2WVCA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
132
Chain Sequence
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDEDNPNDESKIAVLVVIYDGGQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 32
structure length 132
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvcA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvcA02
2BJ3A 1EA4A 1BDVA 3GXQA 2WVEA 2CPGA 2WVBA 1MNTA 3BKTA 2BNZA 3VEBA 3QSIA 2JXIA 2BJ9A 1P94A 2KELA 2FGCA 3FT7A 1NLAA 3H87C 3LGHA 1BDTA 2K29A 1ARRA 2CAXA 1B01A 2K6LA 1PARA 2CA9A 2BJ8A 3VW4A 2AY0A 2JXGA 2K9IA 2BJ1A 2CAJA 1U9PA 2F1FA 3QOQA 1B28A 2HZVA 2CADA 1Q5YA 3FMTA 4ME7E 3OD2A 1X93A 4FXEA 4HV0A 3VEAA 2GPEA 3PHTA 3BKFA 2HZAA 1ARQA 2WVDA 1IRQA 3BKUA 2WVFA 2JXHA 2BNWA 2BSQE 1QTGA 2RBFA 4D8JA 2K5JA 2PC6A 2K1OA 2BJ7A 2NZCA 2Y3YA 2WVCA 2H1OE 2BA3A 1BAZA 1MYLA 1Q5VA 1MYKA
chains in the Genus database with same CATH superfamily
1NK5A 2JLGA 4MMOA 2BW7A 3CJSA 1NKEA 2XMKA 4JI2F 4YR3A 2KN4A 3F56A 3Q24A 3Q8RB 3HHLB 3KLEA 4J9LA 4WXOA 2MQMA 3DLEB 4F3MA 2AX0A 3TZXA 3D1QA 3DMJB 5E33A 4UOHA 2HNDB 1ZA2B 2KZMA 4ECVA 1FDNA 1TL7B 5DO2A 2JEFA 1WEYA 3EVOA 2CA9A 1I6JA 1PYOB 1SH3A 3X3UA 3LW5C 2DR5A 4JI2J 1CJTB 4ZVFA 1MU2B 1X4DA 4NCGB 1UW4A 2VQFF 4HL9A 1RCXB 3MMBA 3MDFA 2CYYA 2HGLA 3AOCA 5E0OA 2PEBA 2A6OA 4TLRA 3DU6A 3CWJA 1R89A 1VIXA 5HJXA 2MLXA 4OYIA 3C66A 1RWNB 3D0IE 5IM0B 2AQ4A 4IR1A 4J9VA 4LRDA 3FKBA 3KJFB 4RUBA 1X31C 3AB4B 4OLOA 1SKWA 5HJYA 1BXNA 1X5TA 4EWTA 1K0VA 2IVFB 1V3SA 2QV6A 2JRSA 2KTQA 3DLGA 2LEBA 2JFDA 1YBTA 1RTZA 7FD1A 3MTKA 2XEXA 3QSIA 3BV8A 2J6SA 1WHWA 2UZAA 3K89A 1LWFA 3IWNC 1VGYA 2IFXA 3RB4A 3FFIA 1H2VZ 1AUSL 3IBCB 3IR7A 1MWQA 2AYEA 1WF2A 3SQOP 3KLGB 3JYTA 4W4MA 4ECRA 2AJ0A 4CO2A 2RIJA 4ZCLA 1U1OA 2DY9A 1J5OA 4I2QB 1JLBA 5IC6B 4FPIA 1NAQA 3LAMA 2Z57B 1OYEA 2ZZMA 3BGOP 2ZH7A 1Q95G 3D6FB 4AFFA 1FXRA 1ICEB 4ZLLA 1S9GA 4EBCA 1B3TA 3P49B 2DNRA 2QLXA 1T95A 1RU1A 2H51B 4DR4F 3BQ2A 2WVBA 1HBUB 4NCAA 3L7UA 2IBOA 4IOAQ 3OXLA 5CA5A 1UVLA 1FJEB 2QRRA 2G9OA 4DPTA 1VDHA 3JTOA 1B7FA 3GIMA 3FSXA 1FDDA 3OTEA 1JJ4A 2XYPB 2VKRA 3DN9A 4URSA 1MROB 4DX6A 4DR4J 1K8AT 4I7FA 4Y2CA 1ZM2A 3EXYA 5KOXA 1HW8A 4J9RA 2XG8A 4ES1A 2VICA 4IQXA 1HMVB 1EAYC 5IT0A 3MMAB 2CG4A 3M9OB 1FTRA 5LMNJ 1U2RA 3CF5Q 4LFAF 4K4VA 2VL1A 5KFNA 4DPXA 5D3GA 1G7CB 4DUYF 4N8OA 3MHYA 4ED4A 1UAWA 1WC5A 5KT7A 2DNHA 1PYTA 3VTIA 2B9YA 2KJWA 3DLKA 4RW8B 3Q0AA 5J1NA 2ASYA 2XULA 2WVEA 3D6MB 4ED3A 2ZNYA 2W2OP 1U25A 2C22A 4WWSA 2YNGB 2Z2ZA 3UW1A 2BJDA 3VCDA 2BNZA 1QDUB 2K06A 2XQCA 2LCWA 4QW8A 4DR1F 1TL5A 2BA9A 5I42B 4YHHF 2MYFA 3G6VA 4GVLA 3BR9A 3HHDA 2UVVA 3TZZA 4M5IA 1KONA 3TI0A 3JAMU 4I69A 2B5JB 2JC0A 4BS2A 2LP4A 1RCOB 3E51A 4KHMA 1HYSA 2MJNA 3M8RA 3OTOF 4DR1J 1FX2A 2PMHA 2PFFB 4LIWA 3VQSA 3ZTSA 2JXHA 2UVUA 3DYAB 2BEFA 2CPJA 2ZBCA 2XLJA 1TL3A 3W8GA 3OTOJ 2C28A 3CCZA 1HHTP 3ITHA 4CO0A 2Y8YA 4WE1A 3BF4A 2CPGA 1SUQA 5H9FK 1HD1A 2EEYA 2GVZB 4NLDA 1RXOB 2B7CB 2R8HA 2FHOB 4OV1A 4R8UA 4J9NA 1SI9A 4P9SA 2IC3A 3SQGA 1KHWA 1S5ZA 4DQRA 1WDDA 3K7RA 4NX9A 1OIAA 1C1CB 2D3O1 4ZN1A 3RJMB 5K20B 4WZMA 2UVRA 1JXLA 4ILMA 2BANA 2DRAA 3GSDA 1EX8A 1GEHA 4PQAA 3W64A 3C46A 4CM2A 2Z2YB 4H4MA 1QSSA 3CCES 2OJ3A 3H25A 5DQIA 1NDCA 4A8MP 2VV5A 2NUUG 2YNFB 5M2UA 1FX4A 3PO5A 2WSFC 5A8RA 1JQGA 3H4BA 2DNQA 4OJ3A 3IWXA 2NXCA 2DR7A 5DGBA 1FK9A 2E5LF 4RBUA 3E01B 1GNKA 2JBVA 1SH0A 3CNQP 3SEOA 4TU7A 3S8SA 1AROP 1BAZA 3VAFA 2ZZTA 1YJWS 4O4GA 1FJGJ 1NSKL 3CDEA 2WK4A 2EFQA 1BC6A 2M8DB 4L3NA 4DN0A 2JOQA 2DTJA 4TQRA 2CZ9A 1QAJA 5A0YB 2VOPA 3DXBA 4NRTA 1JKHA 3GJTB 2E5LJ 3C6UA 3A3PB 3RB3A 1RWWB 2MLYA 3GSIA 2QA4G 1YTYA 1VQ4S 1ARRA 2Y9HA 4OZ3A 3NWGA 4QWCA 4U7UD 3CD6S 4F67A 1LWXA 4DV6F 1IKXB 3PX6A 2V8DA 2MZSA 3IM8A 1KOHA 3BEGB 2XMJA 4MJWA 4EYIB 1JLAA 2DHXA 3R5GA 3PIOQ 5ETSA 3SV4A 2AT1B 5HK4A 3TYTA 4HT5A 3KLIA 2KG1A 1VQYA 3OHBA 4DHVA 1NK8A 1LWCB 4DV6J 2NYIA 4AQYF 1WHYA 1REVA 3LWLA 3HVTB 4X64J 3UVJA 5ETQA 2E66A 3GFXA 4AUKA 3DCAA 3IAS9 3HFKA 4Y2KA 2BYCA 3VR1A 1YG0A 3K57A 1F9EB 1LOUA 4JI4F 1MNTA 3L95X 4AQYJ 3IG1B 2ZWPA 4DWIA 4LR8A 4OLPA 3T1HF 4A8OA 4FBTA 2GAGC 5LXRA 1S6UA 3UCGA 2F8EX 2NXJA 4MTPA 2WCXA 2MKJA 1PKUA 1R8AA 3QT5A 3LP0A 4NXMJ 2FZGB 1S12A 3M6UA 3UR0A 2FLPA 3OFEA 2HMIB 2HFUA 2BJ1A 4AL5A 1WG4A 3U27A 4XPEA 1CJVB 3L7PA 3T1HJ 2X7IA 4MAKA 5B09A 5DETA 1VBXA 5B7WA 3OHAA 5G4DA 1PILA 3KHHA 5F0WA 1IBCB 3PYDA 5ETKA 4KHPF 3SYZA 3TEGA 2DR8A 3ZO7A 1TKTA 3CIZA 2XHWA 2WBRA 1Y11A 3IGVA 4CLWA 4RL1A 5AJ3F 2DNGA 2V68A 3KUEA 3MEEA 3QIPB 2EXUA 2Z30B 4U9RA 5KFOA 1T9YA 1T9VA 1H73A 2G1DA 3H5UA 4FF3A 3GP9A 4DJBA 1U48A 4USKA 2IAJB 2EG1A 2MZJA 3AAWB 2AKWB 4EUVA 1P94A 3J7YU 2HHTA 3VAJA 5AJ3J 1VHIA 2OPQB 3UD5A 2VG7A 2RAQA 1HHSA 2QT7A 5F41A 3LWMA 4WTYA 3BSAA 3JXOA 1N56A 2OO4A 3TWZA 1U1MA 2HHXA 4PCQA 5DDPC 1CJUB 2PFDA 1NPKA 5KG4A 1I1GA 1QTMA 4B3MJ 5DGAA 3M8WA 2HZAA 4ED5A 2IDLA 2CVEA 1FKPA 4HDHA 1XC9A 2W2QP 1NKBA 1Y4ZB 1KLMB 2K1RA 1UVIA 4FF4A 4LFBF 1KP6A 3KDNA 1D8ZA 4ZOSA 3AY0A 4FNHA 1JLEB 3M6WA 3IRXA 3N6NA 1S0VA 4K8RA 2ERRA 2VQEF 1M1KT 1RT2B 1P27B 2GMLA 3W1YC 4FF2A 1WHVA 1KSPA 2HSEB 1V9OA 2JXIA 3D4JA 1Y5NB 1UJ4A 2PN6A 2K7KA 4K4SA 5H1SV 1NUEA 4C9DA 2DRBA 1FE4A 2OSRA 2XZWA 2CPFA 5LMUF 4N76A 3EXCX 4ES3A 2CQPA 1S1VA 2GHPA 2UXDF 1GMUA 4YDDB 4D3HA 2CUYA 1HWKA 3RB6A 2K7JA 3GFYA 2XWXA 3MCNA 1HIYA 2V9KA 3M2UB 4AXIA 1KVIA 3GYGA 3N5FA 5LMUJ 3DLJA 2V8HA 1DLOB 1IUJA 1S1XB 4JI0F 2C3PA 2EK1A 3NGRA 5ETRA 2UXDJ 4ID5B 1RWOB 5HMXA 5DRKA 3EGNA 4KT0C 1TQLA 1VRUA 1Q5VA 2GS8A 1NZAA 1UFLA 2DXDA 3BSOA 2AZ1A 1N36F 4Z7CA 3PNIA 4WIIA 3TW0A 1PYSB 1ZM3A 5GAEI 1XNRJ 5C2GA 3RAQA 3QLHA 2DNMA 3RBDA 2HFNA 3HHNB 2ACMA 4ECQA 1PC4A 2ZHBA 3T1YF 1GMVA 2Q6BA 2EFVA 2XGPA 3BR8A 3HK2A 3DU5A 5HSPA 2CJ9A 4URQU 5F3ZA 2G0JA 4ECZA 3HFZB 3T9NA 3ONQA 3V6DA 1J5EJ 1RP5A 3SCIE 1LK7A 2B56A 3I87A 3ET6B 2GQCA 3P5TL 5HANA 2KOEA 3R5DA 5HMWA 3G2XA 2KXHA 2DKOB 2PO4A 1S6PA 1EP4A 4PPZA 4PXCA 5K8MA 3PRVA 3QRPA 5F9NA 1GQEA 3FSIA 2HBRB 4V19J 1UJ6A 5KFUA 1UKUA 2YWHA 1FCAA 1IBKF 2M3DA 3PW2A 2Q43A 5HBMB 4MIBA 1SB6A 1MW7A 4PXDA 3UCUP 4F8RA 2LXUA 3MCMA 2DISA 4A8SA 2UUWA 4CIOA 3OQ2A 4C48A 1M5OC 3CVKA 1IBKJ 1FD8A 4OX9J 3OBIA 4JB8B 3IP0A 5F3TA 4OZNA 1FRMA 2H3AA 3O5TB 1VRTB 2RD5C 3L7OA 2J8SA 1Q5YA 2H3EB 4KH0B 4QR2A 1T3OA 3LF0A 5D4LA 4W90B 3FGVA 2MMYA 4G3IA 3KHLA 1QTGA 3UR3C 2PA3A 5KFCA 2K2PA 3CCMS 2IM2A 1M1GA 2H9ZA 1R8BA 2WB4A 1QSYA 2VDHA 