA 1BDVA 3GXQA 4ME7E 3VW4A 1MYLA 3VEBA 2K1OA 3BKTA 2RBFA 2K29A 4FXEA 2CADA 2BJ3A 1Q5VA 1B01A 3OD2A 2K5JA 1BAZA 1EA4A 3H87C 2BJ7A 2H1OE 3PHTA 1ARRA 2PC6A 1U9PA 3BKUA 2BNWA 1B28A 2AY0A 3QSIA 2WVFA 1QTGA 2JXGA 3VEAA 4D8JA 3LGHA 2CPGA 2KELA 1MNTA 3FMTA 2Y3YA 2WVCA 1X93A 2HZVA 2K6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAX A;  3BKF A;  1NLA A;  2JXI A;  1Q5Y A;  2CAJ A;  3QOQ A;  2FGC A;  1MYK A;  2BJ8 A;  1BDT A;  2WVD A;  2JXH A;  2BJ9 A;  2GPE A;  2BSQ E;  2WVB A;  1PAR A;  2NZC A;  2HZA A;  2BA3 A;  3FT7 A;  1ARQ A;  2BNZ A;  2WVE A;  2BJ1 A;  1IRQ A;  2CA9 A;  4HV0 A;  1P94 A;  2K9I A;  2F1F A;  1BDV A;  3GXQ A;  4ME7 E;  3VW4 A;  1MYL A;  3VEB A;  2K1O A;  3BKT A;  2RBF A;  2K29 A;  4FXE A;  2CAD A;  2BJ3 A;  1Q5V A;  1B01 A;  3OD2 A;  2K5J A;  1BAZ A;  1EA4 A;  3H87 C;  2BJ7 A;  2H1O E;  3PHT A;  1ARR A;  2PC6 A;  1U9P A;  3BKU A;  2BNW A;  1B28 A;  2AY0 A;  3QSI A;  2WVF A;  1QTG A;  2JXG A;  3VEA A;  4D8J A;  3LGH A;  2CPG A;  2KEL A;  1MNT A;  3FMT A;  2Y3Y A;  2WVC A;  1X93 A;  2HZV A;  2K6L A; 
#chains in the Genus database with same CATH topology
 4A8Y A;  3PEH A;  4CNY A;  4PXD A;  2AEF A;  4DFJ A;  1HNX J;  2EFO A;  3WHI A;  1JLC B;  3C16 B;  1M1K T;  3T5L A;  3TRG A;  2BE7 D;  3QRR A;  1N0V C;  2HNY A;  2RDI A;  3DRR A;  4IKA A;  1EZZ B;  2QIF A;  4QR2 A;  4TXS A;  4DHV A;  1VJW A;  1LW2 A;  4DQI A;  3HDS A;  2RD5 C;  1U26 A;  4WU2 A;  2DNO A;  3CWJ A;  2LVW A;  4PEO A;  2XCP A;  3NNE A;  4L76 A;  2DH8 A;  1S57 A;  3EVW A;  2GQQ A;  4DL7 A;  4LR9 A;  3BKU A;  1LK7 A;  1DZ5 A;  1URR A;  2HZC A;  1DFD A;  4WFB Q;  3G82 B;  3WX8 A;  5I42 B;  1OMS A;  1XNR F;  4H4M A;  2KXN B;  5CCM A;  2RKI A;  1VRT A;  2Z2Z A;  1FTC A;  2RIJ A;  2ZWP A;  4LF7 J;  2WVC A;  4E0D A;  3L7U A;  3NCR A;  5GVQ A;  2PA3 A;  3POT A;  4OX9 J;  5LJ5 Y;  3NLC A;  4QOT A;  5RUB A;  5D0G A;  2RQC A;  3PW5 A;  1LKZ A;  3M2U A;  1FKO B;  1NKB A;  2WVE A;  2Y1R I;  2Y8W A;  2B7C B;  3N6L A;  3A13 A;  2EVZ A;  2O01 C;  5DQH A;  3W66 A;  1UTA A;  2VHG A;  3CJK A;  3U1L A;  1U47 A;  1FKP B;  1D9A A;  3ILL A;  2MGZ B;  1Q5V A;  3T5H A;  5SZT A;  1TKX A;  1ZZF A;  2H5E A;  4DL0 C;  1YRX A;  3MCO A;  2BJ7 A;  2GFF A;  1OG7 A;  1YQH A;  4LF9 F;  1ARR A;  1TKT B;  3T6J A;  1RP5 A;  2VIC A;  2F63 A;  3MCN A;  1HNZ J;  5J2Q B;  4FYW B;  2E1M C;  1S99 A;  4NML A;  2HQC A;  5IWA J;  2MJN A;  1WTB A;  4X4N A;  2HKE A;  2N7Y A;  3AXM A;  3KLG A;  4MH8 A;  2ZD1 B;  3V4M A;  2WTF A;  2RB7 A;  3GV5 B;  2XG8 A;  1XNQ J;  3QT6 A;  1EX8 A;  2XTJ P;  2HZV A;  1T95 A;  4WFY A;  2F7V A;  3G9C A;  3M2R B;  2DHX A;  3PKM A;  2CZ9 A;  3W5X A;  4EBC A;  4DPT A;  2KB2 A;  5AXL A;  3MEC B;  3UDC A;  5C42 A;  2HRT A;  4A48 A;  1CJT B;  1S0V A;  2UXD F;  2ASY A;  2U2F A;  3PRD A;  4IO1 A;  4XDD A;  1OIA A;  2QX0 A;  4HT5 A;  5DM6 Q;  1HW8 A;  4K4V A;  1AZS B;  4MK7 A;  1RT7 A;  1DTT B;  2Q3P A;  5HBM B;  2KJV A;  4K4Z A;  2HK2 A;  4DSK A;  3OHB A;  2CFX A;  3PW7 A;  1GTH A;  2YQ3 A;  1G1X A;  4ZVR B;  4X4O A;  1UVK A;  3GE9 A;  2KZM A;  4NEY A;  5ETL A;  4XDC A;  4IFV A;  4MT1 A;  4LQ3 A;  2QO3 A;  3Q23 A;  1WF1 A;  3OVA A;  4TU9 A;  5H9F K;  2K1R A;  1XC9 A;  3THP A;  4B3O B;  2BKP A;  1U1N A;  3LAN A;  5H1S V;  3TAM B;  2E29 A;  2KT3 A;  3HZG A;  1CUL B;  2YKN A;  2GML A;  2JSX A;  2ZH2 A;  2J7W A;  3EZU A;  1HD1 A;  1REG X;  4C0H A;  4ED4 A;  2N4C A;  4DPU A;  4OYO A;  5D3G B;  5KFT A;  4FYY B;  4U96 A;  1MN9 A;  4MKY A;  3OSP A;  1UA0 A;  1BQN A;  2AIR B;  3TQE A;  2IBK A;  1YX2 A;  1U6Z A;  2BAN B;  3H25 A;  2V34 A;  4DR3 J;  3MUV P;  3KLH A;  5ETM A;  2XY5 A;  2ZOM A;  2EFN A;  2ZBQ A;  3G86 A;  2Q1L A;  2H1O E;  1Z1Z A;  4I2P B;  1VCT A;  1CJK A;  1Q81 T;  4NI2 A;  5LXY A;  2KM8 C;  8ATC B;  3DM2 B;  5BYS A;  3BGR B;  4RBT A;  3LP1 A;  5KT4 A;  3GZ7 A;  2ABY A;  2V9K A;  3UVJ A;  4CM0 A;  5F0W A;  3BKF A;  1U1M A;  2M8H A;  4RZR A;  3N4W A;  4ECW A;  3I9Z A;  1CBK A;  4J91 A;  2C1E B;  2ZE2 A;  3HVT A;  1S7H A;  4HTJ A;  2VG5 B;  1OQ6 A;  3ICL A;  1QE1 B;  4OZ5 A;  4Q7A A;  2O67 A;  2OPR B;  1FCA A;  3E8O A;  2D3Z A;  4RW6 A;  2NXN A;  3D66 A;  5A6P A;  3Q8P B;  3MED B;  4JB8 B;  4DEZ A;  4ZP7 A;  4K0K J;  3C6T B;  4LVN P;  1U7L A;  3PNI A;  3DLK B;  2YKO A;  1S6Q B;  2HS3 A;  1HNI B;  2OKQ A;  1SC4 B;  1DLO B;  5KOW A;  4DQR A;  2V67 A;  3VAL A;  2VPY B;  3T19 A;  3CMQ A;  2ZH1 A;  3HHL C;  4OHY A;  3QAT A;  3M2V B;  3K5P A;  3R97 A;  2JEJ A;  3NKY A;  1K8A T;  2DHG A;  2IIH A;  1IR2 A;  2F65 A;  3SSS A;  3D1H A;  4FZV A;  2CIM A;  4G1I A;  1HWL A;  1ZM4 A;  3KK3 A;  2CXE A;  1MNT A;  1XEZ A;  2RUS A;  3GIM A;  1RLC L;  3OUY B;  1X93 A;  5T41 A;  4A8W A;  3CME S;  3LA0 A;  2EBG A;  1XNQ F;  2PMW A;  3IR6 B;  2DPI A;  4OJ3 A;  4QWD A;  1V3S A;  1VQS A;  1UJ4 A;  3O2I A;  4RW4 B;  1S48 A;  2IVM A;  2YH1 A;  3SV3 A;  3IR7 A;  2XNR A;  2QLW A;  1RAA B;  1RWO B;  4ZPA A;  1U4B A;  2AHO B;  3B8H A;  2CRL A;  2VDI A;  2H3E B;  4ZPC A;  2HPU A;  1SIW B;  4Y6I A;  3BKT A;  4GVL A;  1WC6 A;  1YDL A;  4RR5 A;  2DIS A;  4DSF A;  2ADC A;  2P6S A;  2DCU B;  2PD1 A;  3EXY A;  4WK3 A;  1R43 A;  4DX6 A;  3S7R A;  2C3O A;  5HVH A;  3H98 A;  3M8S A;  3G6Y A;  4F25 A;  2DGX A;  5HQL A;  3LPY A;  2AY0 A;  2R2T A;  3OV7 A;  1HBN B;  3GIK A;  3KK1 A;  2ZOF A;  1WC4 A;  2WB4 A;  1IR0 A;  3DLG B;  2PA8 D;  1R6V A;  4X62 J;  3A3O B;  4B3T J;  2RDD A;  1RT5 A;  4DQS A;  3BJY A;  1RT2 A;  2QZ8 A;  5HMZ A;  4OLP A;  3H42 A;  4OZ2 A;  2LEC A;  3JSM A;  3IWL A;  3CDE A;  2HIQ A;  2XSJ A;  3D4J A;  3KLI B;  4OZN A;  1CG2 A;  4Q45 A;  1NU4 A;  2HHP A;  4OI2 A;  2W2O P;  4A8F A;  3VVU A;  2L41 A;  3K5L A;  5KFF A;  4DR7 J;  2FLL A;  1P94 A;  2DNH A;  4HAC B;  4NRU A;  3EUN A;  3CD0 A;  3GJR B;  1NKE A;  2ZD1 A;  2DY9 A;  4WP8 A;  4B02 A;  3H7H B;  2J7K A;  4JUZ A;  1N5S A;  4DR3 F;  2DNP A;  3QNW B;  4ZA1 A;  2JFD A;  4NZ0 A;  4O23 A;  3VGT A;  1JLE B;  1UZH A;  2A6M A;  1U9P A;  5KT2 A;  1XR6 A;  3QBC A;  1SH3 A;  3UR0 A;  3SSR A;  5KFY A;  3WIV A;  4PPD A;  3B78 A;  3RAM A;  2XMV A;  3BRE A;  5KAK A;  1J5O A;  3S6E A;  4ZIT A;  2L9D A;  3SCL E;  3M32 A;  1RLD A;  5F8H A;  4NLQ A;  2DR8 A;  1RHJ B;  3PTW A;  3NGK A;  4YB1 P;  1P9Y A;  4IOC Q;  1VC0 A;  3OTC A;  4A8O A;  4LF8 F;  2JBV A;  1X9M A;  3QT8 A;  3G8T A;  4JI0 J;  2YBV A;  4OI0 A;  3HT3 A;  3DLE A;  2KTQ A;  1K0V A;  4EFA C;  5HJX A;  1X4D A;  3O6Q A;  3DOM B;  4TLQ A;  2EEY A;  4OJG A;  2KYX A;  1RAF B;  2DEJ A;  2ZBP A;  2D9P A;  2QV6 A;  5C24 B;  3KK2 A;  4L3K A;  2Z0G A;  2GAH C;  4O0N A;  1N5T A;  2IAJ B;  4UY8 5;  3TUP A;  5CZX A;  2CNL B;  3V6J A;  1YJU A;  3KDO A;  2ALY B;  3V5R A;  2P9G A;  4OZ0 A;  1H3D A;  3PR5 B;  1W25 A;  4KFB B;  4MKB A;  4LIW A;  4ZJL A;  3Q0A A;  5A8W B;  1RWN B;  2G0I A;  4N5S A;  5A8R B;  1RHR B;  4C8K A;  1SL0 A;  4ZN3 A;  3GPA A;  1S1W A;  1AFJ A;  3F41 A;  1OY9 A;  1Z4U A;  4YOE A;  4WFZ A;  1F3V A;  3OJU A;  5D8H B;  3MAH A;  3MEE B;  1ARQ A;  3ZZZ A;  4B9S A;  2B43 A;  5KG0 A;  1LFP A;  1FFW B;  2XHC A;  3FSY A;  1BD6 A;  4F0H A;  2OTL S;  3VR1 A;  5KFI A;  4UQG A;  2VQF J;  4WKR A;  2F4V F;  2W2N P;  3FNN A;  2W25 A;  3MPD A;  1FF2 A;  3JQJ A;  3PXG a;  3OD2 A;  3MAA B;  2UUW A;  4DZ6 A;  2DGV A;  3OLA A;  1RWK B;  1X4G A;  2H4W B;  3GTY X;  2XLK A;  2VG5 A;  2Z2Y B;  2ILY A;  4NLO A;  5KFN A;  3ELH A;  1DTQ B;  2ZM6 F;  2VPX B;  2Y9H A;  2BAC A;  2I0X A;  2ZZT A;  3J7Y I;  1CJV B;  1VMB A;  4I4B A;  2KL8 A;  2G0C A;  3HXM A;  4EO8 A;  1HNI A;  3QT7 A;  2WW8 A;  4ANC A;  1DLO A;  1RWV B;  1T05 B;  1SKW A;  1LV5 A;  2Q66 A;  3W65 A;  5HRO A;  4RBU A;  2JLF A;  3AY0 A;  5J2P B;  2FHJ A;  1K1S A;  2H3A A;  1T9V A;  3D1O A;  2H5I B;  3WQP A;  3LJP A;  1TKD A;  1RIS A;  3C15 B;  3ISN C;  1RYS A;  2DIV A;  3OUY A;  3MM7 B;  4NEZ A;  2W2P P;  3CDU A;  2GVD A;  1NZA A;  1FDD A;  1T9X A;  3JQM A;  2G2Y A;  2A6O A;  4ETZ A;  2GO9 A;  2XWX A;  3Q24 A;  2FJE B;  3NS7 B;  3I4P A;  1VIS A;  1RT3 A;  2P2C B;  4DFM A;  3DXS X;  4CH7 A;  4AE5 A;  2BQR A;  3CJ5 A;  2G2O A;  3H20 A;  3H0P A;  4DV1 J;  3CJT A;  1KNZ A;  4CWB A;  4KGZ B;  1R8P A;  2AJQ A;  3GV7 B;  3CD5 A;  1TV6 B;  2QEX S;  5CHC B;  4ZCI A;  4UT4 A;  4B9M A;  4LF6 F;  2FHK A;  3ULH A;  2CQ0 A;  2DKO B;  4CYU A;  3LQV A;  2XS5 A;  1JXV A;  2J9D E;  3P5T L;  1S97 A;  3PIP Q;  1LFW A;  4UF4 A;  4NLG A;  1C4A A;  4QJV A;  2VU5 A;  1U49 A;  2BBE A;  2I38 A;  1WKL A;  1X31 C;  5EGY A;  4JI0 F;  1FDA A;  5IT9 Y;  1VBZ A;  1VHF A;  1CJU B;  2K7K A;  3C14 A;  5LMU J;  4FVM A;  2R2R A;  2ZH9 A;  3G8Q A;  2ZBR A;  1VHI A;  4NLS A;  1P6T A;  1WNE A;  1YK9 A;  1HI1 A;  1XMB A;  2J5A A;  3KLI A;  2UXC J;  2HVE A;  2NSC A;  5I3U A;  4HH1 A;  2IM2 A;  3V6D A;  1RA7 A;  2W4D A;  3HVA A;  5J1N A;  3QLH B;  3U02 A;  4HAC A;  4C4W A;  3V81 A;  2X1A A;  1GMW A;  2V4J B;  2QMW A;  4IUF A;  1K73 T;  4RJV A;  4UST A;  2DCL A;  2MQP A;  1D1U A;  4PG6 A;  5EN1 A;  4OFZ A;  3BYR A;  5KT5 A;  1JLE A;  5LMN J;  8RUC A;  1GT8 A;  3CCM S;  2Y8Y A;  4ECZ A;  3G6V A;  1TK8 A;  1RT1 B;  1QD1 A;  1N88 A;  2IM3 A;  4U8Y A;  2ZH7 A;  1PGZ A;  1C0T B;  1JIH A;  2KM8 B;  1S12 A;  3BQ1 A;  5FDL B;  3ILJ A;  2V8D A;  3P45 B;  2CNN B;  4AXI A;  2YNG A;  4FF4 A;  2NXC A;  2JC1 A;  4LF2 A;  4DPO A;  4LIR A;  2VQF F;  3CCJ S;  2ASL A;  5MAO A;  2MZ1 A;  4PYD A;  2BMB A;  4N56 A;  1LW0 B;  1FJG F;  3GJS B;  2W8L A;  3TJ9 A;  4RUH A;  5K20 B;  4RW9 A;  4D3H A;  1RAI B;  2AJ1 A;  3M8Z A;  3UQS A;  1RU2 A;  3FBC A;  1WOP A;  3MM8 B;  3HUL A;  1SL1 A;  2JHE A;  3DLB A;  1U8S A;  1G2E A;  1FFG B;  1SJQ A;  2LQB A;  2HW3 A;  5KG6 A;  4LFA J;  3UI3 A;  1KOO A;  2L9N A;  1X4C A;  3BM7 A;  1RTH B;  4IFY A;  2FQQ B;  3M8Q A;  4NWB A;  5C24 A;  5LSL A;  4DUT A;  4B3R J;  5JUM A;  2FVC A;  3IAS 9;  1S9G B;  2HG4 A;  3HHL B;  2W7A A;  4ECV A;  1VBK A;  1PIL A;  4CTA A;  1Q8B A;  5AT1 B;  3QZ7 A;  1RGV A;  3FRZ A;  4KE5 A;  2VL1 A;  2ACY A;  3NNC A;  4O0I A;  2RBF A;  1YIJ S;  3EZO A;  3BBC A;  4OI1 A;  4CLS A;  3GJQ B;  5C2G A;  1S1X B;  2Z30 B;  2J6T A;  2QSF A;  5J1E A;  2DD8 S;  4WFN Q;  4FF3 A;  3CCU S;  3PW0 A;  3M9N B;  4ZVU B;  3TJ8 A;  1Y4Z B;  4PYA A;  1SCJ B;  3ETO A;  1Q95 G;  3G6X A;  2CQC A;  4ECR A;  3F73 A;  4C0B A;  3JQK A;  1RI7 A;  3RJM B;  5CQG A;  3NNH A;  1V6H A;  3G96 A;  1G7C B;  3VGU A;  2Z57 B;  4JI6 J;  2HHH J;  3OFH A;  4F2R A;  2MEW A;  2FLP A;  2NYH A;  2P9E A;  4Z2X A;  1DAR A;  4H4O B;  2W01 A;  5DM7 Q;  3UNG C;  1NH8 A;  3GP9 A;  3I32 A;  3DRS B;  3MPY A;  3ZTS A;  2CVE A;  2BEF A;  4O4R A;  2E44 A;  3NEK A;  1OO0 B;  3NGR A;  5ETT A;  4RNM A;  4U9R A;  1VRU A;  1CQN A;  2F40 A;  3ENV A;  4NXN F;  4WBF A;  5G0R A;  2CG4 A;  3PVX A;  1T03 B;  1SC3 B;  1JLA B;  3TUI C;  2UV8 G;  1WD6 A;  6FDR A;  3C66 A;  2WSF C;  4X65 J;  1VS3 A;  3PJ9 A;  2IVF B;  3HVR A;  1IBM J;  4F26 A;  1HWI A;  4Z37 A;  2Z56 B;  4MK8 A;  1R7I A;  1LEO A;  2BRK A;  4OV6 A;  1WKJ A;  4Y0F A;  1LWC B;  1D8Y A;  4YEA A;  2UXC F;  2YWF A;  1ZA1 B;  2V8G A;  2UXB J;  2CPD A;  2WCX A;  3FSX A;  4K4X A;  4B3S J;  1YBT A;  5GAH I;  2UP1 A;  1HIY A;  2PT0 A;  2C3M A;  3C15 A;  1EET B;  1S9E B;  3BGO P;  2DHH A;  2MQ8 A;  3OL9 A;  3I0R A;  1J2V A;  2YNI A;  2HK3 A;  4DF8 A;  2HVH A;  2VOD A;  4KGK A;  4YFU A;  3GYG A;  4WP9 A;  2CJA A;  4JI8 F;  3F56 A;  3EVO A;  1PAE X;  2J0Q D;  5HP1 A;  4I0W A;  1DQA A;  2GGP A;  2BDP A;  5B0D A;  3SIP B;  5LMN F;  4TKT A;  1T3N A;  2M0G B;  3HHD A;  1XTZ A;  5IS2 A;  1XR7 A;  1J5E J;  2YXL A;  1S1T A;  2M8D B;  2E5J A;  1CEZ A;  2E9Z A;  4QCL A;  2Q43 A;  3RR7 A;  3OR2 A;  7FDR A;  1HWU A;  3KUH A;  3H87 C;  4USU A;  1MN7 A;  3MF5 A;  5KFE A;  4IH7 A;  3UE2 A;  2M5Y A;  2C2O B;  4HR2 A;  5DGB A;  1Y5N B;  2BV3 A;  2GHW A;  3RB4 A;  4P9S A;  2VDH A;  3G2X A;  2XLJ A;  5JXS A;  1RWX B;  1UVJ A;  1KC8 T;  2KZZ A;  4D8J A;  1XJW B;  2CQB A;  1ULR A;  1KRP A;  4OHW A;  2MKC A;  2NPI A;  3QIP B;  2XWY A;  1C1C A;  2BM1 A;  4NYZ A;  4LFA F;  3T6B A;  3M9M B;  2GX8 A;  1Y3J A;  5KG2 A;  1TFW A;  1MWQ A;  5KFK A;  2XGQ A;  3H8Y A;  1PIE A;  1MSW D;  1UVL A;  1UW9 A;  3KG4 A;  3UPF A;  2ATC B;  3ZZY A;  1QM9 A;  1ZS6 A;  3EXC X;  2UUB F;  4ED8 A;  1GEH A;  4KV8 B;  1KEK A;  3P4U B;  1Q4R A;  1IKY B;  