2BJ3A 5J2MA 3CDAA 2N3OA 1FO1A 4MKVA 2KB2A 3RTVA 4HR2A 2KHDA 3UQSA 2UUBF 2FJDB 4USTA 2FVSA 2LQBA 4DN9A 4TNOA 1RKJA 5AXNA 3D5MA 3VEBA 1MMDA 1SC4B 1OY9A 4DL5A 2RQCA 4FN5A 3A12A 5J2QB 4YDXA 2YNHB 4C7QA 4HHUA 1YSJA 2LYVA 3F73A 1EETB 4FYWB 1N88A 1E6VB 1TK0A 2UUBJ 5CD4H 1WJ9A 3GCWP 4B17A 2XM3A 4UQGA 2BR0A 2R9LA 4AL6A 2AJ4A 1M90T 2R8GA 2EFNA 1WORA 2XWYA 2XY7A 2FLNA 2FC8A 4FF1A 4QBUA 2NSCA 8RUCA 2HAIA 4DQQA 1BMQB 2E9RX 2CPYA 3UO0A 1F5BA 2QA1A 2W24A 1U1RA 4OYOA 4JI5J 2A6MA 1IKYA 1RBAA 1PJ6A 4BLGA 1RT4A 2XGQA 1WG1A 4DF8A 1Y3JA 2HWHA 3NS7B 3MM9B 1HBNA 2M9KA 2VFVA 9RUBA 4ZIVA 2CPHA 5CYMB 1U49A 3NBPA 3RB0A 1MWZA 3H4DA 4QPTA 4NLTA 1VQPS 1RHMB 1TKDA 5KFYA 1RWXB 3FNNA 2VZ9A 3O44A 1OSCA 1IQZA 4KV8A 2W4PA 5G0RA 1MN9A 2CZ4A 4ENOA 4BWJA 4GVBA 2RF2A 3CCRS 3OR1A 2IY5B 1TL1A 4A8WA 2WHOA 4TVAB 2LU1A 5EGYA 3EPIA 3OV7A 1HD0A 3BGRA 4NLPA 1EKSA 3K0JA 4C4WA 3T5HA 5B0AA 1ZZNA 2LA4A 3RAXA 1RT5B 2R7SA 3PV8A 3HSGA 3M6XA 4LF6F 3KXDA 4P52A 2NS1B 5ETMA 4P7VA 3C6TA 1Q4RA 5KFIA 3GFHA 3K5MA 5GAHU 1ZAWA 2VG5A 4USHA 3FEYB 1RT3B 4JOUA 4C8MA 5DJBA 1RYSA 2ZEJA 3IS9A 4B9NA 4IFYB 2CQ0A 4ANCA 2ROPA 2V69A 2EC0A 1NK6A 1HW9A 4IH6A 2APOA 2UUAF 2WBMA 4XTTA 3EMTA 2BKOA 2VIHA 1S97A 3FC9A 1WF0A 4KO0A 1UVMA 4FXWA 1S9EB 2R7WA 2YX7A 2BJEA 1WC1A 4X4TA 2AEMA 3ZTQA 5I3QA 3W3SA 3DOLB 1XTZA 1RT1B 3NGSA 4KTQA 5HP1B 2CIMA 2HRYA 2B4UA 4ED2A 2OKQA 2J9EA 3KK1A 2XZTB 4LRBA 3MAQA 2FUG9 4NEZA 4B3RF 4WFYA 1P6TA 1D0EA 4ZKAA 2QLJB 5IT9Y 1TKZB 4K59A 2HW3A 1G3OA 2JVRA 5CQGA 2D9PA 1NDPA 3TUPA 3HJVA 3JSYA 4ETXA 2XMAA 1S99A 2DNKA 5K5MA 1M5HA 4B3RJ 1NJZA 5ETVA 3DC2A 4TYBA 4IFVB 3NOGA 4PRFA 3I0RB 2MHNA 2RH3A 4RUCA 2FLLA 2G1HA 2POKA 4EBEA 4DR6J 3CCQS 4UTGA 2AU0A 1QJHA 3QNWB 4A4JA 1SH2A 4UZBA 1B01A 3TP2A 1KQSR 3W61A 4ZLPA 4EGLA 1VBZA 2HS3A 1YJRA 5A8KB 1ZOTA 4K4TA 1RWVB 4ECWA 5IV4A 1A0OB 3MM7B 4HH1A 4A48A 1Z2LA 4CLUA 3PIPQ 4ZCKA 4N7TA 4DV0F 2XMWA 2DJWA 1JLQB 5HQLA 5IQ6A 4NA2A 1WD6A 2G2YA 5DQGA 1QAIA 2FHKA 1R31A 3SFGA 2V4JB 4KJIA 4KY3A 4MFBA 2GMHA 1YKWA 2QMXA 3WBZA 4DV0J 4L73A 5L39A 5GADI 4ZCIA 4C11B 1NRKA 3OUYA 1U8WA 2ZZNA 3J81Y 2KU7A 5DM6Q 2J9CA 4PEOA 5RUBA 5E5NA 1OO0B 1KFSA 1RTIA 2ZBRA 2ASDA 2CQCA 4DV2F 2XB2D 2HQGA 1WEXA 2JJ4D 4U8YA 2GIFA 4ZPBA 4R5PA 1QAXA 1S4EA 3UN3A 2BJ8A 2VC0A 2A1BA 4E2FB 1Y9OA 2AGQA 2H5JB 3R5JB 4I0WA 4B02A 1BQNB 3CEDA 1IJFB 4HACB 2FDNA 2CJQA 5C24B 2E1CA 2BQUA 1ZYQA 4NMLA 4IQMA 2EPIA 2L08A 3PO4A 1RACB 2KXNB 2MKKA 2BUNA 2HNZA 1HNVA 2AMCB 2JEGA 3L4BC 3OVBA 2VONA 3C16B 4ANDA 3A1YG 4XO0A 1SCJB 1EZZB 3I4HX 1FRHA 2QO3A 2XSFA 3BN4A 2V6AA 1T03B 2HYIB 1BQMA 1Q1KA 1V3RA 5LL6d 4N56A 2QMUB 2XSJB 2LQ8A 3PW5A 2NXUA 8ATCB 4GC6A 4DL7A 3O6QA 3W7BA 4TLQA 2VD3A 2QEXS 1FF2A 2F5GA 3GMGA 4Y6IA 1VOMA 1FKAF 4PUOB 1TVRB 4C3MA 3OLBA 2Q3PA 1S4FA 4J37A 3Q8YA 3ZC4A 5GAGI 2YH1A 2E1PA 5EWGA 3ELHA 1SC1B 5J2NB 2AGOA 3NL0A 2U2FA 1PIEA 3UFCX 1U24A 1YBUA 4Q5VA 2OGUA 2R7QA 3C8YA 3HHLA 2EI5A 4Y2IA 2QG9B 2VASA 3DMJA 3MR7A 3G9CA 4U95A 1I51B 3VVTA 2HNDA 1E6YB 1S7IA 4Q0BB 4CCHA 3MEDB 4XK8C 2ZJPQ 1TL7A 1RYRA 1FNMA 2MXYA 3TVKA 1EA4A 1WEZA 2DR6A 4F4YA 3UN5A 2ZJQQ 2XTJP 1CJTA 1MU2A 5DS7A 2O3DA 1D1UA 1N6QB 1H74A 5FIIA 5JJBA 4J9QA 3OSPA 4W98A 5KFVA 3AD9C 5IM0A 4Q45A 2FZCB 1S1TA 4XAKA 4UY85 1PBUA 4DPOA 1N32F 2J7UA 4DR2F 4C3LA 1B64A 5IQQA 4AXJA 2KRBA 4OYZA 1SJ4P 1YJ7A 1I94F 5LJ3Y 1CQNA 2YXLA 4IR9A 2LEPA 1H7WA 4UOGA 4R0JA 1YRXA 2DGOA 5DM7Q 3R5AA 2MKIA 4UUWA 4KGKA 2BE2B 4HYKA 2CZVC 1NSPA 4DS5A 1I94J 1XWLA 4HDGA 1YZ7A 1NDKA 3G86A 2BE9B 2MQLA 3I5CA 5IWAJ 3KLGA 4ZIWA 4ECYA 4DSFA 1HBMA 2KXFA 2DR9A 2CKWA 2ZVSA 3S6EA 4G65A 2EFGA 2DPJA 2BX6A 3D2WA 3I4PA 3PJWA 4ZN3A 4FYDA 1UETA 2F9DA 4LF1A 4ZP6A 3MPWA 5THWA 4IRCA 2G4BA 1VQKS 1N4LA 2V2ZA 4FKYA 4IYQA 1A6LA 2E9ZA 3SCLE 1TTHB 1RBOB 2C2NA 5EWEA 4YB6A 2B8QA 5E41A 4GKKF 4M5LA 3G8QA 1BQXA 2V8GA 3ZNUA 5EN1A 3QGHA 2QLBB 1MROA 1FFGB 4OYAA 3Q2TC 4DV7J 3JQJA 1RHJB 1JMTA 2LXIA 4CH1A 1G4CA 2AD9A 1JK9B 2QN6B 2ZH5A 2K3IA 4DX8H 5L38A 1U1LA 1QVFR 2GAHC 4I68A 5BYRA 4OZ2A 2NXNA 1HMVA 4GKKJ 1RTHB 1YJNS 3M6VA 1YIJS 3C14A 4P74A 3D0HE 1Q8LA 5K8OA 5HI7A 3AQPA 3K5PA 2CXEA 3Q8QB 4ED6A 2YX1A 4P2MA 3R6LB 5AXKA 2ZE2B 4USUA 2YNIB 2AW0A 3W60A 1FESA 5SZTA 3VW4A 1RAJA 1JJHA 4M95A 1TUVA 1DTTA 2IHR1 1DZ5A 2HFZA 1B0TA 3H2LA 2XHCA 1WI6A 1PC5A 3EE3A 4EI2A 2GVDB 4KFBB 3S01A 3B4MA 1S76D 4FXVA 2HHHF 1OY6A 4LF4F 2Z58B 3GV8B 1K73T 2DXFA 2OMOA 1NK9A 3AD8C 4OI2A 1WI8A 1AB8A 1UPPA 5DDQC 5I42A 2N7YA 1NDLA 3D3BJ 4DL4A 5CCMA 2JLFA 2MKYA 3VALA 2ROGA 2KM8C 4OZ0A 1MYLA 1CS4B 4LF4J 1FTCA 4FYXB 1TAUA 2CJAA 2B5JA 4QU6A 1X4BA 5L1LA 2VBZA 1JB0C 1ZETA 3V5RA 2R2TA 2RHQB 1BE4A 1O0PA 2R2RA 4ILRA 5HN0A 1T05B 1BD6A 4ITSA 3DYAA 1IBMJ 2NZ4A 1RBLA 1PGZA 4KGVB 4CZCA 4X84A 2YVSA 5BR8F 1X9WA 4LSNB 4WKYA 1LEOA 1WOSA 2N3LA 2CQDA 4ZPCA 3OVAA 5DLGA 5K8NA 4AYBD 3G8SA 2RU9A 4L72B 3CDWA 1QTNB 2E1MC 3VV2B 1X4HA 4Y34A 2GVZA 4QYZK 3KDOA 3FQKA 5CYQB 3SCJE 2G2OA 3FK4A 1SXLA 2LDYA 2HHUA 4EK2A 1BGXT 2CQ1A 1C1CA 2KKHA 3D68A 5KG7A 3TX8A 3WHIA 4DQSA 2GQ2A 2LKZA 2CNKB 5L46A 2CWXA 2XMVA 2MLZA 4OX6A 2RUGA 4NLQA 4P7TA 3FRYA 4O3NA 5IZHA 2V4RA 1N34J 1UVNA 4CWBA 1XQIA 5KFSA 3I5BA 5KG0A 3HXMA 4PR6A 2ACYA 4YY3F 2MQQA 4JI3J 3I9ZA 2YNFA 4JV1A 4QWBA 2EG2A 3FT7A 2VC1A 2RDDA 4X4VA 1APSA 4WFBQ 2Y0SD 1F9HA 4USMA 1NH8A 3E01A 2HIYA 5FD1A 3CGIA 3DLBA 4DSIA 2EK6A 3PEHA 2JL9A 5H9EK 1WNEA 4YY3J 2ATLA 4WFNQ 4B3OA 1RA7A 3IBFB 1U4BA 1FNXH 2B9EA 3PYFA 3GU0A 1NK7A 1GTEA 5A0YA 1UP1A 2WVDA 1DQAA 2HQ3A 3T41A 4DV5J 4MYTA 3BBFA 2OMLA 3PVXA 4F2RA 3P45B 1FXLA 1HWJA 3M8SA 3IWLA 2ALYB 4J91A 1TK8A 1IKXA 2AJQA 2IPOB 2J8AA 4Q44A 2KRRA 1MMLA 1LWEB 4P73A 1HQUB 4P2FA 2BABA 1KFDA 4LUBA 4RNHA 3A3NB 4CO5A 4J9PA 4OZLA 4MT1A 3A8EA 1TELA 3R7BB 4M1KA 4RU9A 2BVZA 3CJ2A 2D74B 4NLXA 5D0EA 1UEVA 1U47A 2C1EB 4I56A 3JYTB 3RRHA 1HPZA 3D1OA 1S1UB 1Y10A 3GIRA 3LUYA 4DX5A 5L9NA 3A3OB 5HL7Q 2LQ9A 3LGNA 1YITS 3CD7A 1P9YA 3ZFVA 4XDCA 4EEYA 2QIFA 4PYAA 3EZUA 4Y3CA 1S9GB 2NPFA 4ECXA 3P6YC 1R8PA 3AJ2A 2VKZG 4FS2A 3SSRA 1U6FA 3KNAA 4DR5J 3MCOA 2E29A 1RDRA 1X4EA 4NZ6A 1RAFB 4KKOB 3OR2B 4NWBA 4UZCA 3RR7A 2OPPA 2Y1LB 2HHSA 5CCLA 2HMIA 3R7NB 3MUTP 1EARA 1DRZA 2KYZA 5KG1A 3J7Z5 1KTVA 1CJVA 2VUGA 2W2MP 3MWBA 3HCXA 1RAAB 2KH9A 1U6ZA 3DRRB 5LM7E 3H98A 4UT4A 2YQ3A 3LGHA 4HVZA 4NA1A 2XO7A 2L48A 1VMBA 1IR2A 1H0HB 4A8FA 3I82A 1VC5A 3HHLD 1X9SA 3UD3P 3QIPA 2KJVA 3H5XA 3RBXA 4IRKA 2KT2A 2V9WA 5HROB 1HKAA 4OIXA 2F4VJ 3NLCA 2M88A 1VK3A 4IOBA 3N28A 2ADCA 5EUHA 3OXGA 4X66F 2GNKA 2IAJA 1K47A 2OLWA 3W8PA 1X0FA 1ARQA 2F4FA 4ZJQA 3CO9A 3LA0A 2W7PA 4NLGA 2ILYA 3TQEA 2N7CA 4MKBA 1HNXF 2FHMA 4CYUB 3CDUA 4ZPWR 3B4DA 2UVWA 1AW0A 3QO9A 3I5AA 1IBLF 2FGOA 3AB2B 3M4XA 2BBEA 2R7OA 2UXCF 4UUXA 5I3UB 3CTRA 2DO4A 2Z4PA 3HULA 3BBBA 3D6HB 3HJFA 1OSDA 1CPZA 1WSVA 1IBLJ 4QQBA 1YGYA 1KLMA 3NGTA 4NZ7A 2XLIA 1U6BA 4PG8A 5IC4B 1JLEA 2HWIA 2UXCJ 3N79A 2I8EA 1LK5A 1NHUA 1RJJA 3NY0A 5FLXU 2GA7A 3V4IA 1TUGB 1RT2A 3NS5A 3K59A 2PGCA 4Z2XA 2KFNA 2QGFB 3PHTA 4OX7A 4HI2A 3AOBA 4WU2A 3SZ2A 5KFJA 3WDOA 4TYAA 4ZLNA 3VWSA 1H38A 5AE3A 2W9AA 4PXEA 3M2VA 4R8UB 3DOKA 5KFGA 1VQ7S 2IC3B 1S72S 3SQGB 2AF6A 2F9JA 4YN3B 2DIVA 1ZM9A 3VVUA 1WOOA 4IG3B 4LF5J 4Q2MA 1WF1A 3NCQA 1S7HA 4GMKA 2CNNB 2KHCA 2MDAA 3G6XA 1DLOA 1FRKA 2R4FA 4OYBA 3CW2C 4FYYB 1S1XA 4IG0B 4F04B 4DMZA 2DT9A 2HFSA 4ID5A 1PARA 2CDRB 1NSQA 2HFOA 1OS5A 5HQMA 5A8WB 1RHRB 3ZTPA 2EFOA 6AT1B 2MGZA 3DNCA 1FK9B 5KFFA 1H98A 2ZITA 2PD1A 1SQGA 2X1GA 3NCPA 2SXLA 1IVZA 3KKFA 1HL6A 2DK2A 4RBVA 2GIRA 4USVA 1SIWB 2XMTA 3HFVA 3IR6B 3KG4A 3M8QB 2ZUGA 3MAAB 2BMBA 3OL8A 1UVKA 1JKHB 4AL7A 4X65J 2QMWA 3RBEA 4FXDA 1N5TA 3ET6A 3AQOA 3CJ5A 1TU0B 5F8LA 3CCJS 2EBEA 3CB4A 1HWUA 4E98A 4PABA 1JLFB 2G13A 3V6KA 4CNYA 2VPXB 1D9AA 4WU3A 2J0QD 2OPRA 4OI4A 1RHQB 2VPZB 4PWDA 3AOAA 3KLIB 3OFGA 2ZBPA 1NPPA 3AT1B 3PXGa 2RNEA 1KR4A 2DCLA 5HBMA 4NA3A 1UWBB 2I5JB 3N9UC 4ED8A 4OJGA 4USJC 1T8EA 1REVB 2ZBQA 3W65A 2EWHA 3MR2A 4QW9A 2NCKL 2ZKUA 4DX7A 2GGPB 2W2NP 2NYHA 3MECB 3H20A 3R6GB 2DHGA 4F26A 1RAHB 2MSSA 2CQIA 1RQ0A 3D3CJ 1KWMA 3H5YA 2CPXA 2DNNA 3PCOB 1WWHA 3E2EA 1ROFA 3NGDA 4K4ZA 1OQ6A 3GYXB 2XO6A 1VQ5S 2JSXA 3BBCA 2YWEA 4DSLA 3MEGB 5LSOA 2GJ2A 3LGMA 2FC9A 1F2HA 4K4XA 3LP0B 3OJUA 3TJ9A 4QWAA 4J9SA 2MY7A 4X4QA 2ZHOA 4ZVQB 2FLOA 2FTRA 1X4GA 2YQ0A 2P6TA 1BDTA 3MUVP 2CAXA 2HEKA 2D69A 3DM2A 1GXUA 2MEWA 2VU5A 2KT3A 4C8ZA 2QL9B 2DD8S 3KOAA 1Y5LB 1TKTB 2YTCA 5HQ8A 5EX3A 4K50A 4NLOA 3H40A 3VAIA 1HR0J 4N77A 1U02A 3J7A1 1M5PC 3H7HB 1URRA 4NZ0A 3OJSA 2VG6B 2FY1A 3RUBL 1YK9A 2PSZA 5MLCV 5J2QA 1LW0B 4DR3J 2YNHA 4LT6A 2FJEB 4LBHA 3R2CJ 4DG1B 5E3CA 3L9ZA 3RR8A 1EETA 2HVDA 1E6VA 2DNLA 4ZVRB 4K4YA 3OPKA 4DCOB 2VOOA 2E5IA 3GXQA 4I64A 2X3GA 1WTBA 2X51A 2KT5A 1W26A 1VQLS 2BRLA 3OW2R 2C2ZB 3FZBA 1D3WA 4JI6F 4K2XA 1EJ7L 4HH0A 3QJLA 3MAHA 5KG6A 2O01C 4P10A 4WK3A 1BHNA 1CC7A 2NREA 4WCEQ 3THVA 1VI7A 1FKPB 3D7SB 2JXGA 2I9SA 4Z37A 4LIRA 5FDLA 1CULB 4OQJA 2MSTA 3MM9A 3RZAA 4JI6J 5CYMA 2V94A 3IXQA 3OD2A 2OI2A 3GB0A 3IRXB 1Q82T 1R0AA 2MB0B 3AXMA 1YJTA 5CZXA 4DF4A 4C8NA 3J80U 2FJVA 2WVCA 2KKEA 4R25A 1HNZF 2UV8A 2H4YB 5LMNF 1ULRA 2HK3A 3BGFA 4P71A 3LANA 3SFUA 3KK3B 3NG8A 2ZBIA 3CSKA 3HSDA 2DGSA 1XR7A 4JBCA 4PXBA 5F8GA 4V19X 3W66A 1UZHA 1IM6A 1RT5A 3B8HA 1HI0P 1HNZJ 2VA3A 4J90A 5AT1B 2J6UA 4WFAQ 2D7SA 1YWXA 2V8PA 2MJUA 1UJ5A 3T6JA 3DI6B 3Q89A 2OEKA 1YJVA 2QYGA 2VPWB 3EDQB 2ZH9A 3OT9A 2C2DA 1BUXA 1RHKB 2HQCA 4WTOB 4IFYA 1JLCB 3K5OA 4DDFA 3M9MB 4RO0A 1VRUB 1C4AA 2RHSB 5D0GA 3M05A 4YOEA 3TAMA 4K0KF 2RBFA 2I6WA 2WW8A 1L3SA 1ZH5A 2B8PA 2V67A 1S9EA 3NP5A 1RTJB 2BACA 1XBWA 3QRQA 1NM2A 4LQ3A 1RISA 2CPDA 2Z8QA 3V6HA 4O0IA 4F3OA 3DOLA 3NMRA 1RT1A 2VJVA 3CCWA 5HP1A 1GH8A 4K0KJ 2ZWOA 2IIHA 1HQEB 3G6ES 2B6AB 5DG8A 3GJRB 4WIQA 4ZK7M 1RT7B 3H87C 2GO9A 3CUNA 1IN0A 3ZTOA 3FEZA 3GILA 1RWMB 1ZPVA 1R0BG 2MQPA 1IKVB 2AJFE 5KFBA 4GKJF 2BDPA 1D9FA 4RW4B 2NLWA 3ZZYA 2V2VA 1U9PA 1D09B 4FBUA 2C2OB 3AD7C 4IFVA 4EZ6A 1KTQA 3I0RA 3MR3A 4C97A 6FDRA 1F3VA 2BM1A 3POTB 4TN2A 2ADLA 3WX8A 2M52A 3DGVA 2QLWA 5GMDA 4K7QA 3PX4A 4GKJJ 2HRTA 4DSEA 5A6WA 1EB0A 2L3MA 1GX5A 2C2EA 1XMQF 2W4DA 1VQOS 4I2PB 3BB5A 2MPUA 1KBRA 2H5EA 4LF8F 1VJQA 5K14B 4MKYA 1UMJA 2KYXA 5DZ6A 1U0HB 3T6BA 4ATNA 5LT5A 3HD2A 2C3YA 4NEYA 1NJIT 5ETTA 2MZQA 1QSLA 3VAHA 1GT8A 3UDLA 1XMQJ 2E44A 4ECUA 4LSZB 4LF8J 2P9GA 4NCBA 4MKAA 2K6LA 4OFZA 3ZZ0A 1FJGF 3FBFA 3TO8A 5A2QY 4DOZA 2A3JA 3E3XA 3KLFB 2FIUA 2DGWA 1WKKA 1FDBA 4C11A 3PW4A 1RGVA 1Q79A 1F5AA 3Q8PB 2KG0A 3HMJG 3HD1A 3M9NB 4C98A 2OPSA 2XYHB 3TA0A 5I3PA 1JWWA 4D8JA 2RILA 4LF7J 1M5KC 3WZ0A 4NLWA 4PG4A 1XIQA 3THTA 1HI1A 5BYQA 1VQNS 4X4UA 1N8RT 3QT8A 3JSBA 1R6VA 2Y1IA 3GJQB 4JI1F 4N41A 3GG1A 4OI3A 2IMWP 1XNQF 1DAXA 4IO1A 1ZM4A 1BQNA 1S6QA 4CH7A 2NR0A 4DV3F 4HACA 3M1VA 5C24A 2KELA 5KFAA 4X64F 3W2VA 3PJXA 3KG1A 3K8VA 4JI1J 4RU2A 2WAQD 1NU4A 4N5SA 1L3KA 2B7BB 3TEHB 2YKPA 2HAFA 1XNQJ 5IFMA 3C16A 3US5A 5KFTA 4DV3J 2GIQA 4HT7A 3QAUA 3FMTA 4M94A 1IKYB 1NSAA 3H59A 3QGPA 4GC7A 3CIMA 3CPWR 2M70A 3OTDA 2XSJA 4NXMF 1B0VA 3OSNA 3D66A 2FJBB 3U1MA 3JSMB 1T7PA 4RNFA 4PUOA 1BLUA 5KT6A 1W2IA 4JI8F 4YB5A 2GQQA 2LU2A 4ZJLA 2QX0A 3IFEA 5L9XA 3TRGA 3CCSS 4WP8A 5G0RB 3SDEB 3BJYA 2JC1A 1WG5A 4OZ5A 2HVHA 4G1QA 1Y0HA 3DLLQ 4ED0A 1E6YA 2LMIA 4JI8J 4Q0BA 4DPWA 5L8RC 1SL0A 3GV5B 3RG6A 2ZDOA 3NAIA 2ZD1B 1KEKA 3HHEA 2Z2MA 3FSYA 1UA0A 3DHXA 2N4DA 3DFEA 4O44B 2VG5B 4FXEA 3HVAA 3H2VE 2RKIB 1R43A 2YKMB 3DGPB 4HHHA 4M5HA 1S57A 3FMWA 8AT1B 4F7VA 5HO4A 3HHLC 3IS9B 3CJ3A 2J7KA 3J7AN 5KFWA 1LNQA 5J2PA 3CJKB 1ACMB 4NLRA 5C42B 3IO1A 2DGQA 2KL8A 2ALZA 2EKYA 3CD0A 1N33J 5D0HA 4B3MF 4ZJOA 2ZKTA 1N54B 2HNYA 3HM9A 2XYGB 3AA8A 1WC6A 4LF9J 3MM6B 1S1WB 2R7RA 1WDTA 2XCAA 2BE2A 2K29A 3MD3A 2W1BA 1VJWA 4DU7A 3JTNA 3SCKE 4CRJA 1IKWB 1H6KX 4ECSA 1RHUB 3BQ1A 3D0GE 4WPAA 1WELA 1W2BR 1C2PA 1NNDA 1JX4A 2HGMA 4Q2LA 3GR0A 4NRUA 1TP7A 1MNEA 1ZPWX 4ECTA 4OHYA 3T19A 1S0OA 3R5BA 4Q43A 4M5MA 2F8HA 4QIVA 4OHWA 3PM9A 1NK0A 2HVEA 4DL2A 4Y28C 2FVPA 3CC7S 3G71S 1KVJA 1T9TA 1Z4UA 3LPEA 2ZH3A 2X1FA 4DZDA 2R2UA 5GAEU 4CLLA 3MD1A 2C2KB 3HKZD 3R1LA 1ZTTA 4CQ1A 4C6AA 1F6TA 2CJYB 1T9XA 4KAIA 2QSFA 1H2TZ 4DL0C 2JNJA 4BHQA 1XK8A 1ZBTA 2MKCA 1L3UA 2ASLA 1T0TV 1UW9A 2EC2A 2ZNZA 4TU9A 4J9UE 4LBPA 4OMFG 2ZH8A 5E3PA 3TZWA 1XERA 4F50A 5KFPA 4TY8B 4FPRA 1FERA 2D9OA 5KFRA 4DPUA 1YLXA 4I6WA 1JLGA 1KOOA 3PW0A 1XNRF 2BW2A 1KQGB 3BYPA 3H2UB 1K9MT 1RTHA 3KFWX 1DTQA 1O6XA 3Q8UA 3MEKA 3BDEA 3HKWA 3MPYA 1TMMA 2MKSA 2EBGA 5KG5A 1FWKA 4OJHA 2ZE2A 1QD1A 2YNIA 5F8MA 1FRIA 1TAQA 1MSWD 3R9LA 1KNZA 1J5EF 4IOCQ 2B51A 2RQMA 1P1LA 1V3ZA 1HNIB 2DITA 4KB7A 3WC0A 2DCUB 2DH7A 4R5PB 2V0NA 3KJVB 4OYWA 3ISNC 1NB2A 3T1AA 2RE1A 3T5LA 4DEZA 5AXLA 3J81j 3A8IA 1LW2B 5EWFA 1T9WA 1NH7A 1IWAA 4KSEB 4ZHRB 1VQ9S 5KFLA 5C7PA 1UEKA 1PJ5A 2V2QA 1VK8A 1CS4A 1KVKA 