5BR8 J;  2JEG A;  2ZKU A;  3C6U B;  2L3M A;  2R7S A;  2W9C B;  3QO9 B;  5J2M B;  3HD1 A;  3DLJ A;  2WOM B;  4JV2 A;  2EWH A;  4RO0 A;  2VIH A;  4RU9 A;  2DJW A;  4MJK A;  5SUH A;  4NLX A;  4DPY A;  4YY3 F;  1OJ4 A;  4YUD A;  2V8P A;  1QSL A;  3UD3 P;  4NZ7 A;  1XK8 A;  4EWT A;  1Q8K A;  2VFV A;  4EBE A;  4HT7 A;  1RTJ B;  3VEA A;  4PQA A;  4ZDN A;  2YNF B;  1C0T A;  1FX4 A;  2AGO A;  2B7B B;  4BWJ A;  4KSE B;  4MAK A;  2BQ3 A;  2HHH F;  4DZD A;  1MRO A;  4ED2 A;  3IWX A;  3J81 j;  3OL6 A;  5KFV A;  5AXK A;  4A4J A;  4LVO P;  5GME A;  3X3U A;  1SQF A;  4K5R A;  2BA3 A;  1WAC A;  1RTD A;  1NK9 A;  2ADL A;  4ITS A;  1DRZ A;  4U6P A;  2QJ3 A;  5HMX A;  4GVB B;  4UQT A;  4IH6 A;  3THT A;  3EM1 A;  4CLF A;  4OYX A;  2OPP B;  3FK4 A;  3W3S A;  4ZCL A;  1W2B R;  4K4W A;  3BO4 A;  4P2S A;  2RT3 A;  4OLO A;  1SKR A;  4X64 F;  4X65 F;  4FBU A;  2HUR A;  3OR1 A;  4NCB A;  3QSY B;  1JLQ A;  3HHL A;  2RNE A;  3ZZU A;  3SYZ A;  1F5B A;  4X66 J;  2B4U A;  2PE8 A;  1X9W A;  1WC0 A;  2F9D A;  2VZ9 A;  3GB0 A;  5IC4 B;  2VFR A;  3PRV A;  2UXB F;  1UP1 A;  4NCG B;  4B3S F;  1I94 J;  5F8I A;  3SCK E;  2BW7 A;  1WEX A;  3ZC4 A;  4RNH A;  1ROF A;  3KHH A;  1OSD A;  4IRK A;  2WON A;  2B9W A;  1NSQ A;  2HHS A;  1NHU A;  4PQU B;  3QAE A;  1T94 A;  3DDK A;  4YHH F;  4ED6 A;  4MIB A;  3SBM A;  2C3U A;  4P71 A;  4PXC A;  1WEZ A;  2FVQ A;  1UFW A;  4CH0 S;  4ME7 E;  2A2C A;  1MYL A;  3W63 A;  1V9O A;  1DUR A;  1J5E F;  1IKX B;  2QFJ A;  1RWW B;  3RBX A;  2ZHB A;  2HIY A;  1FEE A;  2EK6 A;  2Q79 A;  1RT4 B;  2V68 A;  1FNO A;  4CCH A;  2PEH A;  1X5O A;  3I55 S;  3T5J A;  3I6P A;  2XLI A;  2JRS A;  1U0H B;  5A0Y A;  3QFH A;  3KLV A;  3TUJ C;  4IRD A;  2VG6 A;  4L72 B;  3C3L A;  3IM8 A;  2M7S A;  3KLF B;  4OV1 A;  3TA2 A;  3PV8 A;  3U7J A;  1P9Q C;  2E9T A;  1TMJ A;  3V4I B;  2NXU A;  4CLW A;  4MFB A;  1EP4 A;  5J2N B;  2MHE A;  1RTI B;  3FVY A;  2EFG A;  1Q7Y T;  1KN6 A;  2AT1 B;  3EX7 B;  2HGL A;  4RW8 B;  5THW A;  4ES2 A;  2RRA A;  2GMJ A;  3JAM U;  1TL4 A;  5LJ3 Y;  3HFK A;  3SDE A;  2WSC C;  3VTI A;  1T9Y A;  4OZL A;  1HBO A;  4HHJ A;  4U7U D;  2BOA A;  5BR8 F;  3P8B B;  3CJQ A;  3W2V A;  3KUE A;  3HHE A;  4PCQ A;  1ACM B;  3K5N A;  4ICL A;  4LF4 J;  1IM4 A;  3IBF B;  2X1B A;  4FF2 A;  1VQN S;  4YB6 A;  3DGP A;  3EDQ B;  2BNW A;  1HHT P;  3NS5 A;  3EJM A;  1MU2 B;  4DV2 J;  4HI2 A;  1QTG A;  3A3N B;  2YNH B;  7AT1 B;  2YWW A;  2F5G A;  3MD3 A;  3HKZ D;  3E3X A;  4C8N A;  4RUB A;  2OPS B;  1NLA A;  3TWZ A;  1HBM A;  4ZJQ A;  1LOU A;  3QOQ A;  1OSC A;  1YG0 A;  1MYK A;  5E0O A;  3CPW R;  2J9E A;  1XIQ A;  5DQG A;  1J27 A;  2EFV A;  2B6A A;  2GIR A;  2IPO B;  4S0M A;  1VR6 A;  3GIL A;  2BX6 A;  5KG1 A;  2R7U A;  3J81 Y;  5L9N A;  3CJS A;  2LXI A;  2XNQ A;  4GKJ J;  1LWF A;  2HQI A;  4M5I A;  5HJY A;  2MST A;  4USI A;  2ASJ A;  5LOQ A;  4V19 J;  4F4Y A;  1Q7L B;  3VW4 A;  4O3P A;  2MKI A;  3D6T B;  2LEA A;  4QWE A;  3MUT P;  3ADA C;  3ET6 B;  4ZHR A;  3RBD A;  4DI6 A;  4J9S A;  3SFG A;  4AFF A;  2DT9 A;  3B54 A;  4XTT A;  2UVU A;  4EYI B;  3MFI A;  1KWM A;  3HM9 A;  1KOH A;  4CNZ A;  1HI8 A;  2YX7 A;  1R8A A;  3OTB A;  4K2J A;  1QLN A;  4LRV A;  1SVD A;  4WZQ A;  1SL2 A;  2XI2 A;  4DX8 H;  1GH8 A;  3RB3 A;  1SKS A;  1ITP A;  4WP3 A;  2JEI A;  2KU7 A;  3D5M A;  4QWB A;  1GNK A;  4GO5 X;  3QO9 A;  3TEG A;  3OJS A;  1I1G A;  4K4T A;  1I94 F;  3CCV S;  3CE8 A;  1X4B A;  3DHW C;  4W90 B;  1C1B B;  2KHD A;  5L46 A;  2DGT A;  1YJ7 A;  3EGW B;  2ZH8 A;  4DX5 A;  1L3S A;  3W62 A;  4MKV A;  1LQ9 A;  1KP6 A;  1TL7 A;  3IFE A;  3JTP A;  3NMA A;  3ZZR A;  2E66 A;  5DRK A;  2A1B A;  1NDP A;  4ZPB A;  2GVZ B;  2IFX A;  2KHC A;  4TQR A;  1RE1 B;  3M7V A;  1VBX A;  3EVM A;  1EAY C;  1OHN A;  4CLZ A;  2XMK A;  2B8Q A;  1E6Y B;  5KFM A;  5KFO A;  1IJE B;  3CCQ S;  3RRK A;  2RH3 A;  4NA1 A;  2D1C A;  3TYT A;  2DTJ A;  4TLR A;  4ZMM A;  1IR1 A;  4ALZ A;  3SV4 A;  2LFV A;  4OHX A;  2A2D A;  2M9K A;  4PG7 A;  1S1U A;  3DGV A;  3DMJ B;  2R8I A;  5CCL A;  2XQC A;  5K8P A;  3I5C A;  2GO8 A;  1JKH B;  2WHO A;  3GR0 A;  2OGU A;  3GMG A;  1S4E A;  3TNV A;  3BSO A;  1TL5 A;  1T9W A;  3G5O A;  3T9Z A;  4ZLJ A;  4RW7 B;  2DH7 A;  3I4H X;  3W5Y A;  1QDU B;  3ZNJ 1;  4JI2 J;  4DWI A;  4AAI A;  4E98 A;  1PJ6 A;  3D3C J;  1RHQ B;  1QJH A;  3LW5 C;  3R27 A;  2AN7 A;  3LAM A;  2FVR A;  2XO6 A;  4C8Z A;  1LXJ A;  3W60 A;  3JYT B;  2HFV A;  2AGQ A;  4DR4 F;  5HI7 A;  3FMB A;  4PR6 A;  5IFM A;  2UUC J;  2BJD A;  4QU7 A;  3I5A A;  3IN5 A;  1KLN A;  5KG7 A;  2ZC4 A;  1XQI A;  2DNQ A;  4TN2 A;  2B3T B;  1I6J A;  5CYM B;  4EUV A;  4ES1 A;  4B08 A;  2AP6 A;  2FPH X;  2OSQ A;  5AJ3 F;  1NRK A;  3GJT B;  2ZJP Q;  2GJI A;  2PO4 A;  4O44 A;  3OVB A;  5CZV A;  3US5 A;  4XIU A;  2YWG A;  5IXU A;  3VWS A;  3K8W A;  4NE9 C;  2APO A;  4KHP F;  1OY6 A;  4OZ1 A;  5C2C A;  4DL5 A;  4QPT A;  1FO1 A;  1HD0 A;  1ICE B;  1U0H A;  2HND A;  1FNX H;  1V5V A;  4GKJ F;  3NRB A;  2GCF A;  5CYQ B;  3CIZ A;  2G0J A;  1WC1 A;  1S10 A;  1LK5 A;  2Y0B B;  3UCZ P;  1VDH A;  5HMY A;  3MM9 B;  4A8Q A;  1C0U B;  4NAS A;  3BS9 A;  2ZUG A;  3DRP A;  1N6Q B;  4Y2C A;  3HK2 A;  2DY1 A;  3M30 B;  4MKA A;  2CJ9 A;  2WVF A;  4RUC A;  3MD1 A;  4OQJ A;  4OYP A;  4LBH A;  2HFZ A;  4PUO A;  1XMO J;  3E01 B;  1WOS A;  2B56 A;  3KHG A;  4HL9 A;  1FRK A;  3TA1 A;  5KFJ A;  1X0F A;  1X4H A;  1FJ7 A;  3AD7 C;  2F3J A;  3EWG A;  4ZVO B;  1IKV B;  1JNR B;  1TKZ B;  1EQM A;  1YLX A;  1KVK A;  4G6V B;  1U0S A;  2XCA A;  1CS4 A;  3BO3 A;  4I64 A;  1NHV A;  3KKF A;  1Q1K A;  1N33 F;  3TZZ A;  3M8P B;  4C3L A;  1L3U A;  1ZBT A;  2R3V A;  1UL3 A;  4DV0 F;  4FKX A;  3GXQ A;  4X4U A;  1RDR A;  2P9C A;  3I0S B;  2BM0 A;  5K5M A;  3KYL A;  4DS5 A;  2RAQ A;  3MMC A;  4KPC A;  3AD8 C;  2J7U A;  1R3N A;  2BOP A;  3GYX B;  1C2P A;  5A8K A;  2IM0 A;  4N7T A;  2CJX B;  3IGV A;  1HPZ B;  2RIL A;  1H74 A;  4DN9 A;  1JLG B;  1T02 A;  1HL6 A;  4KH1 B;  1BY9 A;  3ZXW A;  2QGF B;  4KQZ A;  4OJH A;  1U1P A;  3W7B A;  4C7Q A;  5KFL A;  2W9B A;  2BUN A;  2BA9 A;  2HRU A;  4BWM A;  3PY8 A;  3HD2 A;  3D6F B;  3IS9 B;  2XY7 