3EVWA 1GMWA 3NOCA 3CO0P 3ZZRA 3KK2B 4C0BA 1RABB 2UUCF 3KJNB 4DSJA 5KFDA 1RI7A 4ETZA 2E5HA 1T05A 4DQIA 4OX9F 1Q16B 5D0RA 1P8GA 4AAIA 4U67Q 3PRBA 2QFJA 3NGKA 2OP5A 1S79A 1BQMB 4LSNA 1D8YA 4HLBA 1DHMA 1FD2A 3JAMY 3EPGA 2UUCJ 1Q8BA 4J5OA 3MURP 3PACA 4NYZA 3GZ7A 2RMLA 1MG7A 3R27A 2RQKA 3K5NA 3B82A 3R1HA 1QM9A 2Q1LA 5CYQA 4TY9A 3QFWA 4H4OA 2W2PP 1VQ8S 4UQTA 1DQ8A 3TUIC 5GMKa 2AWZA 4LRFA 4CLKA 3H90A 5KFMA 1Q53A 2W9BB 3WIVA 1NCLA 3QPIA 4RW7B 2OD6A 3PX0A 5HMZA 2D3UA 4Q7AA 2PMZD 2M7SA 3GG0A 1L3VA 3MPUB 1UZDA 3LH2S 3OL6A 1HBOB 3Q8VA 3CMQA 3WX4A 1U1NA 2DY1A 4LVNP 1RTDB 1TUWA 1QE1B 2DHHA 1YJUA 1F2GA 4RBTA 3NRBA 2HQIA 1FFWB 4CLYA 1HNWF 2NQPA 4H54A 1S1TB 2Q2KA 1BWEA 4DFKA 2JEJA 2LXFA 1HWIA 3GCXP 2VQFJ 2MZTA 4BWMA 4JI5F 2E5GA 3HPOA 4L76A 1A7GE 1SJRA 3DDKA 1RADB 5CABA 3NWRA 1X5PA 2NUHA 4I6YA 3BPDA 1HNWJ 4WK1A 4DLEA 5L1IA 3P8BB 3BO2A 2QTWA 3M8PB 5F8HA 3W2WB 3QBCA 3D54A 1FHTA 3K58A 2HHQA 3W9HA 1LWEA 1HQUA 4JP8A 2HVIA 2A2BA 1IR1A 5KFKA 2LLZA 2EW9A 2RS2A 3JTPA 2HK2A 3V6JA 1U1KA 3BKUA 5E2QA 2LEAA 5KT5A 3GE9A 1HBMB 3JS9A 3IBWA 4ED7A 3RU0A 5F0UA 1S1UA 3AJDA 4ZP7A 2DGTA 1P9QC 3LP2A 2IM1A 4B9MA 3ZZUA 1UA1A 2WONA 3FDSA 1XR6A 2AP6A 4PYDA 2V4QA 3D1HA 2WOMB 1B0PA 1SC3B 1J27A 5IT4A 1FWLA 3HVWA 1SBRA 3AJ1A 1I5OB 1AZSB 1CLFA 1DURA 2LECA 4IKAA 3MMCB 4KKOA 4DU8A 4EFAC 3OR2A 4O3RA 1YVFA 1VIOA 4RNMA 3TJ8A 5J1EA 2OTLS 2HPUA 2JH3A 4PZVA 1AT1B 1FRLA 3H42A 4AD6A 2VHGA 2BV3A 2C3UA 2M5YA 7FDRA 2LFVA 2ATCB 1IJEB 2KFZA 1Q7LB 4A8KA 2KO1A 2BKNA 5A6PA 1WSRA 1RAIB 3DRSB 4J9MA 1OHNA 1VRQC 2J5AA 3BKFA 5U47A 5T7LB 2HFVA 2B4OA 3DRRA 1WC0A 2FQQB 2KVIA 3OLAA 5HVFA 4RW6B 4F2SA 3KUGA 3C14B 3EZ5A 3PYEA 4KYZA 4F25A 2IRYA 2AHOB 5HROA 4QYRA 2D3ZA 3OTBA 1Q78A 3K2YA 4CLTA 4ZVSB 3KUHA 4J9KA 2DO0A 3NCRA 5HAOA 3TZYA 4FS1A 4NI2A 2MQOA 3GYNA 3BO4A 1DTTB 2B4VA 1FVSA 1NLAA 4FZVA 1EKRA 4LFAJ 2JZ5A 4KQZA 4CYUA 4CTAB 2CDQA 4HKQA 1FKOB 4DUYJ 2COLA 4RNNA 2CAJA 1NB7A 4DR6F 2K3KA 4OI1A 2HQDA 5I3UA 5CZVA 4ME7E 3P3DA 4JV0A 4F02A 3PHEA 3AH6A 4YFUA 4NMXA 4NYOA 4RW9A 4TQSA 4E8UA 3QZ8A 1OJ4A 3DOMB 3ZXWA 2K5JA 2A2CA 4ZS6A 5EHHA 1N0VC 2MY8A 4M8LA 3O3LA 5D15A 2NZCA 2I0XA 1ZZFA 4KR0B 2BA3A 4YHHJ 5GADU 1C0UB 2ZFHA 1FDAA 5HLFB 3MR6A 3TJAA 3ISZA 4LSLB 4X4NA 1VYAA 3BSNA 2UP1A 4LRAA 1H72C 1ZAXA 2BE7D 4MK8A 3DDNA 4WJBA 4CLZA 3HT0A 3NMAA 4UOFA 4NXNF 3MI7X 3MOJB 4QIWD 2VB6A 3CJTA 1LQ9A 1U7LA 3SBMA 3FVYA 4KC5A 3U1NA 2YWFA 4ZA1A 3RRKA 2F63A 3LP1B 2DNZA 3M2RB 2RS8A 3N01A 5KT4A 3K8WA 1ZA1B 1GK8A 4NXNJ 1RT6A 2Y8WA 2DH8A 3JQMA 3NNAA 3B6BA 4QR0A 1CG2A 2IVMA 3VGUA 2DH9A 1TR0A 4OJ1A 4Y00A 4IG3A 3IMQJ 1N5YA 4F3QA 1RA6A 1NKCA 5CXTA 3I96A 4BBYA 4IG0A 4M5DB 3I6PA 1QAYA 3U7JA 1NJYA 4U96A 3QAEA 3ZZTA 3FJ2A 4U8VA 2PI5A 5A8WA 1T02A 1TFYA 3FBCA 5T41A 4DSKA 1V5VA 4FKXA 4PWWA 4CT9A 4ID8A 4CI0B 5E3RA 3QYYA 2EKNA 5ETNA 1JJCB 2HBYB 4LVOP 2F40A 4B3OB 3HDSA 3MM5B 4YB1P 1EHWA 2IVYA 5GAGU 1KQFB 2R7VA 1SIWA 4PPDA 3M8QA 3EUNA 3MAAA 3VHQA 4JV2A 3EGZA 4PQUB 4E0DA 1BWVA 3QSYB 2GV1A 3QOQA 4YQWA 3C2PA 5JVGQ 2CADA 2YX4A 3EVMA 4F4KA 1VHFA 1VQ6S 3NNHA 5KFEA 1EQ0A 4GRSA 1F1BB 2IJRA 1RKIA 1EIYB 1SV5B 1JLFA 2DEIA 5CH7B 4TU8A 1IWGA 3L3CA 1NHVA 3BREA 4LQ9A 3W5XA 3Q2SC 4DQPA 3VAKA 4G1IA 4BC7A 1M0SA 3TANA 3N5BA 2XNRA 4RWWA 2J0SD 4ZLJA 1HPZB 2RVJA 3PTWA 1UWBA 2I5JA 4ZPVR 1S6OA 4CM0A 2YQ1A 3THPA 1KQKA 2J9DE 3QQCD 3X1LB 1S0NA 2GGPA 4B9SA 2E7XA 1TV6B 3MECA 2FGCA 1GMWD 2W9CB 3C15B 4FDFA 2JHEA 3K5LA 3CMAS 1X5OA 3OL9A 1KLNA 2VJUA 3P4UB 2DNYA 3UNGC 1HARA 3MM8B 1C0TB 3EDRB 2CPEA 1FRJA 3LTOA 3CCVS 4WFZA 3EX7B 3DLEA 1K0TA 2XC9A 4Y65A 1SVDA 3MEGA 4EBDA 3EZOA 4WZQA 1UL3A 3ETOA 5KG2A 1WKJA 2OPPB 4C8YA 2XI2A 3FZ2A 5KAKA 2KZZA 1M1HA 3D28A 4YUDA 2WZ1A 4JI4J 1AUDA 4WYLA 4NCGA 3KMQA 3VAMA 3G82B 3OL7A 1HA1A 4TXSA 1UWAA 4B9VA 4U7UK 3FBEA 5HATA 4DZ6A 1M5SA 4NYPA 5IS2A 1YBAA 2A18A 2AGPA 3UNYA 3ULHA 1Q81T 4PKDB 4OYMA 3V81B 2DXEA 1Q8IA 1B7YB 5E3AA 4DLGA 1NJWA 4WKRA 3W5ZA 5IT9U 3H8YA 1RSCA 1S10A 4QWEA 2VG6A 3PG9A 4NLSA 3O8WA 2FHJA 3I0SB 1LW0A 5KFXA 4EMDA 4UY8T 4KHPJ 4DG1A 3HF5A 5IWAF 3VZIA 4RUHA 2KFYA 4O23A 1X4AA 1N0UA 5HMYA 2P2CB 2D41A 2GC8A 4IDKB 4OZ1A 3N4WA 1Z1ZA 1B28A 4QWDA 4B3TF 1VISA 3EYZA 2WB1D 5B0BA 4X62F 2AZ3A 1S49A 5MAOA 4ICLB 2BKPA 3QO9B 5FJ4A 1AA1B 3M32B 1SL1A 2MTLA 1B99A 1C1BB 3BSCA 2RUSA 4EYHB 4JI7F 3KTQA 5KFHA 2DHSA 1OPZA 4I2QA 5C25B 4B3TJ 4YEAA 4DXLA 4X62J 4WP3A 2V50A 2ZOGA 1CULA 4YR2A 2L41A 4C2MA 2HHWA 3PFOA 1X8DA 1NLKL 3G4SS 5KG3A 1J2VA 1LV5A 4F4XA 4JI7J 5JMNA 4PAAA 2XY5A 3V4IB 2GCFA 1T9UA 4DV7F 1HBUA 4NPOA 3AA9A 2HS4A 4O3SA 3GJSB 1OYDA 2JVOA 3PYGA 4IH7A 3J7YI 2JWNA 3ADAC 4RWXA 1HI8A 4KHRA 2AY0A 1UTAA 3IC1A 3U02A 4U6PA 3HI9A 4LFBJ 1S77D 2OELA 2F1FA 1KDNA 3M30B 5B08A 2E7WA 1R7IA 4DI6A 1DARA 2EFPA 3PRDA 4R0EA 3KK3A 1QLNA 1ELOA 4F4WA 4MK7A 4EU0A 2VQEJ 3M2VB 3J81U 3DOKB 1RAGB 2PDAA 4DCPB 1U45A 2LVWA 1F60B 2AYMA 1IM4A 1OG7A 1NXIA 2Y1RI 2J6TA 2WW4A 3MMAA 2VDIA 3GIKA 4YS2A 3DLHA 1VS3A 3E8OA 2R7TA 1R27B 3CCTA 3DI6A 2X3DA 1TKXB 5JUMA 1MYKA 3CC2S 1CJKB 2XCPA 2HBZB 2AJ1A 2B9WA 1MWYA 3PJ9A 2VODA 2QE5A 2WSCC 1JLCA 4M5KA 2OSQA 1CC8A 2AX1A 2O1PA 2XNQA 1AYEA 2QA2A 3VF0B 2Z56B 2GJFA 1IXKA 4RW8A 2DGUA 2YKNB 3IAM9 3R7SB 2MKHA 1RWUA 4GO5X 2MGZB 4A8YA 4KH1B 2RT3A 3M8YA 2AN7A 2YNGA 5H9FJ 4RX6A 1RTJA 4F0MA 1KKHA 3LALA 4F0HA 2K9IA 4JI0J 1UEUA 3KMSA 4G6VB 1U0SA 3DRPB 1X4CA 2PEHA 3VEAA 1IBMF 4ES2A 1HQEA 2B6AA 1N36J 2GJIA 3GPAA 3HX9A 3KLHB 1RT7A 3P96A 1F9FA 4O0NA 2ABYA 3SMZA 1B70B 1R6YA 1K44A 1U1QA 4P6QA 3ENAA 4RKUC 5CYJA 2VH7A 1IKVA 1Y3KA 2Y0BB 3T1YJ 1G2EA 2IYGA 4BCAA 2E9TA 3UPFA 4RW4A 4URGA 5DDOC 3Q22A 5LXYA 3CD5A 1NHKL 3N6LA 1YI2S 4W92B 2I2YA 5E3QA 2IM0A 3A8KA 2OPRB 2QC3A 4G1PA 3GIIA 4PWDB 3M7VA 3POTA 2GX8A 3P5BP 2UV8G 9ATCB 2HZCA 2W4CA 1KS2A 1Q0NA 1A9NB 1XJWB 2OEJA 2MZRA 3N6MA 4I2PA 1N34F 3RRGA 5B0FA 5K14A 2HHVA 1MMNA 2DGXA 3DRXA 1U0HA 2JLEA 2FYXA 4JI3F 4HTIA 5F8JA 5ADZA 2RRNA 4DFMA 1H2UX 3FBBA 2OTJS 2GPEA 2V8VA 3KLEB 3BO3A 1NO8A 4CO3A 4QCLA 2K1OA 3KWMA 4P72A 3RBZA 4OX8A 1SIZA 2BZ2A 4L6V3 3LOUA 3KLFA 3NO7A 3IRWP 3CCLS 4QPXA 3IR5B 2MQ8A 5M2RA 3W5YA 3DM2B 2RQ4A 5K8PA 1N5SA 3MMBB 1Y7PA 3MXHP 3RYLA 2VBXA 4DV5F 4MK9A 4ZMMA 3CJRA 3TVZA 1R8HA 3PEJA 1RZMA 3MOZA 3TUZC 3HO1A 2Z0GA 2MQNA 4I4BA 2VFRA 3ZZZA 3JSRA 5CAAA 2UU9F 3D9BA 3T9ZA 4C8LA 3BGUA 2HBQB 3G96A 3EM1A 2W01A 3DLGB 2F7VA 3G6YA 4P2SA 3CMES 2RRAA 1HFEL 3HHKA 2RSQA 4USIA 4ZP8A 