A;  2ZHA A;  3E51 A;  3MMA A;  1YHQ S;  1T11 A;  1YJW S;  3U1N A;  5A6W A;  2XY6 A;  3MAQ A;  3HI9 A;  4NMX A;  4AYB D;  5DO2 A;  3UN5 A;  2MLX A;  8AT1 B;  3IWN C;  1U1Q A;  4UOC A;  2F8H A;  2IM1 A;  1FK9 A;  2J0S D;  5K8M A;  3PYF A;  4FYV B;  3HT0 A;  4C2M A;  2VBW A;  1QVF R;  4EMD A;  9RUB A;  1A6L A;  1O0P A;  2XZT B;  1L3T A;  4Z7Y A;  4JI2 F;  2EFQ A;  3UR3 C;  3JTN A;  3VAG A;  3W1Y C;  4ZK7 M;  3K17 A;  3DRX A;  3OFG A;  3DOK B;  3B82 A;  1GXU A;  2IYG A;  4CLK A;  4DSL A;  4H54 A;  4X4P A;  2ACM A;  1HLW A;  4Q2L A;  3QJL A;  1HYS A;  2JJ4 D;  2VFT A;  1Q8L A;  1T8E A;  5B0A A;  2DGQ A;  2GVZ A;  2XC9 A;  2RQM A;  4I69 A;  1WHX A;  1KD1 T;  4TY8 B;  2A10 A;  3ZTP A;  1YJR A;  2WVB A;  2JL9 A;  1HQE B;  3FEX B;  3WC2 A;  3CCS S;  3R5D A;  4FP9 A;  3P5B P;  1Y10 A;  3CJ3 A;  1IKW B;  1KTQ A;  2CQ1 A;  2IVY A;  2OEJ A;  1NB7 A;  4LJM A;  1TL1 A;  1WDT A;  3I56 S;  1Q0N A;  3TUZ C;  2FY8 A;  1B64 A;  3IR5 B;  1Y3K A;  3H5S A;  2LQ5 A;  1JJH A;  1UEK A;  1ZM3 A;  4QWA A;  3NOC A;  3BPS P;  4NA2 A;  4NXM J;  2D69 A;  3TOQ A;  4F3O A;  1H38 A;  2DK2 A;  1JKH A;  4RNN A;  3D6M B;  3J7A N;  3KTQ A;  3D0G E;  3VAJ A;  2XMM A;  2YKA A;  3HJV A;  2OJ3 A;  1TR0 A;  5LT5 A;  4NLR A;  3LOU A;  4WYW A;  3JSR A;  2KN4 A;  3AAW B;  2MZR A;  3K2Y A;  2UXD J;  4KKO B;  2ZZM A;  4FN5 A;  4CO1 A;  4J9N A;  1QUP A;  2CG8 A;  1XMO F;  5D78 A;  5ETK A;  2K8G A;  2UZA A;  3OFF A;  4MYT A;  5DGA A;  3H59 A;  4G1Q B;  2MB0 B;  3OBI A;  3ITH A;  4USM A;  2J76 E;  3QGH A;  1VYA A;  1U2R A;  2XS7 A;  2MKK A;  2GJF A;  1BQM B;  3I87 A;  3BQ0 A;  2OEL A;  1YJ9 S;  4ES3 A;  2EK1 A;  4NPO A;  4ELU A;  5AE2 A;  2ZH6 A;  4P75 A;  5EX0 A;  2VPW B;  1GXT A;  2I9S A;  1U1R A;  1TZ0 A;  4M8L A;  2O3D A;  5CYM A;  3J7A 1;  2B5J A;  3A1Y G;  3MM6 B;  2VA3 A;  5M2R A;  2FIU A;  3N01 A;  2R7Q A;  4NLP A;  1XWL A;  4ZPV R;  4LFC F;  1X7V A;  2CQG A;  4DFP A;  4F67 A;  4USV A;  4DOZ A;  1CQM A;  4B9T A;  4NLY A;  3MEG A;  4Q8E A;  3SEO A;  1HBU B;  3UD5 A;  5CYQ A;  3GQC A;  4UOF A;  1P27 B;  5K14 A;  1FE4 A;  2DH9 A;  4ZN1 A;  4QYZ J;  2W4C A;  1U2F A;  3FCV A;  1LWE B;  4LRE A;  2Z8Q A;  3R2D J;  1WEL A;  3Q8S B;  2N4D A;  4UY8 T;  5D15 A;  3CVK A;  4DX7 A;  1H72 C;  1TVR B;  5IQ6 A;  3B4M A;  3QPI A;  4DL2 A;  2VFS A;  3P96 A;  4QPX A;  2A0F B;  4R8U B;  2FJX A;  1ZZN A;  1L3V A;  4KO0 B;  2AYE A;  4WXW A;  1Q79 A;  5IV4 A;  1ZPW X;  2KKE A;  2HNZ B;  3E2E A;  1KS2 A;  1X8D A;  5F8M A;  3IO1 A;  1M1G A;  2BE2 B;  2OMO A;  2VG7 B;  4IRC A;  4IYQ A;  4Z7C A;  5IT4 A;  1YRT A;  4R5P A;  3NGU A;  3RR8 A;  1RCO B;  2RML A;  4ECT A;  3IA0 A;  3IM9 A;  2R8K A;  2HBQ B;  4YDD B;  2FZG B;  3H40 A;  3IRX B;  2YWE A;  4ED3 A;  3QAU A;  5KFD A;  1RUS A;  4P72 A;  4TYA A;  1ZM9 A;  3RB0 A;  9ATC B;  1UJ6 A;  2VOP A;  4P7T A;  1HWJ A;  2H48 B;  3LP0 B;  5C25 A;  2J6S A;  2Z4P A;  5HLF B;  1JLF B;  3QFW A;  4I7F A;  3DU5 A;  3RRH A;  3PR4 A;  3M8R A;  4JP8 A;  3ILO A;  4M5M A;  2R42 A;  2K3I A;  2XHW A;  4J9R A;  1JLB A;  3NOG A;  1X4E A;  4NXM F;  3GII A;  2MTL A;  5I3P A;  1RSC A;  3FMW A;  5EX3 A;  1HNV B;  2VBX A;  3I82 A;  4ZPT R;  1OPZ A;  4O3R A;  4CLT A;  4ERD A;  4K4U A;  2G1H A;  5KFG A;  1QVG R;  2QLB B;  4C98 A;  1Z2Z A;  2AX0 A;  1HNW J;  1MMN A;  4M5G A;  3OVS A;  3D0H E;  2I2Y A;  2ZVS A;  1RHU B;  3NGD A;  2CWX A;  1FRM A;  1TFY A;  2FVP A;  4MMO A;  4FPI A;  5CD4 A;  1FJC A;  2ZDP A;  3DOK A;  4TU7 A;  2JOQ A;  1E6V B;  3EZ5 A;  1RAE B;  3U1M A;  2XMA A;  4LBP A;  3MZI A;  5FII A;  2W8K A;  2HHQ A;  2W2Q P;  4CO0 A;  4UW2 A;  3A8K A;  1NJY A;  2AYM A;  2UUA J;  3KDN A;  2E5G A;  3DYA B;  3MMJ A;  4DXL A;  1SUQ B;  2HHX A;  3N5B A;  3RW7 A;  2UU9 F;  1SBR A;  5JJB A;  2MLY A;  2IBO A;  3KLE A;  4I56 A;  2GV1 A;  4TY8 A;  3R7N B;  1VK8 A;  1R0A A;  1HMV A;  1YZ6 A;  3EGN A;  2Q6B A;  3EYZ A;  3OTO F;  1IKW A;  5IM0 B;  1SH0 A;  4RU2 A;  4NYO A;  4DG1 B;  5H9E J;  3FFI B;  2NRE A;  4J37 A;  4CDI A;  5DZ7 A;  2MKS A;  1S1V A;  2HWH A;  1EKR A;  2CPE A;  5GAG U;  5CYJ A;  4J9Q A;  1NK7 A;  1ZAV A;  4CLP A;  2JWN A;  1UVI A;  1SJ1 A;  2BYC A;  3AT1 B;  2HVZ A;  3KJV A;  1U45 A;  4HV0 A;  4OYB A;  3OXF A;  4Y2I A;  4WZM A;  4FBT A;  1NH7 A;  2C2D A;  3SSQ A;  3MM5 A;  3T41 A;  1UPM B;  4HLB A;  2VV5 A;  1KVI A;  1KHV A;  1B7F A;  1RWU A;  2CQ3 A;  4QZV B;  4CT8 A;  1S6P A;  1R27 B;  3OL8 A;  4LFB F;  2ZHO A;  1VJQ A;  1UFK A;  2Q2K A;  4RNO A;  4LSL B;  2ZH3 A;  4FYX B;  3FZ2 A;  2DO4 A;  2FLO A;  4J5O A;  4NLU A;  2Z2L A;  1IM6 A;  2E9R X;  2FTR A;  3S1T A;  1CC8 A;  4K59 A;  2FVS A;  1Q16 B;  2KRB A;  3RRG A;  3W2W A;  3DOL A;  1KKH A;  5BXI A;  4PWD B;  3DCA A;  4O4G B;  3GIJ A;  4X4V A;  4N8N A;  1S0O A;  4ECU A;  2CNO B;  4LF8 J;  1TQL A;  2WZ1 A;  4DL6 A;  4C11 A;  2HVD A;  2QRR A;  1M5P C;  5FLX U;  1WTF A;  1RWP B;  2FZK B;  2XM3 A;  2KT5 A;  2RF2 B;  4WK1 A;  3KUG A;  2DB1 A;  4E2F B;  2EG2 A;  5L1I A;  1JMT A;  2NLW A;  3KG0 A;  2YKM B;  1VQ8 S;  3MR7 A;  1N32 J;  1HR0 F;  2ZNY A;  2HWI A;  1KQS R;  4FS1 A;  3CC7 S;  3TAQ A;  2LA4 A;  4DV6 J;  2QSW A;  3Q2S C;  4IDK B;  4ZPW R;  3AOC A;  2PSZ A;  1NK0 A;  4WE1 B;  2X51 A;  2H4Y B;  3GFZ A;  2DVI A;  4DMZ A;  1KFS A;  5DG7 A;  1JLC A;  1B0T A;  2K1O A;  3C16 A;  3BGL A;  3J7Y U;  2GIF A;  1UVM A;  3T9N A;  4DR1 J;  1Y11 A;  2RRB A;  1KTV A;  1X5T A;  2FJD B;  2XMJ A;  3CB4 A;  2OUG A;  4OYZ A;  4USH A;  3N28 A;  4EI2 A;  3AA8 A;  2R8G A;  3L7P A;  2R2U A;  4QWC A;  2GIQ A;  3LWM A;  4MIW A;  1TTH B;  1XMQ J;  1FWK A;  1WC5 A;  3VAK A;  3LTO A;  4QU6 A;  2NS1 B;  2E5H A;  1HNW F;  2MQN A;  3G82 A;  1PJ7 A;  5I42 A;  4E8U A;  2DRB A;  2F4V J;  4LF1 A;  3LF0 A;  2J0W A;  1RZM A;  2EG1 A;  2DXD A;  5T7L B;  5M2U A;  2P8I A;  2V8V A;  1QAX A;  2VG7 A;  2EPI A;  2HMI B;  4USJ C;  3MTK A;  1RAC B;  3SQG B;  1NND A;  1RU1 A;  3OHA A;  3K0J A;  5DDQ C;  2ADB A;  1NLK L;  4Y00 A;  2HBR B;  2ZM6 J;  2V0N A;  3TP2 A;  4LRB A;  4ECY A;  5E3R A;  2UVR A;  2R7T A;  1S0M A;  2UUA F;  1RT6 B;  1FKO A;  1SPB P;  4DDF A;  1IWA A;  1GMV A;  2CQ4 A;  4LSZ B;  1S0N A;  1W7W A;  5L9X A;  1F0X A;  1M5K C;  3UDV A;  4JI5 F;  1FKP A;  2MGZ A;  4G65 A;  1VGY A;  3RYL A;  4L74 A;  1HA1 A;  4WFX A;  3LP0 A;  4BDP A;  5I4M A;  4UOG A;  3HFV A;  1FDN A;  1TKT A;  1V5I B;  3K58 A;  4RKU C;  3DFE A;  3UD4 P;  4F4A A;  4XPC A;  1T7P A;  2HYI B;  2XS2 A;  3WDO A;  5J2Q A;  3IGN A;  2HNY B;  4DR2 F;  3DRR B;  4FXD A;  4F2S A;  1FXL A;  1WWH A;  3UCG A;  4M5L A;  3K7R A;  1LW2 B;  4J9L A;  3JXO A;  4BHQ A;  4F0M A;  1HNV A;  3DNC A;  4N41 A;  1N5Y B;  1Y00 A;  4FPR A;  2JLG A;  3M2R A;  3M9O B;  1RHK B;  1BQX A;  1T9U A;  3MEC A;  3AQP A;  5DS7 A;  4B3M F;  2HFN A;  2IC3 B;  3AH6 A;  2C2E A;  2AJ0 A;  1CJT A;  2RQ4 A;  2V9W A;  1NDL A;  3PO4 A;  4H4M B;  5I3Q A;  3R6G B;  2RKI B;  1BHN A;  1LWX A;  2FC8 A;  3CDB A;  3CJR A;  1AZS A;  3KXD A;  3HSJ A;  1DTT A;  2RUG A;  2AJ4 A;  5HBM A;  3TAR A;  3D9B A;  1WSR A;  2LU1 A;  4LF6 J;  2RRN A;  1N0U A;  1D0E A;  3POT B;  1RAH B;  2YVS A;  3LAL A;  4Q44 A;  4G1P A;  1S4F A;  3MR5 A;  4MK9 A;  2OAU A;  3AJD A;  1ZYQ A;  1ZH5 A;  2AGP A;  3OW2 R;  3T3F A;  4QYZ K;  4O3N A;  2CNK B;  4YR0 A;  3M2U B;  3DYA A;  3EDR B;  2ZVI A;  1PO6 A;  2EBE A;  4ZVQ B;  4A47 A;  2YX4 A;  5CD4 H;  4DR5 F;  1U48 A;  2BJ8 A;  2JEF A;  3QGP A;  1RK8 A;  3CJK B;  4B3O A;  2VBZ A;  2PEB A;  5GAG I;  3H5X A;  3U27 A;  3C19 A;  1N32 F;  3H2L A;  5GAD I;  3TAM A;  1SQG A;  4DSI A;  1CUL A;  5IM0 A;  4I68 A;  1TKX B;  4DV6 F;  2NYI A;  3BBF A;  1SC1 B;  2K9I A;  2RQK A;  3L4B C;  5GAE U;  2H51 B;  1BDV A;  4D3G A;  4ER8 A;  1CPZ A;  4NRT A;  4KYZ A;  3EE3 A;  3VGV A;  5D3G A;  2GMH A;  1A9N B;  3OXG A;  1FKA F;  1VQO S;  3K59 A;  2QFI A;  4BCA A;  4PAB A;  3JB9 k;  3H5Y A;  1P1L A;  3LH2 S;  4DR1 F;  2BAN A;  2E7W A;  2AD9 A;  2LDY A;  1FJE B;  2DNG A;  3KNG A;  3AFG A;  4JV5 J;  2ATL A;  3C2P A;  2F4F A;  1NPK A;  1BWV A;  2LP4 A;  2CPG A;  5KFQ A;  1VQK S;  3O8W A;  5C42 B;  3R6L B;  5KG5 A;  1RCX B;  4I2P A;  5JVH Q;  3TAN A;  1U1O A;  2XMT A;  4AD6 A;  1XMQ F;  4UOH A;  1F60 B;  3DM2 A;  1B4S A;  3BGR A;  3Q8V A;  3LO3 A;  1Y9O A;  4K50 A;  1RT7 B;  4QIE A;  3G4S S;  4J9O A;  1JXE A;  3KHR A;  1B0P A;  2CQI A;  4NLW A;  1FJG J;  4O3O A;  2XEX A;  1WDD A;  2BE9 B;  2CPZ A;  4AUK A;  2CZV C;  1MG7 A;  5M2P A;  4LRD A;  4YR2 A;  4KGM A;  4C8O A;  4J9K A;  1HI0 P;  4IFV B;  5B0B A;  3OFE A;  2B8P A;  1QE1 A;  3ZTR A;  1WOO A;  2OPR A;  2M4M A;  1RBA A;  2K1R B;  4ZIV A;  1VQL S;  3TX8 A;  1FVQ A;  3X1L B;  5B0E A;  3MED A;  4NX9 A;  3ENA A;  4EYH B;  3HLU A;  1FI4 A;  3C6T A;  3R3T A;  3DLK A;  1S6Q A;  2MZJ A;  1S5Z A;  2O5D A;  4I1T A;  3MPW A;  1RKJ A;  4YR3 A;  4C0O C;  2LA6 A;  2R7V A;  1NHK L;  2ZOG A;  2V63 A;  3FCW A;  1LNQ A;  1NSK L;  2BW2 A;  2LEP A;  4WE1 A;  4NCA A;  5JVG Q;  3QT5 A;  1TMM A;  4K4S A;  3H2U B;  3I96 A;  2CKW A;  3M2V A;  2RS2 A;  2PFF B;  1UCN A;  4IH5 A;  3PX0 A;  2CQH A;  2P5V A;  2XUL A;  4F50 A;  4DV7 F;  1BQN B;  1VQP S;  4DPX A;  1QSY A;  2KH9 A;  1VC5 A;  1PAR A;  3KLH B;  1YRU A;  3AOA A;  3BGU A;  4CO4 A;  2MQQ A;  2BJ1 A;  5KFH A;  1IRQ A;  2CA9 A;  3MHY A;  5D77 A;  3LWL A;  2DGU A;  3KJN B;  4WTO B;  3DI6 B;  1VLO A;  1CJK B;  4KGX B;  5IC6 B;  2IDL A;  3NXZ A;  2KG1 A;  4NI2 B;  4RW4 A;  2Z2M A;  4I6W A;  4I6A A;  4DR6 F;  2D9O A;  5GAH U;  4MIA A;  3LP1 B;  4IO9 Q;  5HVF A;  3CCT A;  3SXL A;  1VI7 A;  4U7U K;  4KIA A;  5A76 A;  2Y0S D;  1SIW A;  3EGZ A;  1R0C B;  5E7O B;  1OPI A;  3VAI A;  5H9E K;  3VVT A;  1F6T A;  2ZE2 B;  4F0K A;  3SZ2 A;  2NXJ A;  1JNZ B;  1FRX A;  2DXE A;  5AXN A;  3HVT B;  2R7X A;  4RNF A;  3MXH P;  5F8N A;  2ZFH A;  3MGJ A;  2QTW A;  1NXI A;  1A7G E;  4NXN J;  4RW6 B;  1ZAW A;  4F36 A;  1PC4 A;  4UZB A;  4K8R A;  1RT6 A;  1WSV A;  3J80 U;  4ZVS B;  1HBN A;  2PDA A;  2AF6 A;  3L9Z A;  2O66 A;  1NUE A;  3DLG A;  5L1K A;  5KG4 A;  3Q89 A;  4QR1 A;  2WAQ D;  2G4B A;  2M2B A;  1PYS B;  3PEJ A;  5HMW A;  1KHW A;  2OFH X;  2HGN A;  4J9U E;  4PWU A;  2YX1 A;  1GMU A;  4KJI A;  3A8E A;  1FRH A;  4F3M A;  5FD1 A;  3RTV A;  2KVI A;  2LQJ A;  1Z2L A;  2AEJ A;  2QMX A;  3GSD A;  2FJA B;  2D3U A;  4ECX A;  3TEH B;  3KK3 B;  1QTN B;  3AJ1 A;  2EW9 A;  3NAH A;  1M0S A;  4F3Q A;  1KR4 A;  3KMQ A;  2DEI A;  3N6M A;  3MOJ B;  2VH7 A;  1QAI A;  4JI8 J;  3HSZ A;  1N5Y A;  4JV5 F;  2AEM A;  3DLH A;  2JFK A;  2IC3 A;  3RB6 A;  4R0J A;  2W9A A;  1TUV A;  3IR7 B;  4L75 A;  2YWH A;  2CDR B;  3NBP B;  1YJV A;  4WYL A;  2CPJ A;  5CA5 A;  4P52 A;  2G2Z A;  4UUW A;  1RTZ A;  3PAC A;  1P8G A;  5B0F A;  2C3P A;  3HZE A;  1JQG A;  1SV5 B;  3NG8 A;  2BR0 A;  3VCD A;  3OXL A;  2M52 A;  5FLX Y;  3T1H F;  1WG1 A;  1WC3 A;  5E3Q A;  5GAE I;  1Q78 A;  4ID5 B;  5KFU A;  4OHV A;  2DYA A;  3RAX A;  2DRA A;  3CIM A;  1NBE B;  3I5B A;  4JI7 F;  3KK1 B;  5E3C A;  3GSI A;  4OYI A;  1Q82 T;  4OX8 A;  3DOM A;  1RT5 B;  6FD1 A;  1OWX A;  3NCP A;  1G4C A;  5D0H A;  1RT2 B;  5U47 A;  4URG A;  1UWB B;  2QLX A;  3JSM B;  2MQO A;  4U8V A;  2PII A;  2V2Q A;  2XSJ B;  2IAJ A;  4RBV A;  2MY7 A;  2XO7 A;  3QWP A;  4CM2 A;  4ZVP B;  2UUB J;  2CAX A;  3P6Y C;  2MMY A;  4DPW A;  2FGC A;  4NLV A;  4FXW A;  1RAG B;  1QTM A;  2QYG A;  4KFB A;  4GMK A;  3MR2 A;  4OYA A;  4HH0 A;  1C4C A;  3BB5 A;  2QA2 A;  1JB0 C;  5A8W A;  3W61 A;  2YTC A;  2QA4 G;  5T14 A;  3MEK A;  2FJV A;  5KFW A;  5A8R A;  3S8S A;  3UWT A;  4ILL A;  3BO2 A;  2DNY A;  1N34 J;  3MR3 A;  4YY3 J;  2VF3 A;  2G9O A;  2EKN A;  3DDN A;  2KOE A;  2QN6 B;  2LQ9 A;  5B0C A;  3MR6 A;  4K4Y A;  2NXE A;  2XYH B;  3MEE A;  1MNE A;  1FHT A;  2OSR A;  3CMA S;  2ERR A;  1J5O B;  3UNY A;  2AU0 A;  5KTQ A;  2B4P A;  3M32 B;  2VFU A;  4WPA A;  3GFY A;  4YQW A;  2FJB B;  3KG1 A;  4OIX A;  3O44 A;  1FER A;  2FHJ D;  1N56 A;  2HFS A;  1AFI A;  1I51 B;  3MAA A;  4F4Z A;  4FS2 A;  2CDQ A;  5D6G A;  3AQO A;  4DV5 J;  4L6V 3;  5F8L A;  5ETN A;  4L3N A;  2I5J B;  2HS4 A;  2MYF A;  4KH0 B;  1DTQ A;  3DLE B;  3VAM A;  3PYE A;  1VC6 A;  2AZ3 A;  1QY7 A;  1CJV A;  2C22 A;  3A8I A;  5IT9 U;  3DHX A;  4OI3 A;  1FD8 A;  1RYR A;  3OLB A;  3KK2 B;  2PGC A;  2V8H A;  2KRR A;  4ATN A;  3A4T A;  2VUG A;  