2UU9J 1Z2ZA 3MR5A 4YMEA 3QATA 1Y00A 1LWFB 2MHEA 4IH5A 5D77A 2ZHAA 4ERDA 2W8KA 3FFIB 3DXSX 4OI0A 2V2KA 3IR7B 3JB9k 1CQMA 2HKEA 2CQ4A 5D4PA 4ZVHA 4WYWA 2LDIA 1XEZA 1LWCA 2DB1A 2M0GB 4NE9C 5SUHA 3O1LA 2OH2A 3TNVA 2A0FB 5EX0A 3U1LA 4CLFA 3A8JA 1J5OB 4DFPA 4DR5F 3HVTA 3ILLA 1JLBB 1SQEA 4LRCA 2UUTA 1S0MA 1O5JA 5FDLB 1FI4A 2ZH2A 1UFKA 1RUSA 1TL4A 2AJ2A 1N48A 2JDJA 2NXEA 2BQ3A 2X1AA 3JSMA 1NMEB 3VAGA 3IG1A 4KIAA 1R0AB 3ETMA 2W25A 1SL2A 4U7CA 2D3OR 1SQFA 4ZDNA 4ZCMA 3SDEA 1VFJA 4ZPTR 2BSQE 4B3SF 1KN6A 1WTFA 2I1RA 2QA4S 4H4KC 3SIPB 3QT7A 4ED1A 5ETLA 4I7FB 1RLCL 3KYLA 2H48B 1KHVA 1KD1T 1HHQA 4ELUA 2F4VF 3HZGA 2ZD1A 1VR6A 4OHVA 3J7ZT 4TKTA 4X4RA 2GHVC 2IBKA 2FVRA 4DV1F 5F9LA 2CPIA 4O44A 4B3SJ 2O66A 2ZH6A 3BGLA 4ZVTB 3UI3A 2L9NA 2RKIA 2YKMA 2OFGX 3DGPA 3CJ4A 5D3GB 4LF2A 1WACA 3IGNA 3QZ7A 2KM8B 2ZH4A 5L1JA 4LF6J 1UVJA 3CJKA 1RWPB 2OHDA 3M8ZA 3UE2A 5C42A 4DV1J 4LMZA 3DLKB 2HGNA 2ZOFA 3GTYX 1X4FA 3TAMB 2WSEC 5L1KA 4NASA 2HLTA 2OPQA 3OTCA 5D4NA 2QFIA 1F5CA 1NK4A 1U1PA 1WC3A 2IMOA 3MM6A 1S1WA 2NSBA 4KGZB 4KRWA 2UUAJ 1CJUA 1N52B 3GR1A 2WRMA 4I1TA 2GMJA 3C3LA 4OZJA 3VGSA 4CP5A 2ZDPA 1JXVA 1K1SA 1IKWA 2FHJD 5GAHI 1S59A 2VA2A 1OWXA 1XN9A 3MMJA 1OPIA 1HYSB 5KT3A 2IJFA 4L75A 2CG8A 5HVHA 3ENVA 3VGTA 5DZ7A 5DQHA 1REGX 2BJ9A 1FA0A 4ZITA 2IJNA 1HWLA 1O8BA 1YHQS 3MZIA 2DGVA 4ILLA 3QRRA 4RNOA 4FP9A 2H54B 3RAMA 1TL3B 4WF9Q 3HSZA 4Q8EA 1GX6A 3R5CA 3ICLA 3GWCA 4CDIA 2YWWA 3ITHB 5AE2A 3CJ8A 4WE1B 3DHWC 2OUGA 1VCTA 1SUQB 2P6SA 4EZ9A 4LF5F 2FJXA 5EDWA 1W25A 1PAEX 3DKDA 3EICA 4JUZA 4AE5A 1G6BA 1FFSB 3UCZP 3EGVA 2P8IA 4DL3A 2Y3YA 3VQTA 4KPYA 4YR0A 2B0GA 2RB7A 1NBEB 3B54A 2BANB 1F3FA 3M2UA 2FPHX 3NXZA 5BYSA 3QGGA 1SPBP 4TY8A 3KHRA 4J9OA 4H4MB 1YZ6A 3R97A 2G0CA 4ZP9A 4F36A 1JIHA 4RR5A 2F8MA 3D6TB 2FJAB 2CJBA 5A8RB 3VGVA 1RAEB 3T5KA 4OYXA 4M5JA 3F44A 3W62A 1Q8KA 4X65F 2ZH1A 1VBYA 4O4GB 4BDPA 2OPSB 3Q83A 2KDOA 5DG7A 3ISND 1HNIA 2H5IB 4KE5A 3AODA 3H0PA 2GZOA 1JNRB 3KJVA 1AFIA 1YRTA 3C6UB 4MIAA 2R2SA 4EO8A 2FJWA 2VPYB 1ZTWA 2RJZA 3PDNA 1LW2A 2CJKA 1SJ1A 4ZHRA 1DQ9A 4DV2J 1S6QB 4LBIA 1PJ7A 3M1VB 4DV4F 2VF3A 1BDVA 3W2VB 4Y2MA 1BY9A 2DHAA 2XY6A 3KK2A 1JLAB 3CJ0A 3ILOA 2YKQA 2O5DA 1FEHA 2XMUA 4Y2AA 1EQMA 2R42A 1B4SA 1JXEA 4WXWA 2Z2LA 7AT1B 1Q16A 3ZTRA 4AT1B 4KGXB 2XBPA 2GW8A 4DV4J 2E5JA 3BH7B 3UVJB 3ZZOA 1SJFA 1SKSA 3CDBA 4FVMA 5GMEA 1ZS6A 5ITHA 2X1BA 2NPIA 2CQBA 2CQGA 1RU2A 3UDEA 5BXIA 4WBFA 1RWKB 1X93A 2HHPA 3KJQB 1UFWA 2XS2A 2WVFA 1VRTA 2IDEA 3G8TA 5BJRA 1WKLA 3WIUA 2B4PA 2ZC4A 3A4TA 4C8OA 2JFKA 4C0HA 2QJ3A 3QIDA 1LFPA 1HR0F 2W9BA 3QJJA 2HLUA 4G1QB 3AHPA 5DLFA 3GQCA 1FRXA 1YJ9S 4RW7A 2B43A 3RGIA 2B9XA 4RPFA 4RUAA 5LJ5Y 1WHXA 4K2JA 3JQKA 2KVQE 3HP6A 3TA1A 4XPCA 4DR3F 4LR9A 3HVRA 3ZNJ1 4DBQA 3PFEA 3GFZA 1H7XA 2GO8A 3TX0A 4NOHA 1HBOA 2PIIA 1RTDA 1QE1A 3BM7A 3SXLA 1U26A 3MEEB 1OMSA 2ILZA 1LXJA 5F8IA 1PSDA 1YDLA 4M63A 5J2PB 1AFJA 1XMBA 3BYRA 1T11A 3KLVA 3CC4S 3B78A 3FCWA 4HEA9 2CNLB 3MCSA 1QUPA 1NJXA 2VG7B 2R7XA 2HNYB 2IA6A 1UPMB 4ZVUB 1UCNA 2MZ1A 2H1OE 5KTQA 2OIHA 4MYUA 3GONA 2R8JA 2AEJA 3M8PA 5I4MA 2KI2A 1L3TA 3R2DJ 3W2WA 3MUMP 4PWUA 1N32J 2OD4A 4DR2J 1Q7YT 3KNGA 1GAOA 1U2CA 1VLOA 2FVCA 3G87A 2VBYA 2YBVA 4K4WA 3PKYA 5DG9A 3BZQA 3TQ1A 5B0EA 1PG5B 2F65A 1RE1B 1MN7A 2K1RB 3HLUA 4P2XA 3I56S 4FYVB 3WQPA 1RAOA 2V5HG 3HT3A 4JYAF 2YKAA 1R0CB 3ENQA 1SJ3P 2RRBA 3TARA 2WOMA 3FCHA 3FRZA 2OAUA 3OVSA 2R8IA 2HIQA 1FJCA 1MLAA 3KHGA 1AZSA 3I9V9 3MMCA 4CT8A 4JYAJ 3Q86A 3Q8SB 1KC8T 4CO4A 1FE0A 1CBKA 4QR1A 4QZVB 2QZ8A 1S1VB 2PA8D 5B0CA 2AIRB 4ZVGA 3SSQA 3IN5A 2CFXA 1FT8A 1CVJA 5DDRC 4X4SA 3DRSA 2ZOMA 1RT3A 2XS5A 3CT9A 5IOLA 3MTJA 4HHJA 5T7LA 2FY8A 2A10A 3MPDA 3CULA 4DR7F 3PY8A 4F0KA 3ILIA 3LO3A 4PG5A 1JLGB 2W8LA 3PR5B 4RW6A 5AE1A 1X5SA 1DTQB 1IQTA 4CLSA 2D1CA 3KG0A 2V63A 1N5QA 1GTHA 4WP9A 1CSJA 3R3TA 1U09A 4FVCA 4DR7J 2M4MA 3NKYA 6FD1A 1NZ8A 2ZJRQ 3QLHB 1GFWB 1YRUA 2WTFA 4ELVA 1U2FA 1X7VA 3FCVA 2PI4A 3NGUA 1HQ2A 2AYBA 1T3NA 2J9DA 2P5VA 3VZHA 2BJ7A 2Q6CA 1FVQA 4CTAA 2K8GA 3DRYA 1FKOA 1TKZA 3PKMA 1SJQA 3V6DB 2R3VA 2HRUA 4DFJA 3QT6A 2ZM6F 4O3OA 4N8NA 4O4RA 1Q86T 3PZPA 4EO6A 2C3OA 2HHHJ 3RW6A 1S6PB 1EP4B 3DOMA 2CQ3A 1SKRA 5AXMA 5A76A 2YWKA 1P1TA 1C0UA 3TUJC 2C2MB 3I32A 5HLFA 2ZM6J 2XS7A 2BOAA 4LSLA 3Q23A 2YY3A 4RLEA 2W7AA 2QL5B 3BDPA 5D8HB 3A13A 1M5VC 4LFCF 5A8KA 1FJ7A 3T5JA 1V5IB 3LAKA 4N47A 3PW7A 4J7CA 3MPVA 2HVZA 3MM7A 4WFXA 4B9TA 1I3OB 2ZC3A 2YPZA 3NNEA 4DUTA 3LP1A 3G5OA 1D9DA 4IO9Q 1DBDA 4X2BA 3M2RA 3QFHA 1JLQA 4DUZF 5BR8J 5D78A 5ETOA 4LFCJ 1QVGR 4ZPAA 4C0OC 3LJPA 5FLXY 4H4OB 5LSLA 3MF5A 4OHZA 2QL7B 4XIUA 2HQFA 3R8YA 3TOQA 3QJPA 2M2BA 4F4AA 2V4JA 4LF7F 2M8HA 2V34A 5F8NA 1LKZA 3RW7A 1TK5A 4DUZJ 3FMBA 1RB0A 1QY7A 4NLVA 4M5DA 2H1YA 1WC4A 2FVQA 5J2MB 2O67A 4KBIA 4DCJB 2AEFA 4P75A 4HI1A 1NEEA 3CXCR 4FNIA 2JEIA 5IXUA 5CD4A 1U8SA 3SSSA 3HSJA 4MJKA 3OFHA 2OFHX 2CJXB 1H3DA 3BH6B 2BM0A 3FQLA 2F3JA 1V6HA 2IRXA 4CNZA 4NL5A 4USWA 3S7RA 1YX2A 2FZKB 3MM5A 1WOPA 2HWTA 2YKOA 3QMQA 4B9UA 5KT2A 2XMMA 3F0NA 4PQUA 2E7VA 4DS4A 2CQ2A 4LJMA 3ILJA 4IRDA 2IRUA 4OI6A 1X9MA 4S0MA 1VQMS 3BKTA 1VBKA 5ETPA 1SV5A 4I6AA 4UF4A 5KFQA 2DNPA 1G1XA 5KFZA 2DNOA 1F0XA 1FWPA 1T03A 3SV3A 3BS9A 1RT4B 2E1RA 3ENWA 3I31A 4H4KA 1R3NA 2AYGA 1HBNB 1FNOA 3UD4P 3NBPB 1R8CA 3LP2B 4Q8FA 2JX2A 1TVRA 3QWUA 2WONB 1TV6A 2QSWA 2GFFA 1N5VA 2W9CA 4O3QA 3C15A 3TAQA 4Y0FA 4KV8B 2W7OA 2PE8A 3BN7A 5J2NA 3EJMA 5GVQA 3CCUS 4B08A 1PBAA 1GXLA 2ZVIA 4GVBB 3MM8A 1C0TA 2BXJA 2RF2B 3UN2A 4K5SA 3V4MA 3H5SA 4M5NA 5E7OB 4UW2A 3OR1B 1TL1B 4A46A 4CO1A 1Y5IB 4X4OA 2AV5A 4K5RA 2OEMA 1DY3A 3MEDA 3BGRB 5C2CA 5J1EB 1RLDA 2IA0A 1XMOF 2HG4A 1X0PA 2U1AA 3QGIA 2Q79A 5JVHQ 1FXDA 2DYAA 3CE8A 2CNOB 1LFWA 3O2IA 4GO7X 3C6TB 4OHXA 3IA0A 1N6QA 3K17A 1N33F 3G82A 5JXSA 1PCAA 1TZ0A 4JV5F 4PG7A 3MFIA 4BC9A 4A8XA 4LRVA 2DVIA 2IYIA 1S48A 2P9EA 1XMOJ 2PT0A 1DJ0A 4QIEA 4LF9F 1YQHA 4NLYA 2XLKA 1RK8A 2XZDB 4D3GA 5D4OA 3V81A 5C5JA 4CLPA 2DPIA 2Q66A 4LREA 2BNWA 4JV5J 1PAUB 4KO0B 4ZPDA 2UXBF 3W63A 3BPSP 2PC6A 3I0SA 3LQVA 4XDDA 5IV3A 3UWTA 5M2PA 3I55S 2C3MA 3FEXB 4ZVOB 4NI2B 3EWGA 3NS6A 4RZRA 4X4PA 4OL8A 1CEZA 2J7WA 4IDKA 2FB0A 3KK1B 3EGWB 5D6GA 2UXBJ 1JJ2R 1SKUB 1KRPA 4ICLA 1ITPA 4QU7A 2DEJA 1VC6A 3M32A 2YWGA 4ANEA 2ZUAA 4M5GA 1X60A 3AXKA 2ADBA 1C1BA 3W9JA 4X66J 2DBBA 4A8QA 2HURA 2G2ZA 3AFGA 3OXFA 1TFWA 1K1QA 2QYCA 3D67A 3F41A 2J76E 