2OTJ S;  4X64 J;  1T05 A;  1X0P A;  2F1F A;  1N5V A;  1JJC B;  2CUY A;  3OT9 A;  1NJZ A;  4MJW A;  2IA6 A;  4HI1 A;  4ZVG A;  3FRY A;  1HNX F;  4F02 A;  5J2P A;  2OHD A;  3RW6 A;  4M5D B;  1U6B A;  2DRD A;  2VB6 A;  1REV B;  1XR5 A;  2V5H G;  3PX4 A;  4IG0 B;  2WSE C;  3QYY A;  3WIU A;  3HO1 A;  4ED0 A;  2X3D A;  2IMO A;  1S1W B;  3ZZT A;  3MM7 A;  3M6X A;  2DR5 A;  3ZZP A;  5GMD A;  1UA1 A;  3TAP A;  2MZQ A;  3DI6 A;  5F3T A;  1N4L A;  1U1L A;  1EAR A;  2BAB A;  4YHH J;  4KHR A;  2B9E A;  4FNI A;  3OTD A;  1EQ0 A;  3HSG A;  5DG9 A;  4LT6 A;  4P7V A;  2ASD A;  3DKD A;  5EHH A;  3MCS A;  2J8A A;  3QID A;  3GG1 A;  2VKZ G;  2KXH A;  2ZBI A;  2ZJR Q;  4ZVT B;  2OFG X;  3GWC A;  3UDE A;  3M1V B;  2N3O A;  3SFU A;  3AA9 A;  4LF7 F;  4ILR A;  1TV6 A;  2IMW P;  2RDJ A;  5CXT A;  3CJ0 A;  4OX9 F;  3PJX A;  4DUZ J;  2DGO A;  5F3Z A;  3M8W A;  4KTQ A;  4ELV A;  1NZ8 A;  4IR1 A;  2YKP A;  4X4S A;  1H6K X;  3GCX P;  1GMW D;  3ZZ0 A;  1Q8I A;  4HKQ A;  2C2K B;  4PXB A;  2BJE A;  2KG0 A;  2GAG C;  1FDB A;  1CJU A;  3C8Y A;  1BLU A;  2QMU B;  1FD2 A;  2C2N A;  3FBF A;  1FEH A;  5IQQ A;  1U02 A;  2IRU A;  4Q5V A;  3TX0 A;  1SH2 A;  3DN9 A;  3IP0 A;  5HAN A;  5HRO B;  2VOO A;  2GJ2 A;  6AT1 B;  2HLU A;  2LXU A;  3MTJ A;  2IJR A;  4Q43 A;  3D28 A;  1HNZ F;  5LM7 E;  5IZH A;  2B0G A;  2L48 A;  1N48 A;  3TO8 A;  2DNL A;  3F0N A;  3QLH A;  5DDO C;  1TK0 A;  5IWA F;  2YPZ A;  3H5U A;  1PYT A;  1VQ6 S;  2DIU A;  2C2R A;  3A12 A;  2R2S A;  2E7V A;  3B4D A;  2VQE J;  5F9N A;  2COL A;  4UTG A;  2GVD B;  1EHW A;  2V4J A;  1WHV A;  1SJF A;  1XER A;  1NK8 A;  1N34 F;  2CZ4 A;  2FY1 A;  1RT3 B;  1RT1 A;  1B3T A;  1DQ8 A;  4OYW A;  4NLD A;  2JLE A;  3NBP A;  3FQK A;  2K2P A;  5FDL A;  1PBA A;  5LL6 d;  2W2M P;  1HQU B;  4XO0 A;  2KFN A;  4N77 A;  2CJY B;  1S79 A;  2Z58 B;  1GTE A;  5EWG A;  2B51 A;  2R7R A;  1FWL A;  3J7Z 5;  4HHU A;  1LW0 A;  2HHW A;  1SV5 A;  4DBQ A;  4CYU B;  2WW4 A;  4JI1 J;  1OY8 A;  2AW0 A;  3A3P B;  5EUH A;  1S9F A;  2RVJ A;  4ID5 A;  4IR9 A;  1SC6 A;  3MM8 A;  1N5Q A;  2B4V A;  4DV5 F;  3MFH A;  4BBY A;  1T3O A;  2HQF A;  1H0H B;  3C14 B;  2H9Z A;  1R8H A;  3PM9 A;  4YP3 A;  1VQ5 S;  3HX9 A;  2KFY A;  4WWS A;  2E1R A;  2ZIT A;  2C3Y A;  1RTH A;  3CCR S;  4CT9 A;  1UWB A;  2FB0 A;  2LKZ A;  3BN4 A;  1SJ4 P;  4YME A;  2JNJ A;  4WF9 Q;  2LCW A;  5I3U B;  2FDN A;  1S9G A;  1UAW A;  3V6D B;  4OI6 A;  3D67 A;  5D0E A;  2FHM A;  2IA0 A;  1M5S A;  1FX2 A;  2PI4 A;  4R25 A;  4GC6 A;  2MKH A;  3V81 B;  3HHN B;  1S1X A;  2HBY B;  1YSJ A;  3QGG A;  1MML A;  3TZW A;  1R6Y A;  3CW2 C;  2IY5 B;  4C9D A;  1HW9 A;  1HAR A;  2DR9 A;  1PAU B;  1CC7 A;  2DIT A;  5ADZ A;  1HWK A;  3MWB A;  4V19 X;  2YNG B;  1NK4 A;  2HFU A;  1ZAX A;  4ENO A;  1X9S A;  3EPG A;  2W7O A;  3R5C A;  4H4O A;  4WII A;  3IXQ A;  2JH3 A;  2OPQ B;  4Y65 A;  2KO1 A;  1TK5 A;  3CJ2 A;  3VHQ A;  4QYR A;  4DFK A;  3DRS A;  3RZA A;  4B17 A;  4L73 A;  2XGP A;  1F5C A;  4QW8 A;  1NEE A;  2MSS A;  4RW9 B;  2AZ1 A;  1OYE A;  5F9L A;  4LRA A;  1N52 B;  2L9W A;  1TEL A;  3IC1 A;  3H2V E;  1UEV A;  2DBB A;  3J80 Y;  2BJ3 A;  2KVQ E;  2I5J A;  4DSE A;  1KVJ A;  1XN9 A;  4KC5 A;  2HWT A;  1Y5L B;  4DUZ F;  2CPF A;  4DCO B;  1S72 S;  1UET A;  2GZO A;  2KI2 A;  2IHR 1;  2IJN A;  3LP2 B;  4NA3 A;  3GFH A;  3R5J B;  4IFY B;  1Y7P A;  2QL9 B;  3IBW A;  3M8Q B;  1T03 A;  4K0K F;  3LGN A;  1JLA A;  3QSI A;  2OH2 A;  3GON A;  2VKR A;  4Y2K A;  3TZY A;  5F41 A;  3CT9 A;  1FVS A;  3BSC A;  3TJA A;  2XZD B;  4PG4 A;  4ID8 A;  4WCE Q;  4CTA B;  4M5D A;  1G6B A;  1LWC A;  2E5L J;  2EFP A;  1U09 A;  1X4A A;  2JX2 A;  1REV A;  2H1Y A;  1M1H A;  2WRM A;  5ETP A;  1EET A;  1TL3 B;  1S9E A;  3D7S B;  4IG0 A;  2UVV A;  5J1E B;  2LYV A;  4J9P A;  3TVZ A;  3MUR P;  3NWG A;  2VQE F;  2VC1 A;  4FXV A;  4W92 B;  2FYX A;  2V4R A;  4DR4 J;  1R89 A;  4ZP9 A;  3VEB A;  4N76 A;  1RXO B;  1NSA A;  2CAD A;  3BDP A;  4AQY J;  2R8J A;  1DBD A;  2D3O 1;  2BZ2 A;  3R7S B;  2NSB A;  2ILZ A;  1OQ3 A;  1F2G A;  1T9T A;  1NJI T;  2QL7 B;  5AJ3 J;  2DNK A;  4NL5 A;  2JVR A;  1RHM B;  4WJB A;  3L3C A;  2HFO A;  3M1V A;  4X2B A;  1AXQ A;  1D3W A;  3RGI A;  1ZM2 A;  3D3B J;  2JZ5 A;  1YJN S;  3H4D A;  4KHP J;  2WB1 D;  2BXJ A;  2X3G A;  1RAJ A;  1MLA A;  4CLL A;  3N5F A;  4JI1 F;  1VRU B;  2CAJ A;  2YY3 A;  4JV0 A;  1YI2 S;  1O51 A;  5G0R B;  4ZVH A;  3QIP A;  2ROG A;  2W4P A;  4EBD A;  3AB2 B;  3FSI A;  4X62 F;  2GQ2 A;  4B3T F;  4C8Y A;  1FT8 A;  1HHS A;  2R7W A;  4F4W A;  2MLZ A;  2UUT A;  3QWU A;  4ED5 A;  2BQU A;  3CC4 S;  1BE4 A;  1UZD A;  2CQD A;  2E5I A;  3MI7 X;  3MCM A;  4J9V A;  1OYD A;  4KV8 A;  2HEK A;  1IKY A;  2AMC B;  4A8K A;  5MLC V;  4DR7 F;  3C6U A;  3I0R B;  3JS9 A;  3EGV A;  4C97 A;  2YNI B;  3GG0 A;  4HDG A;  2W9C A;  2K7J A;  2I6W A;  5J2M A;  2CQ2 A;  2WOM A;  3GR1 A;  3N9U C;  2FD2 A;  3EMT A;  3HSD A;  5DLF A;  5D4N A;  1S7I A;  1N33 J;  2OD6 A;  5HP1 B;  2GGP B;  1VK3 A;  4DV0 J;  2DNR A;  3BF4 A;  4C8M A;  2R8H A;  1AUD A;  2HVI A;  3TVK A;  1RTJ A;  2JXH A;  2FZC B;  2YNF A;  2Q6C A;  3CD7 A;  2H54 B;  1S1T B;  1SJR A;  5DLG A;  1UFL A;  1JXL A;  1HQU A;  2CPI A;  2OIH A;  1F9E B;  3OR2 B;  3QRP A;  4EO6 A;  3HHL D;  4ZLN A;  2ZNZ A;  3S01 A;  3M6W A;  4J7C A;  3V6H A;  1KLM B;  3FGV A;  1R0B G;  4FF1 A;  1UEU A;  4PZV A;  2XYP B;  3LUY A;  4NOH A;  1N36 J;  3PHT A;  3P3D A;  3HHK A;  5ETV A;  1C1C B;  3CUN A;  2IYI A;  4I67 A;  3NGS A;  3FEZ A;  2LMI A;  2ZWO A;  4GVB A;  2LDI A;  2KXF A;  1UWA A;  2RE1 A;  5HL7 Q;  1HHQ A;  2OPP A;  5KOX A;  4UZC A;  5CAA A;  1TAQ A;  4PG5 A;  1BC6 A;  5KFR A;  5A2Q U;  2NR0 A;  2M70 A;  2RU9 A;  1VQY A;  4PPZ A;  1KSP A;  4B9U A;  2CPH A;  4IOB A;  3KFW X;  3DC2 A;  1QUV A;  2EKY A;  3CF5 Q;  1NM2 A;  1FRJ A;  2N82 B;  2E5L F;  4KT0 C;  3L09 A;  3QJJ A;  4ED1 A;  3R9L A;  4NCG A;  3ONQ A;  1Q53 A;  3CED A;  1PJ5 A;  3NL0 A;  2AV5 A;  4CO3 A;  1Q86 T;  5HQM A;  1SI9 A;  3HMJ G;  1M5O C;  4JI4 J;  3TA0 A;  2N7C A;  2XSF A;  2QL5 B;  4FXE A;  1TP7 A;  4EGL A;  4PQU A;  1GQE A;  4J9M A;  3JTO A;  3D68 A;  4DLE A;  3K5O A;  3MPU B;  2GS8 A;  1O5J A;  2NUU G;  3GFX A;  4M63 A;  4AQY F;  1NME B;  4CRJ A;  4U67 Q;  1O8B A;  2V2Z A;  2JC0 A;  4OHZ A;  1MRO B;  1UW4 A;  1JJ2 R;  4PG8 A;  1IKX A;  2OPQ A;  4X4R A;  4XAK A;  3PYD A;  2U1A A;  3VQS A;  4O3Q A;  1URN A;  2AQ4 A;  2AYG A;  2G13 A;  5C7P A;  2GNK A;  4JV1 A;  3BBB A;  2MY8 A;  1IVZ A;  1NPR A;  4N8O A;  2Y3Y A;  1RT4 A;  1RTD B;  3QQC D;  3HJF A;  1WJ9 A;  5LSR A;  1BDT A;  3J81 U;  1RAD B;  1NDC A;  4GO7 X;  1I3O B;  2VBY A;  5AXM A;  3CNQ P;  3LP2 A;  3K5M A;  5HSP A;  4TQS A;  3CXC R;  3EIC A;  2IDE A;  3KLF A;  3G71 S;  2FGO A;  1WUU A;  3V4I A;  5DJB A;  2O1P A;  2MZS A;  3FCH A;  1B99 A;  1IJF B;  5J2N A;  4X4Q A;  2V94 A;  1RTI A;  3R7B B;  3OR1 B;  2R7O A;  1NKC A;  1JLQ B;  1D8Z A;  4AL6 A;  5EWE A;  2UVW A;  4RW8 A;  4TYB A;  5IT0 A;  2XMW A;  1FRI A;  2KT2 A;  1NK6 A;  2AX1 A;  4QIF A;  2IJF A;  1QAJ A;  2E7X A;  3M05 A;  1DQ9 A;  5L1L A;  1DHM A;  4BS2 A;  1TL3 A;  1F3F A;  1ZTW A;  2OEK A;  2OO4 A;  1K1Q A;  3LGH A;  2WON B;  3PW4 A;  4QR0 A;  2MKY A;  1FFS B;  4H4K C;  4ETX A;  3R5A A;  4K7Q A;  3FEY B;  5EWF A;  2DGS A;  1U25 A;  1MU2 A;  1P1T A;  1WG5 A;  3V2U C;  2HRY A;  3V6K A;  2ROP A;  2YNH A;  2BSQ E;  4I2Q B;  4QIG A;  2HAF A;  4K5S A;  3NP5 A;  2HZA A;  4ZKA A;  5FJ4 A;  3NWR A;  1ELO A;  4J90 A;  4DV1 F;  2OPS A;  3ZO7 A;  3G8S A;  1ARO P;  1KQK A;  4LFC J;  4DLG A;  3RAQ A;  4RPF A;  1IQT A;  3UW1 A;  1F5A A;  3K8V A;  5DZ6 A;  3HFZ B;  3IG1 B;  5A0Y B;  4DV4 J;  2NZ4 A;  2A3J A;  2PC6 A;  2VG6 B;  1N36 F;  3BR8 A;  4DU7 A;  1LXN A;  4GRS A;  4P10 A;  3BPD A;  2LXF A;  2V2V A;  3ET6 A;  5LMU F;  4HVZ A;  1VQ7 S;  3T1Y J;  2XB2 D;  4MFB B;  1U24 A;  1EP4 B;  2QYC A;  1N54 B;  2LQ8 A;  4M5N A;  5HQ8 A;  3MOZ A;  3CSK A;  2DR7 A;  4HTI A;  1CVJ A;  3RUB L;  1YBU A;  1ZA2 B;  3VF0 B;  5E33 A;  2XBP A;  4ZCK A;  5KFB A;  2KDO A;  1IWG A;  4BC7 A;  4ZLP A;  2YKQ A;  3D6H B;  3ENW A;  3SDE B;  4RWW A;  1A0O B;  3FQL A;  1HBO B;  2M88 A;  1RB0 A;  4OZ3 A;  1FTR A;  1RBL A;  2CYY A;  4A46 A;  3W2V B;  3BGF A;  1NO8 A;  4ICL B;  3DRY A;  1HFE L;  1NAQ A;  1WEY A;  2Y1L B;  2VA2 A;  3DGP B;  5HN0 A;  1C1B A;  4C3M A;  1M5V C;  1WOR A;  4JI4 F;  1JX4 A;  3L7O A;  5B0G A;  4ZPD A;  2NUH A;  1MWY A;  4KB7 A;  4OJ1 A;  3BV8 A;  3KWM A;  3CJ8 A;  3AJ2 A;  3PIO Q;  2QLJ B;  3H90 A;  4ZS6 A;  1WG4 A;  3M8Y A;  1HBM B;  3VQT A;  4JOU A;  2Y1J A;  4KAI A;  2AKW B;  1M5H A;  2HQD A;  5D0R A;  3FUY A;  2B6A B;  1E6Y A;  2ZUA A;  1VIO A;  4YB5 A;  1KLM A;  5HAT A;  3CCZ A;  4OX6 A;  1HKA A;  3BQ2 A;  1PBU A;  3VZH A;  1FXR A;  3CCL S;  2RSQ A;  3RU0 A;  1LWF B;  1QSS A;  2V50 A;  3CJ4 A;  3HPO A;  2GC8 A;  3Q22 A;  1MMD A;  3ISN D;  3D1Q A;  5KT3 A;  3KNA A;  3GLJ A;  1BUX A;  4C3K A;  3FBB A;  3DMJ A;  4NYP A;  4ZHR B;  4URQ U;  2BNZ A;  3CO9 A;  4NLT A;  1RAB B;  3CTR A;  4XPE A;  4ZP8 A;  3NNA A;  3BN7 A;  3QJP A;  3ILI A;  1PKU A;  3MDF A;  4Y3C A;  3JAM Y;  4B3R F;  3PRB A;  3VGS A;  5IV3 A;  3CC2 S;  4RX6 A;  1YTY A;  7FD1 A;  5KFC A;  4RW7 A;  2FUG 9;  2MQM A;  3I9V 9;  4M1K A;  4DQP A;  4FKY A;  2ROE A;  1IUJ A;  3Q8U A;  4Y28 C;  2LLZ A;  4N47 A;  1FXD A;  3DLL Q;  1ZET A;  4USK A;  1DJ0 A;  1KON A;  3UFC X;  1CSJ A;  3RG6 A;  4LR8 A;  2K06 A;  2W1B A;  3NMR A;  3JYT A;  3G87 A;  1EB0 A;  5J1P A;  4NZ6 A;  2L08 A;  2QLF B;  4CQ1 A;  2DPJ A;  2HSE B;  1TL7 B;  5ETQ A;  3H4B A;  3ZTQ A;  1XBW A;  2E1A A;  2ZEJ A;  4KHM A;  2HQG A;  2CWK A;  4BC9 A;  2UU9 J;  1S49 A;  4JI6 F;  4ED7 A;  4OI4 A;  3DU6 A;  3GIR A;  2AWZ A;  3FKB A;  4UUX A;  4WKY A;  3B6B A;  1FNM A;  3OTO J;  3W8G A;  2DNN A;  1BWE A;  3CCW A;  3ZTO A;  3FBE A;  1W26 A;  3BSA A;  2K29 A;  4LRF A;  2XZW A;  2J6U A;  3JSB A;  4YDX A;  4PAA A;  4RLE A;  1Y5I B;  1EA4 A;  4ZP6 A;  2J0X A;  4DS4 A;  1TUW A;  1S1U B;  3L95 X;  3MMB B;  4F8R A;  3KHL A;  4DV4 F;  4X4T A;  1S6U A;  5KFP A;  1S77 D;  1G3O A;  1PC5 A;  2POK A;  1KQF B;  4M95 A;  3CDA A;  1B70 B;  2QA4 S;  2D3O R;  5DQI A;  1RAO A;  2JVO A;  2D7S A;  3N79 A;  2E1C A;  5ETS A;  4P74 A;  2X1F A;  3FMT A;  2UV8 A;  4JI3 J;  3T1Y F;  2HAI A;  3MM9 A;  1C0U A;  4CLU A;  2V69 A;  5L39 A;  2K6L A;  1N6Q A;  1IBM F;  1V3R A;  1Q5Y A;  1S59 A;  3M30 A;  5AE1 A;  4Y2A A;  4HHH A;  2BJ9 A;  1YKW A;  4LFB J;  1AW0 A;  3BH6 B;  4DJB A;  1NJX A;  3QRQ A;  3E01 A;  3THV A;  4KGV B;  3Q2T C;  3D2W A;  2D74 B;  2HQ3 A;  4ANE A;  4F04 B;  1S6O A;  1IKV A;  1SKU B;  2AJ2 A;  1TKZ A;  2AJF E;  3C46 A;  3PKY A;  2RHS B;  5BYR A;  3PCO B;  5KG3 A;  3UO0 A;  2ZDO A;  2XMU A;  4CH1 A;  2XYG B;  3M8P A;  2C28 A;  1UMJ A;  5CH7 B;  4LRC A;  4Q8F A;  3KOA A;  2JDJ A;  1NK5 A;  1GX6 A;  4I2Q A;  4DL4 A;  3I0S A;  1KFD A;  1X4F A;  1YZ7 A;  2R9L A;  3HF5 A;  3TVY A;  2J8S A;  4GKK J;  3Q8Y A;  4B9L A;  1HR0 J;  1N8R T;  2CQP A;  3KJQ B;  2HHT A;  4PRF A;  1HPZ A;  4O44 B;  5GMK a;  1JLG A;  1SJ3 P;  1WF2 A;  1BGX T;  2OD4 A;  4G3I A;  5KFS A;  4F7V A;  2WBR A;  3Q8Q B;  4ECS A;  4CZC A;  4CO5 A;  3IG1 A;  1TAU A;  2I1R A;  2HND B;  1BMQ B;  2ZH5 A;  2CVI A;  1NPP A;  1RJJ A;  4DV3 J;  2ZH4 A;  3M4X A;  4WU3 A;  3LGM A;  2MQL A;  3IS9 A;  5A2Q Y;  3NCQ A;  4HDH A;  5HAO A;  1SIZ A;  3BR9 A;  4ZVE A;  3DRP B;  4WIQ A;  3IMQ J;  3TZX A;  1X5P A;  1S76 D;  1YVF A;  1IBK J;  2M3D A;  4WXO A;  2PFD A;  1BAZ A;  5L8R C;  4PUO B;  5HO4 A;  3ZZO A;  3PX6 A;  1SB6 A;  4ZJO A;  1L3K A;  4MTP A;  4ZLL A;  4Q0B B;  4CLY A;  2H5J B;  2LU2 A;  3EPI A;  2CPX A;  5E2Q A;  4AL7 A;  1AA1 B;  4OX7 A;  1IBL J;  2NPF A;  2VD3 A;  1ZTT A;  2XI3 A;  4KR0 B;  1CS4 B;  1RQ0 A;  2OI2 A;  4CIO A;  2VON A;  4O3S A;  3FJ2 A;  1WI6 A;  4FDF A;  1AYE A;  2ALZ A;  1QAY A;  3OL7 A;  5KT7 A;  2DNZ A;  4CP5 A;  2CJB A;  3MMC B;  4OZJ A;  5D4L A;  5ETR A;  5F8G A;  4JBC A;  2EC2 A;  4C48 A;  5A8K B;  4TY9 A;  4JI5 J;  1HQE A;  3PDN A;  2QA1 A;  4EZ9 A;  2K3K A;  2J9D A;  2K5J A;  4B9N A;  1EIY B;  1JWW A;  3Q83 A;  2W9B B;  2G1D A;  4ELT A;  1SXL A;  4DR2 J;  5KFX A;  1X60 A;  1WKK A;  4F4X A;  2YQ1 A;  3MMA B;  4LQ9 A;  3ZNU A;  2KEL A;  5GAD U;  3FC9 A;  1NDK A;  