3V2UC 5CHCB 5C25A 5B0DA 1HNXJ 4RW9B 2B3TB 2VBWA 2J0XA 1S9FA 3UDCA 2RU3A 4QIGA 1NPRA 1OY8A 4Z7YA 1PO6A 2L9DA 2BOPA 4ER8A 2C2RA 4K4UA 1LXNA 4CH0S 2YH0A 4B9LA 2RDIA 4YB7A 1L5UA 2CVIA 4F4ZA 4QOTA 3N0VA 4UOCA 5A2QU 2VFUA 4IUFA 3GV7B 3M30A 1O51A 2C42A 2H65B 2N4CA 4QJVA 2VFSA 3C19A 2R8KA 1DFDA 5HVGA 4MIWA 2CQHA 1VLYA 3GIJA 2E1AA 3T3FA 2BQRA 2CWKA 3MFHA 2J0WA 1RT6B 1C4CA 3W9IA 3IM9A 1URNA 4OYPA 3J80Y 2G0IA 3DDIA 2HS0A 4DL6A 2LQJA 4ZVEA 1N5YB 1TKXA 4MFBB 4KPCA 3NAHA 5T14A 3FUYA 1CJKA 5J1PA 3LPYA 3UDVA 3OUYB 1OQ3A 3ZZPA 2BRKA 4HTJA 2DRDA 2LA6A 1RTIB 1TMJA 4L74A 2YKNA 2RDJA 2CPZA 2GVDA 4KFBA 4V1Ak 2P9CA 3QWPA 5KOWA 3TAPA 3OFFA 4RJVA 4QYZJ 2L9WA 2N82B 4KGMA 1QUVA 4ZVPB 1VQSA 3MGJA 1FEEA 3DRPA 4C3KA 2XI3A 2ROEA 1T94A 3CJQA 4I67A 2VFTA 3TR5A 1WUUA 4OV6A 1W7WA 2DIUA 3KLHA 1VC0A 4ALZA 2HNZB 2ASJA 1ZAVA 1HNVB 3SI8A 4A47A 4YP3A 1JNZB 5LOQA 2GHWA 3HZEA 2IM3A 3BQ0A 2LQ5A 4C8KA 4DPYA 3L09A 3NEKA 2Y1JA 3TVYA 5LSRA 2HZVA 3WC2A 1HLWA 2A2DA 4PG6A 5B0GA 2PMWA 4NLUA 4HV0A 5K9FA 2YPYA 4O3PA 1SC6A 1IR0A 1IRQA 3NNCA 5H9EJ 4ELTA 2CRLA 4L3KA 2R7UA 2FD2A 2QLFB 3S1TA 3TA2A 3GLJA 4LR7A 4MH8A 1AXQA 4QIFA 2H4WB 2I38A 2EVZA 1XR5A 3PR4A 1GXTA
chains in the Genus database with same CATH topology
2BJ3A 1EA4A 1BDVA 3GXQA 2WVEA 2CPGA 2WVBA 1MNTA 3BKTA 2BNZA 3VEBA 3QSIA 2JXIA 2BJ9A 1P94A 2KELA 2FGCA 3FT7A 1NLAA 3H87C 3LGHA 1BDTA 2K29A 1ARRA 2CAXA 1B01A 2K6LA 1PARA 2CA9A 2BJ8A 3VW4A 2AY0A 2JXGA 2K9IA 2BJ1A 2CAJA 1U9PA 2F1FA 3QOQA 1B28A 2HZVA 2CADA 1Q5YA 3FMTA 4ME7E 3OD2A 1X93A 4FXEA 4HV0A 3VEAA 2GPEA 3PHTA 3BKFA 2HZAA 1ARQA 2WVDA 1IRQA 3BKUA 2WVFA 2JXHA 2BNWA 2BSQE 1QTGA 2RBFA 4D8JA 2K5JA 2PC6A 2K1OA 2BJ7A 2NZCA 2Y3YA 2WVCA 2H1OE 2BA3A 1BAZA 1MYLA 1Q5VA 1MYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ3 A;  1EA4 A;  1BDV A;  3GXQ A;  2WVE A;  2CPG A;  2WVB A;  1MNT A;  3BKT A;  2BNZ A;  3VEB A;  3QSI A;  2JXI A;  2BJ9 A;  1P94 A;  2KEL A;  2FGC A;  3FT7 A;  1NLA A;  3H87 C;  3LGH A;  1BDT A;  2K29 A;  1ARR A;  2CAX A;  1B01 A;  2K6L A;  1PAR A;  2CA9 A;  2BJ8 A;  3VW4 A;  2AY0 A;  2JXG A;  2K9I A;  2BJ1 A;  2CAJ A;  1U9P A;  2F1F A;  3QOQ A;  1B28 A;  2HZV A;  2CAD A;  1Q5Y A;  3FMT A;  4ME7 E;  3OD2 A;  1X93 A;  4FXE A;  4HV0 A;  3VEA A;  2GPE A;  3PHT A;  3BKF A;  2HZA A;  1ARQ A;  2WVD A;  1IRQ A;  3BKU A;  2WVF A;  2JXH A;  2BNW A;  2BSQ E;  1QTG A;  2RBF A;  4D8J A;  2K5J A;  2PC6 A;  2K1O A;  2BJ7 A;  2NZC A;  2Y3Y A;  2WVC A;  2H1O E;  2BA3 A;  1BAZ A;  1MYL A;  1Q5V A;  1MYK A; 
#chains in the Genus database with same CATH topology
 1NK5 A;  2JLG A;  4MMO A;  2BW7 A;  3CJS A;  1NKE A;  2XMK A;  4JI2 F;  4YR3 A;  2KN4 A;  3F56 A;  3Q24 A;  3Q8R B;  3HHL B;  3KLE A;  4J9L A;  4WXO A;  2MQM A;  3DLE B;  4F3M A;  2AX0 A;  3TZX A;  3D1Q A;  3DMJ B;  5E33 A;  4UOH A;  2HND B;  1ZA2 B;  2KZM A;  4ECV A;  1FDN A;  1TL7 B;  5DO2 A;  2JEF A;  1WEY A;  3EVO A;  2CA9 A;  1I6J A;  1PYO B;  1SH3 A;  3X3U A;  3LW5 C;  2DR5 A;  4JI2 J;  1CJT B;  4ZVF A;  1MU2 B;  1X4D A;  4NCG B;  1UW4 A;  2VQF F;  4HL9 A;  1RCX B;  3MMB A;  3MDF A;  2CYY A;  2HGL A;  3AOC A;  5E0O A;  2PEB A;  2A6O A;  4TLR A;  3DU6 A;  3CWJ A;  1R89 A;  1VIX A;  5HJX A;  2MLX A;  4OYI A;  3C66 A;  1RWN B;  3D0I E;  5IM0 B;  2AQ4 A;  4IR1 A;  4J9V A;  4LRD A;  3FKB A;  3KJF B;  4RUB A;  1X31 C;  3AB4 B;  4OLO A;  1SKW A;  5HJY A;  1BXN A;  1X5T A;  4EWT A;  1K0V A;  2IVF B;  1V3S A;  2QV6 A;  2JRS A;  2KTQ A;  3DLG A;  2LEB A;  2JFD A;  1YBT A;  1RTZ A;  7FD1 A;  3MTK A;  2XEX A;  3QSI A;  3BV8 A;  2J6S A;  1WHW A;  2UZA A;  3K89 A;  1LWF A;  3IWN C;  1VGY A;  2IFX A;  3RB4 A;  3FFI A;  1H2V Z;  1AUS L;  3IBC B;  3IR7 A;  1MWQ A;  2AYE A;  1WF2 A;  3SQO P;  3KLG B;  3JYT A;  4W4M A;  4ECR A;  2AJ0 A;  4CO2 A;  2RIJ A;  4ZCL A;  1U1O A;  2DY9 A;  1J5O A;  4I2Q B;  1JLB A;  5IC6 B;  4FPI A;  1NAQ A;  3LAM A;  2Z57 B;  1OYE A;  2ZZM A;  3BGO P;  2ZH7 A;  1Q95 G;  3D6F B;  4AFF A;  1FXR A;  1ICE B;  4ZLL A;  1S9G A;  4EBC A;  1B3T A;  3P49 B;  2DNR A;  2QLX A;  1T95 A;  1RU1 A;  2H51 B;  4DR4 F;  3BQ2 A;  2WVB A;  1HBU B;  4NCA A;  3L7U A;  2IBO A;  4IOA Q;  3OXL A;  5CA5 A;  1UVL A;  1FJE B;  2QRR A;  2G9O A;  4DPT A;  1VDH A;  3JTO A;  1B7F A;  3GIM A;  3FSX A;  1FDD A;  3OTE A;  1JJ4 A;  2XYP B;  2VKR A;  3DN9 A;  4URS A;  1MRO B;  4DX6 A;  4DR4 J;  1K8A T;  4I7F A;  4Y2C A;  1ZM2 A;  3EXY A;  5KOX A;  1HW8 A;  4J9R A;  2XG8 A;  4ES1 A;  2VIC A;  4IQX A;  1HMV B;  1EAY C;  5IT0 A;  3MMA B;  2CG4 A;  3M9O B;  1FTR A;  5LMN J;  1U2R A;  3CF5 Q;  4LFA F;  4K4V A;  2VL1 A;  5KFN A;  4DPX A;  5D3G A;  1G7C B;  4DUY F;  4N8O A;  3MHY A;  4ED4 A;  1UAW A;  1WC5 A;  5KT7 A;  2DNH A;  1PYT A;  3VTI A;  2B9Y A;  2KJW A;  3DLK A;  4RW8 B;  3Q0A A;  5J1N A;  2ASY A;  2XUL A;  2WVE A;  3D6M B;  4ED3 A;  2ZNY A;  2W2O P;  1U25 A;  2C22 A;  4WWS A;  2YNG B;  2Z2Z A;  3UW1 A;  2BJD A;  3VCD A;  2BNZ A;  1QDU B;  2K06 A;  2XQC A;  2LCW A;  4QW8 A;  4DR1 F;  1TL5 A;  2BA9 A;  5I42 B;  4YHH F;  2MYF A;  3G6V A;  4GVL A;  3BR9 A;  3HHD A;  2UVV A;  3TZZ A;  4M5I A;  1KON A;  3TI0 A;  3JAM U;  4I69 A;  2B5J B;  2JC0 A;  4BS2 A;  2LP4 A;  1RCO B;  3E51 A;  4KHM A;  1HYS A;  2MJN A;  3M8R A;  3OTO F;  4DR1 J;  1FX2 A;  2PMH A;  2PFF B;  4LIW A;  3VQS A;  3ZTS A;  2JXH A;  2UVU A;  3DYA B;  2BEF A;  2CPJ A;  2ZBC A;  2XLJ A;  1TL3 A;  3W8G A;  3OTO J;  2C28 A;  3CCZ A;  1HHT P;  3ITH A;  4CO0 A;  2Y8Y A;  4WE1 A;  3BF4 A;  2CPG A;  1SUQ A;  5H9F K;  1HD1 A;  2EEY A;  2GVZ B;  4NLD A;  1RXO B;  2B7C B;  2R8H A;  2FHO B;  4OV1 A;  4R8U A;  4J9N A;  1SI9 A;  4P9S A;  2IC3 A;  3SQG A;  1KHW A;  1S5Z A;  4DQR A;  1WDD A;  3K7R A;  4NX9 A;  1OIA A;  1C1C B;  2D3O 1;  4ZN1 A;  3RJM B;  5K20 B;  4WZM A;  2UVR A;  1JXL A;  4ILM A;  2BAN A;  2DRA A;  3GSD A;  1EX8 A;  1GEH A;  4PQA A;  3W64 A;  3C46 A;  4CM2 A;  2Z2Y B;  4H4M A;  1QSS A;  3CCE S;  2OJ3 A;  3H25 A;  5DQI A;  1NDC A;  4A8M P;  2VV5 A;  2NUU G;  2YNF B;  5M2U A;  1FX4 A;  3PO5 A;  2WSF C;  5A8R A;  1JQG A;  3H4B A;  2DNQ A;  4OJ3 A;  3IWX A;  2NXC A;  2DR7 A;  5DGB A;  1FK9 A;  2E5L F;  4RBU A;  3E01 B;  1GNK A;  2JBV A;  1SH0 A;  3CNQ P;  3SEO A;  4TU7 A;  3S8S A;  1ARO P;  1BAZ A;  3VAF A;  2ZZT A;  1YJW S;  4O4G A;  1FJG J;  1NSK L;  3CDE A;  2WK4 A;  2EFQ A;  1BC6 A;  2M8D B;  4L3N A;  4DN0 A;  2JOQ A;  2DTJ A;  4TQR A;  2CZ9 A;  1QAJ A;  5A0Y B;  2VOP A;  3DXB A;  4NRT A;  1JKH A;  3GJT B;  2E5L J;  3C6U A;  3A3P B;  3RB3 A;  1RWW B;  2MLY A;  3GSI A;  2QA4 G;  1YTY A;  1VQ4 S;  1ARR A;  2Y9H A;  4OZ3 A;  3NWG A;  4QWC A;  4U7U D;  3CD6 S;  4F67 A;  1LWX A;  4DV6 F;  1IKX B;  3PX6 A;  2V8D A;  2MZS A;  3IM8 A;  1KOH A;  3BEG B;  2XMJ A;  4MJW A;  4EYI B;  1JLA A;  2DHX A;  3R5G A;  3PIO Q;  5ETS A;  3SV4 A;  2AT1 B;  5HK4 A;  3TYT A;  4HT5 A;  3KLI A;  2KG1 A;  1VQY A;  3OHB A;  4DHV A;  1NK8 A;  1LWC B;  4DV6 J;  2NYI A;  4AQY F;  1WHY A;  1REV A;  3LWL A;  3HVT B;  4X64 J;  3UVJ A;  5ETQ A;  2E66 A;  3GFX A;  4AUK A;  3DCA A;  3IAS 9;  3HFK A;  4Y2K A;  2BYC A;  3VR1 A;  1YG0 A;  3K57 A;  1F9E B;  1LOU A;  4JI4 F;  1MNT A;  3L95 X;  4AQY J;  3IG1 B;  2ZWP A;  4DWI A;  4LR8 A;  4OLP A;  3T1H F;  4A8O A;  4FBT A;  2GAG C;  5LXR A;  1S6U A;  3UCG A;  2F8E X;  2NXJ A;  4MTP A;  2WCX A;  2MKJ A;  1PKU A;  1R8A A;  3QT5 A;  3LP0 A;  4NXM J;  2FZG B;  1S12 A;  3M6U A;  3UR0 A;  2FLP A;  3OFE A;  2HMI B;  2HFU A;  2BJ1 A;  4AL5 A;  1WG4 A;  3U27 A;  4XPE A;  1CJV B;  3L7P A;  3T1H J;  2X7I A;  4MAK A;  5B09 A;  5DET A;  1VBX A;  5B7W A;  3OHA A;  5G4D A;  1PIL A;  3KHH A;  5F0W A;  1IBC B;  3PYD A;  5ETK A;  4KHP F;  3SYZ A;  3TEG A;  2DR8 A;  3ZO7 A;  1TKT A;  3CIZ A;  2XHW A;  2WBR A;  1Y11 A;  3IGV A;  4CLW A;  4RL1 A;  5AJ3 F;  2DNG A;  2V68 A;  3KUE A;  3MEE A;  3QIP B;  2EXU A;  2Z30 B;  4U9R A;  5KFO A;  1T9Y A;  1T9V A;  1H73 A;  2G1D A;  3H5U A;  4FF3 A;  3GP9 A;  4DJB A;  1U48 A;  4USK A;  2IAJ B;  2EG1 A;  2MZJ A;  3AAW B;  2AKW B;  4EUV A;  1P94 A;  3J7Y U;  2HHT A;  3VAJ A;  5AJ3 J;  1VHI A;  2OPQ B;  3UD5 A;  2VG7 A;  2RAQ A;  1HHS A;  2QT7 A;  5F41 A;  3LWM A;  4WTY A;  3BSA A;  3JXO A;  1N56 A;  2OO4 A;  3TWZ A;  1U1M A;  2HHX A;  4PCQ A;  5DDP C;  1CJU B;  2PFD A;  1NPK A;  5KG4 A;  1I1G A;  1QTM A;  4B3M J;  5DGA A;  3M8W A;  2HZA A;  4ED5 A;  2IDL A;  2CVE A;  1FKP A;  4HDH A;  1XC9 A;  2W2Q P;  1NKB A;  1Y4Z B;  1KLM B;  2K1R A;  1UVI A;  4FF4 A;  4LFB F;  1KP6 A;  3KDN A;  1D8Z A;  4ZOS A;  3AY0 A;  4FNH A;  1JLE B;  3M6W A;  3IRX A;  3N6N A;  1S0V A;  4K8R A;  2ERR A;  2VQE F;  1M1K T;  1RT2 B;  1P27 B;  2GML A;  3W1Y C;  4FF2 A;  1WHV A;  1KSP A;  2HSE B;  1V9O A;  2JXI A;  3D4J A;  1Y5N B;  1UJ4 A;  2PN6 A;  2K7K A;  4K4S A;  5H1S V;  1NUE A;  4C9D A;  2DRB A;  1FE4 A;  2OSR A;  2XZW A;  2CPF A;  5LMU F;  4N76 A;  3EXC X;  4ES3 A;  2CQP A;  1S1V A;  2GHP A;  2UXD F;  1GMU A;  4YDD B;  4D3H A;  2CUY A;  1HWK A;  3RB6 A;  2K7J A;  3GFY A;  2XWX A;  3MCN A;  1HIY A;  2V9K A;  3M2U B;  4AXI A;  1KVI A;  3GYG A;  3N5F A;  5LMU J;  3DLJ A;  2V8H A;  1DLO B;  1IUJ A;  1S1X B;  4JI0 F;  2C3P A;  2EK1 A;  3NGR A;  5ETR A;  2UXD J;  4ID5 B;  1RWO B;  5HMX A;  5DRK A;  3EGN A;  4KT0 C;  1TQL A;  1VRU A;  1Q5V A;  2GS8 A;  1NZA A;  1UFL A;  2DXD A;  3BSO A;  2AZ1 A;  1N36 F;  4Z7C A;  3PNI A;  4WII A;  3TW0 A;  1PYS B;  1ZM3 A;  5GAE I;  1XNR J;  5C2G A;  3RAQ A;  3QLH A;  2DNM A;  3RBD A;  2HFN A;  3HHN B;  2ACM A;  4ECQ A;  1PC4 A;  2ZHB A;  3T1Y F;  1GMV A;  2Q6B A;  2EFV A;  2XGP A;  3BR8 A;  3HK2 A;  3DU5 A;  5HSP A;  2CJ9 A;  4URQ U;  5F3Z A;  2G0J A;  4ECZ A;  3HFZ B;  3T9N A;  3ONQ A;  3V6D A;  1J5E J;  1RP5 A;  3SCI E;  1LK7 A;  2B56 A;  3I87 A;  3ET6 B;  2GQC A;  3P5T L;  5HAN A;  2KOE A;  3R5D A;  5HMW A;  3G2X A;  2KXH A;  2DKO B;  2PO4 A;  1S6P A;  1EP4 A;  4PPZ A;  4PXC A;  5K8M A;  3PRV A;  3QRP A;  5F9N A;  1GQE A;  3FSI A;  2HBR B;  4V19 J;  1UJ6 A;  5KFU A;  1UKU A;  2YWH A;  1FCA A;  1IBK F;  2M3D A;  3PW2 A;  2Q43 A;  5HBM B;  4MIB A;  1SB6 A;  1MW7 A;  4PXD A;  3UCU P;  4F8R A;  2LXU A;  3MCM A;  2DIS A;  4A8S A;  2UUW A;  4CIO A;  3OQ2 A;  4C48 A;  1M5O C;  3CVK A;  1IBK J;  1FD8 A;  4OX9 J;  3OBI A;  4JB8 B;  3IP0 A;  5F3T A;  4OZN A;  1FRM A;  2H3A A;  3O5T B;  1VRT B;  2RD5 C;  3L7O A;  2J8S A;  1Q5Y A;  2H3E B;  4KH0 B;  4QR2 A;  1T3O A;  3LF0 A;  5D4L A;  4W90 B;  3FGV A;  2MMY A;  4G3I A;  3KHL A;  1QTG A;  3UR3 C;  2PA3 A;  5KFC A;  2K2P A;  3CCM S;  2IM2 A;  1M1G A;  2H9Z A;  1R8B A;  2WB4 A;  1QSY A;  2VDH A;  2BJ3 A;  5J2M A;  3CDA A;  2N3O A;  1FO1 A;  4MKV A;  2KB2 A;  3RTV A;  4HR2 A;  2KHD A;  3UQS A;  2UUB F;  2FJD B;  4UST A;  2FVS A;  2LQB A;  4DN9 A;  4TNO A;  1RKJ A;  5AXN A;  3D5M A;  3VEB A;  1MMD A;  1SC4 B;  1OY9 A;  4DL5 A;  2RQC A;  4FN5 A;  3A12 A;  5J2Q B;  4YDX A;  2YNH B;  4C7Q A;  4HHU A;  1YSJ A;  2LYV A;  3F73 A;  1EET B;  4FYW B;  1N88 A;  1E6V B;  1TK0 A;  2UUB J;  5CD4 H;  1WJ9 A;  3GCW P;  4B17 A;  2XM3 A;  4UQG A;  2BR0 A;  2R9L A;  4AL6 A;  2AJ4 A;  1M90 T;  2R8G A;  2EFN A;  1WOR A;  2XWY A;  2XY7 A;  2FLN A;  2FC8 A;  4FF1 A;  4QBU A;  2NSC A;  8RUC A;  2HAI A;  4DQQ A;  1BMQ B;  2E9R X;  2CPY A;  3UO0 A;  1F5B A;  2QA1 A;  2W24 A;  1U1R A;  4OYO A;  4JI5 J;  2A6M A;  1IKY A;  1RBA A;  1PJ6 A;  4BLG A;  1RT4 A;  2XGQ A;  1WG1 A;  4DF8 A;  1Y3J A;  2HWH A;  3NS7 B;  3MM9 B;  1HBN A;  2M9K A;  2VFV A;  9RUB A;  4ZIV A;  2CPH A;  5CYM B;  1U49 A;  3NBP A;  3RB0 A;  1MWZ A;  3H4D A;  4QPT A;  4NLT A;  1VQP S;  1RHM B;  1TKD A;  5KFY A;  1RWX B;  3FNN A;  2VZ9 A;  3O44 A;  1OSC A;  1IQZ A;  4KV8 A;  2W4P A;  5G0R A;  1MN9 A;  2CZ4 A;  4ENO A;  4BWJ A;  4GVB A;  2RF2 A;  3CCR S;  3OR1 A;  2IY5 B;  1TL1 A;  4A8W A;  2WHO A;  4TVA B;  2LU1 A;  5EGY A;  3EPI A;  3OV7 A;  1HD0 A;  3BGR A;  4NLP A;  1EKS A;  3K0J A;  4C4W A;  3T5H A;  5B0A A;  1ZZN A;  2LA4 A;  3RAX A;  1RT5 B;  2R7S A;  3PV8 A;  3HSG A;  3M6X A;  4LF6 F;  3KXD A;  4P52 A;  2NS1 B;  5ETM A;  4P7V A;  3C6T A;  1Q4R A;  5KFI A;  3GFH A;  3K5M A;  5GAH U;  1ZAW A;  2VG5 A;  4USH A;  3FEY B;  1RT3 B;  4JOU A;  4C8M A;  5DJB A;  1RYS A;  2ZEJ A;  3IS9 A;  4B9N A;  4IFY B;  2CQ0 A;  4ANC A;  2ROP A;  2V69 A;  2EC0 A;  1NK6 A;  1HW9 A;  4IH6 A;  2APO A;  2UUA F;  2WBM A;  4XTT A;  3EMT A;  2BKO A;  2VIH A;  1S97 A;  3FC9 A;  1WF0 A;  4KO0 A;  1UVM A;  4FXW A;  1S9E B;  2R7W A;  2YX7 A;  2BJE A;  1WC1 A;  4X4T A;  2AEM A;  3ZTQ A;  5I3Q A;  