1V3Z A;  4QW9 A;  3PW2 A;  3T5K A;  4AND A;  3UCU P;  2RHQ B;  3ENQ A;  4JI3 F;  2GW8 A;  4DSJ A;  3QGI A;  4B3M J;  1FK9 B;  2DGW A;  5KT6 A;  4V1A k;  2EI5 A;  4KKO A;  4X66 F;  2B9X A;  2C2M B;  3W8P A;  1H73 A;  4LF5 J;  4DL3 A;  5K9F A;  5K8N A;  1WI8 A;  3KJF B;  1VQ9 S;  3JSY A;  2GHV C;  2FLN A;  1K47 A;  1H2V Z;  4G1Q A;  2ZBC A;  5L1J A;  1H7W A;  4LUB A;  3DXB A;  4WTY A;  1VLY A;  1B01 A;  4DCP B;  1BQM A;  2X7I A;  1M90 T;  2YWK A;  4HEA 9;  3R8Y A;  1OS5 A;  1H98 A;  1HYS B;  1D09 B;  3M6V A;  4U7C A;  2EXU A;  4DR5 J;  3AXK A;  2N3L A;  3OTE A;  3MUM P;  2J9C A;  2ZC3 A;  3MM6 A;  4X84 A;  2GA7 A;  4GKK F;  3IBC B;  1MW7 A;  3SCJ E;  3UDL A;  4RL1 A;  2SXL A;  3LPE A;  2CJK A;  3NY0 A;  2X1G A;  1U6F A;  3PO5 A;  2QG9 B;  4ZVF A;  3SCI E;  1TL1 B;  5ITH A;  2NQP A;  2WK4 A;  3VZI A;  3K57 A;  2GPE A;  2HHV A;  3OPK A;  2C42 A;  3MMB A;  4P2M A;  1F9F A;  1HBU A;  5KFZ A;  2CPY A;  1IXK A;  1F1B B;  3AOD A;  1EKS A;  3UN2 A;  4DV3 F;  1VQ4 S;  1KDN A;  1LWE A;  3O1L A;  4CO2 A;  1VRQ C;  3ETM A;  1UVN A;  4F4K A;  4FVC A;  1K44 A;  2BKN A;  3TQ1 A;  1TVR A;  5G4D A;  1H2U X;  2VPZ B;  3TI0 A;  4B9V A;  2I8E A;  4OMF G;  1UPP A;  4R8U A;  3GYN A;  1IBK F;  3VAF A;  2E1P A;  4LSN B;  3SI8 A;  1U1K A;  4KO0 A;  3IAM 9;  3Q86 A;  4DUY J;  1CLF A;  3R5G A;  1VIX A;  5D4P A;  2HLT A;  3HKW A;  2HNZ A;  3G6E S;  4C8L A;  2VAS A;  3W64 A;  3VV2 B;  2YH0 A;  2PMZ D;  1U8W A;  1IN0 A;  3ITH B;  2IRY A;  1BXN A;  1TU0 B;  2BE2 A;  4LF4 F;  3R1H A;  2OML A;  3PHE A;  1RWM B;  4A8M P;  1IBL F;  1Y0H A;  3M6U A;  2HHU A;  2JXI A;  4EK2 A;  1GAO A;  4URS A;  3GU0 A;  3CDW A;  2V2K A;  4DQQ A;  4DN0 A;  1AT1 B;  5E5N A;  4DV2 F;  3AB4 B;  4HYK A;  3FT7 A;  2R4F A;  3W9I A;  4IG3 B;  2B5J B;  3IRX A;  4LR7 A;  3D0I E;  3R5B A;  5KFA A;  2ZKT A;  2C2Z B;  1JJ4 A;  1F9H A;  3PZP A;  1YGY A;  1RKI A;  3CGI A;  4CI0 B;  1FWP A;  1JK9 B;  4DU8 A;  3BYP A;  5ETO A;  3NAI A;  5CAB A;  3DDI A;  3MEG B;  1ZOT A;  3BH7 B;  1NCL A;  3AHP A;  4GC7 A;  2D41 A;  3PYG A;  5HLF A;  4ZIW A;  1JLF A;  3KMS A;  5K14 B;  4DV7 J;  1KQG B;  4PWW A;  4PXE A;  2B4O A;  3RBZ A;  4YS2 A;  4PKD B;  1H7X A;  1IBC B;  5H9F J;  2A2B A;  5B08 A;  1YBA A;  3HP6 A;  1F2H A;  2DXF A;  3PFE A;  3QZ8 A;  5E3A A;  1W2I A;  1PSD A;  5E41 A;  4FNH A;  1HQ2 A;  2WBM A;  4LMZ A;  5EDW A;  4DR6 J;  4TU8 A;  1K9M T;  5B7W A;  1SQE A;  4W98 A;  5IOL A;  2H65 B;  2BRL A;  5D4O A;  4Q0B A;  5HVG A;  2DHS A;  2YPY A;  1VRT B;  4W4M A;  3UN3 A;  3QMQ A;  2FC9 A;  3N6N A;  4KPY A;  3F44 A;  3PFO A;  4LF5 F;  5DG8 A;  1AUS L;  2AYB A;  5BYQ A;  4EU0 A;  4WFA Q;  1PG5 B;  3BSN A;  3N0V A;  5B09 A;  1PCA A;  2DNM A;  4R5P B;  5JMN A;  2EC0 A;  1E6V A;  2MXY A;  3CUL A;  4JYA J;  2GQC A;  4AL5 A;  5F8J A;  2ZZN A;  3AOB A;  4DF4 A;  2F8M A;  2ZJQ Q;  4AXJ A;  1ZPV A;  1SUQ A;  4M5K A;  4A8X A;  1FA0 A;  4USW A;  3HVW A;  1GX5 A;  4P2F A;  3I31 A;  4RUA A;  3O5T B;  4Q2M A;  4KRW A;  3IRW P;  3K89 A;  2Y1I A;  3CD6 S;  5C25 B;  3TW0 A;  2LEB A;  4DG1 A;  2NCK L;  4RWX A;  3OSN A;  3Q8R B;  4I7F B;  4M5H A;  2DHA A;  1NB2 A;  3FFI A;  4OL8 A;  1RA6 A;  1KBR A;  3ISZ A;  4QQB A;  4P73 A;  1JLB B;  4DCJ B;  5AE3 A;  3KLG B;  1T0T V;  3SMZ A;  3PG9 A;  1GK8 A;  5BJR A;  4QIW D;  4KBI A;  3MPV A;  1YJT A;  1FE0 A;  1PYO B;  2RS8 A;  3FZB A;  2PI5 A;  4Y34 A;  1B0V A;  4YB7 A;  1MWZ A;  1D9F A;  1TUG B;  2F8E X;  4TVA B;  3O3L A;  3AD9 C;  1XNR J;  1WHY A;  4K2X A;  5F0U A;  2FHO B;  3BZQ A;  2KYZ A;  2PMH A;  2BVZ A;  3NS6 A;  3SQO P;  2F9J A;  3WX4 A;  1YIT S;  4DUY F;  1WHW A;  3W9J A;  4LSL A;  2W24 A;  4ZCM A;  3BEG B;  2IRX A;  4ZOS A;  4MYU A;  1GXL A;  4LBI A;  5DET A;  2KJW A;  1Q16 A;  2HGM A;  4IQX A;  1AB8 A;  1WF0 A;  2P6T A;  4QBU A;  3NGT A;  4PWD A;  3T1H J;  2V6A A;  4H4K A;  4O4G A;  2YQ0 A;  4EEY A;  2WVD A;  4XK8 C;  5HK4 A;  2QE5 A;  2V4Q A;  4TNO A;  4OYM A;  2UUC F;  1IQZ A;  4FYD A;  2KKH A;  4JI7 J;  1K0T A;  4YN3 B;  2RF2 A;  1R8C A;  3PJW A;  4C6A A;  3J7Z T;  5LSO A;  1L5U A;  3KLE B;  4IQM A;  4EZ6 A;  2YKM A;  1R0A B;  1HMV B;  4I6Y A;  4U95 A;  3GCW P;  3HCX A;  3T1A A;  3WC0 A;  1D9D A;  2YKN B;  4ECQ A;  2DO0 A;  4IOA Q;  2FJW A;  1VFJ A;  2CJQ A;  4IDK A;  4LF9 J;  2VJU A;  2MHN A;  2KFZ A;  2QC3 A;  1I5O B;  1GFW B;  3NO7 A;  2A18 A;  5C5J A;  2BKO A;  1APS A;  3RBE A;  1R8B A;  1S1V B;  1B28 A;  2OEM A;  2OP5 A;  5K8O A;  1EJ7 L;  4QIV A;  2JXG A;  2PN6 A;  4KY3 A;  3LAK A;  1NJW A;  5E3P A;  1B7Y B;  3ZFV A;  3W9H A;  2W7P A;  3VAH A;  4R0E A;  5DDP C;  3CCE S;  1RBO B;  1FES A;  2MJU A;  3KJV B;  1UKU A;  4M5J A;  2VJV A;  1DAX A;  4A8S A;  1NSP A;  3P49 B;  3MM5 B;  1DY3 A;  2MPU A;  3D54 A;  2MDA A;  4ILM A;  1O6X A;  2NZC A;  4LSN A;  2HS0 A;  1S6P B;  4BLG A;  1U2C A;  1UJ5 A;  3A8J A;  2HBZ B;  3OQ2 A;  1FRL A;  1X5S A;  4M94 A;  2GHP A;  2VC0 A;  2DR6 A;  1YWX A;  3UVJ B;  3W2W B;  3DOL B;  3TR5 A;  5T7L A;  2RU3 A;  3R2C J;  5DDR C;  1VBY A;  2HMI A;  3WZ0 A;  2MZT A;  3SQG A;  3WBZ A;  4Y2M A;  5LXR A;  4C11 B;  3W5Z A;  3BDE A;  2MKJ A;  4AT1 B;  4JYA F;  2B9Y A;  3GV8 B;  1VQM S;  4P2X A;  5L38 A;  4IG3 A;  1R31 A;  2RJZ A;  2OLW A;  3FDS A;  1VOM A;  1H2T Z;  3CO0 P;  3R1L A;  2QT7 A;  4P6Q A; 
#chains in the Genus database with same CATH homology
 2CAX A;  3BKF A;  1NLA A;  2JXI A;  1Q5Y A;  2CAJ A;  3QOQ A;  2FGC A;  1MYK A;  2BJ8 A;  1BDT A;  2WVD A;  2JXH A;  2BJ9 A;  2GPE A;  2BSQ E;  2WVB A;  1PAR A;  2NZC A;  2HZA A;  2BA3 A;  3FT7 A;  1ARQ A;  2BNZ A;  2WVE A;  2BJ1 A;  1IRQ A;  2CA9 A;  4HV0 A;  1P94 A;  2K9I A;  2F1F A;  1BDV A;  3GXQ A;  4ME7 E;  3VW4 A;  1MYL A;  3VEB A;  2K1O A;  3BKT A;  2RBF A;  2K29 A;  4FXE A;  2CAD A;  2BJ3 A;  1Q5V A;  1B01 A;  3OD2 A;  2K5J A;  1BAZ A;  1EA4 A;  3H87 C;  2BJ7 A;  2H1O E;  3PHT A;  1ARR A;  2PC6 A;  1U9P A;  3BKU A;  2BNW A;  1B28 A;  2AY0 A;  3QSI A;  2WVF A;  1QTG A;  2JXG A;  3VEA A;  4D8J A;  3LGH A;  2CPG A;  2KEL A;  1MNT A;  3FMT A;  2Y3Y A;  2WVC A;  1X93 A;  2HZV A;  2K6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...