3W3S A;  3DOL B;  1XTZ A;  1RT1 B;  3NGS A;  4KTQ A;  5HP1 B;  2CIM A;  2HRY A;  2B4U A;  4ED2 A;  2OKQ A;  2J9E A;  3KK1 A;  2XZT B;  4LRB A;  3MAQ A;  2FUG 9;  4NEZ A;  4B3R F;  4WFY A;  1P6T A;  1D0E A;  4ZKA A;  2QLJ B;  5IT9 Y;  1TKZ B;  4K59 A;  2HW3 A;  1G3O A;  2JVR A;  5CQG A;  2D9P A;  1NDP A;  3TUP A;  3HJV A;  3JSY A;  4ETX A;  2XMA A;  1S99 A;  2DNK A;  5K5M A;  1M5H A;  4B3R J;  1NJZ A;  5ETV A;  3DC2 A;  4TYB A;  4IFV B;  3NOG A;  4PRF A;  3I0R B;  2MHN A;  2RH3 A;  4RUC A;  2FLL A;  2G1H A;  2POK A;  4EBE A;  4DR6 J;  3CCQ S;  4UTG A;  2AU0 A;  1QJH A;  3QNW B;  4A4J A;  1SH2 A;  4UZB A;  1B01 A;  3TP2 A;  1KQS R;  3W61 A;  4ZLP A;  4EGL A;  1VBZ A;  2HS3 A;  1YJR A;  5A8K B;  1ZOT A;  4K4T A;  1RWV B;  4ECW A;  5IV4 A;  1A0O B;  3MM7 B;  4HH1 A;  4A48 A;  1Z2L A;  4CLU A;  3PIP Q;  4ZCK A;  4N7T A;  4DV0 F;  2XMW A;  2DJW A;  1JLQ B;  5HQL A;  5IQ6 A;  4NA2 A;  1WD6 A;  2G2Y A;  5DQG A;  1QAI A;  2FHK A;  1R31 A;  3SFG A;  2V4J B;  4KJI A;  4KY3 A;  4MFB A;  2GMH A;  1YKW A;  2QMX A;  3WBZ A;  4DV0 J;  4L73 A;  5L39 A;  5GAD I;  4ZCI A;  4C11 B;  1NRK A;  3OUY A;  1U8W A;  2ZZN A;  3J81 Y;  2KU7 A;  5DM6 Q;  2J9C A;  4PEO A;  5RUB A;  5E5N A;  1OO0 B;  1KFS A;  1RTI A;  2ZBR A;  2ASD A;  2CQC A;  4DV2 F;  2XB2 D;  2HQG A;  1WEX A;  2JJ4 D;  4U8Y A;  2GIF A;  4ZPB A;  4R5P A;  1QAX A;  1S4E A;  3UN3 A;  2BJ8 A;  2VC0 A;  2A1B A;  4E2F B;  1Y9O A;  2AGQ A;  2H5J B;  3R5J B;  4I0W A;  4B02 A;  1BQN B;  3CED A;  1IJF B;  4HAC B;  2FDN A;  2CJQ A;  5C24 B;  2E1C A;  2BQU A;  1ZYQ A;  4NML A;  4IQM A;  2EPI A;  2L08 A;  3PO4 A;  1RAC B;  2KXN B;  2MKK A;  2BUN A;  2HNZ A;  1HNV A;  2AMC B;  2JEG A;  3L4B C;  3OVB A;  2VON A;  3C16 B;  4AND A;  3A1Y G;  4XO0 A;  1SCJ B;  1EZZ B;  3I4H X;  1FRH A;  2QO3 A;  2XSF A;  3BN4 A;  2V6A A;  1T03 B;  2HYI B;  1BQM A;  1Q1K A;  1V3R A;  5LL6 d;  4N56 A;  2QMU B;  2XSJ B;  2LQ8 A;  3PW5 A;  2NXU A;  8ATC B;  4GC6 A;  4DL7 A;  3O6Q A;  3W7B A;  4TLQ A;  2VD3 A;  2QEX S;  1FF2 A;  2F5G A;  3GMG A;  4Y6I A;  1VOM A;  1FKA F;  4PUO B;  1TVR B;  4C3M A;  3OLB A;  2Q3P A;  1S4F A;  4J37 A;  3Q8Y A;  3ZC4 A;  5GAG I;  2YH1 A;  2E1P A;  5EWG A;  3ELH A;  1SC1 B;  5J2N B;  2AGO A;  3NL0 A;  2U2F A;  1PIE A;  3UFC X;  1U24 A;  1YBU A;  4Q5V A;  2OGU A;  2R7Q A;  3C8Y A;  3HHL A;  2EI5 A;  4Y2I A;  2QG9 B;  2VAS A;  3DMJ A;  3MR7 A;  3G9C A;  4U95 A;  1I51 B;  3VVT A;  2HND A;  1E6Y B;  1S7I A;  4Q0B B;  4CCH A;  3MED B;  4XK8 C;  2ZJP Q;  1TL7 A;  1RYR A;  1FNM A;  2MXY A;  3TVK A;  1EA4 A;  1WEZ A;  2DR6 A;  4F4Y A;  3UN5 A;  2ZJQ Q;  2XTJ P;  1CJT A;  1MU2 A;  5DS7 A;  2O3D A;  1D1U A;  1N6Q B;  1H74 A;  5FII A;  5JJB A;  4J9Q A;  3OSP A;  4W98 A;  5KFV A;  3AD9 C;  5IM0 A;  4Q45 A;  2FZC B;  1S1T A;  4XAK A;  4UY8 5;  1PBU A;  4DPO A;  1N32 F;  2J7U A;  4DR2 F;  4C3L A;  1B64 A;  5IQQ A;  4AXJ A;  2KRB A;  4OYZ A;  1SJ4 P;  1YJ7 A;  1I94 F;  5LJ3 Y;  1CQN A;  2YXL A;  4IR9 A;  2LEP A;  1H7W A;  4UOG A;  4R0J A;  1YRX A;  2DGO A;  5DM7 Q;  3R5A A;  2MKI A;  4UUW A;  4KGK A;  2BE2 B;  4HYK A;  2CZV C;  1NSP A;  4DS5 A;  1I94 J;  1XWL A;  4HDG A;  1YZ7 A;  1NDK A;  3G86 A;  2BE9 B;  2MQL A;  3I5C A;  5IWA J;  3KLG A;  4ZIW A;  4ECY A;  4DSF A;  1HBM A;  2KXF A;  2DR9 A;  2CKW A;  2ZVS A;  3S6E A;  4G65 A;  2EFG A;  2DPJ A;  2BX6 A;  3D2W A;  3I4P A;  3PJW A;  4ZN3 A;  4FYD A;  1UET A;  2F9D A;  4LF1 A;  4ZP6 A;  3MPW A;  5THW A;  4IRC A;  2G4B A;  1VQK S;  1N4L A;  2V2Z A;  4FKY A;  4IYQ A;  1A6L A;  2E9Z A;  3SCL E;  1TTH B;  1RBO B;  2C2N A;  5EWE A;  4YB6 A;  2B8Q A;  5E41 A;  4GKK F;  4M5L A;  3G8Q A;  1BQX A;  2V8G A;  3ZNU A;  5EN1 A;  3QGH A;  2QLB B;  1MRO A;  1FFG B;  4OYA A;  3Q2T C;  4DV7 J;  3JQJ A;  1RHJ B;  1JMT A;  2LXI A;  4CH1 A;  1G4C A;  2AD9 A;  1JK9 B;  2QN6 B;  2ZH5 A;  2K3I A;  4DX8 H;  5L38 A;  1U1L A;  1QVF R;  2GAH C;  4I68 A;  5BYR A;  4OZ2 A;  2NXN A;  1HMV A;  4GKK J;  1RTH B;  1YJN S;  3M6V A;  1YIJ S;  3C14 A;  4P74 A;  3D0H E;  1Q8L A;  5K8O A;  5HI7 A;  3AQP A;  3K5P A;  2CXE A;  3Q8Q B;  4ED6 A;  2YX1 A;  4P2M A;  3R6L B;  5AXK A;  2ZE2 B;  4USU A;  2YNI B;  2AW0 A;  3W60 A;  1FES A;  5SZT A;  3VW4 A;  1RAJ A;  1JJH A;  4M95 A;  1TUV A;  1DTT A;  2IHR 1;  1DZ5 A;  2HFZ A;  1B0T A;  3H2L A;  2XHC A;  1WI6 A;  1PC5 A;  3EE3 A;  4EI2 A;  2GVD B;  4KFB B;  3S01 A;  3B4M A;  1S76 D;  4FXV A;  2HHH F;  1OY6 A;  4LF4 F;  2Z58 B;  3GV8 B;  1K73 T;  2DXF A;  2OMO A;  1NK9 A;  3AD8 C;  4OI2 A;  1WI8 A;  1AB8 A;  1UPP A;  5DDQ C;  5I42 A;  2N7Y A;  1NDL A;  3D3B J;  4DL4 A;  5CCM A;  2JLF A;  2MKY A;  3VAL A;  2ROG A;  2KM8 C;  4OZ0 A;  1MYL A;  1CS4 B;  4LF4 J;  1FTC A;  4FYX B;  1TAU A;  2CJA A;  2B5J A;  4QU6 A;  1X4B A;  5L1L A;  2VBZ A;  1JB0 C;  1ZET A;  3V5R A;  2R2T A;  2RHQ B;  1BE4 A;  1O0P A;  2R2R A;  4ILR A;  5HN0 A;  1T05 B;  1BD6 A;  4ITS A;  3DYA A;  1IBM J;  2NZ4 A;  1RBL A;  1PGZ A;  4KGV B;  4CZC A;  4X84 A;  2YVS A;  5BR8 F;  1X9W A;  4LSN B;  4WKY A;  1LEO A;  1WOS A;  2N3L A;  2CQD A;  4ZPC A;  3OVA A;  5DLG A;  5K8N A;  4AYB D;  3G8S A;  2RU9 A;  4L72 B;  3CDW A;  1QTN B;  2E1M C;  3VV2 B;  1X4H A;  4Y34 A;  2GVZ A;  4QYZ K;  3KDO A;  3FQK A;  5CYQ B;  3SCJ E;  2G2O A;  3FK4 A;  1SXL A;  2LDY A;  2HHU A;  4EK2 A;  1BGX T;  2CQ1 A;  1C1C A;  2KKH A;  3D68 A;  5KG7 A;  3TX8 A;  3WHI A;  4DQS A;  2GQ2 A;  2LKZ A;  2CNK B;  5L46 A;  2CWX A;  2XMV A;  2MLZ A;  4OX6 A;  2RUG A;  4NLQ A;  4P7T A;  3FRY A;  4O3N A;  5IZH A;  2V4R A;  1N34 J;  1UVN A;  4CWB A;  1XQI A;  5KFS A;  3I5B A;  5KG0 A;  3HXM A;  4PR6 A;  2ACY A;  4YY3 F;  2MQQ A;  4JI3 J;  3I9Z A;  2YNF A;  4JV1 A;  4QWB A;  2EG2 A;  3FT7 A;  2VC1 A;  2RDD A;  4X4V A;  1APS A;  4WFB Q;  2Y0S D;  1F9H A;  4USM A;  1NH8 A;  3E01 A;  2HIY A;  5FD1 A;  3CGI A;  3DLB A;  4DSI A;  2EK6 A;  3PEH A;  2JL9 A;  5H9E K;  1WNE A;  4YY3 J;  2ATL A;  4WFN Q;  4B3O A;  1RA7 A;  3IBF B;  1U4B A;  1FNX H;  2B9E A;  3PYF A;  3GU0 A;  1NK7 A;  1GTE A;  5A0Y A;  1UP1 A;  2WVD A;  1DQA A;  2HQ3 A;  3T41 A;  4DV5 J;  4MYT A;  3BBF A;  2OML A;  3PVX A;  4F2R A;  3P45 B;  1FXL A;  1HWJ A;  3M8S A;  3IWL A;  2ALY B;  4J91 A;  1TK8 A;  1IKX A;  2AJQ A;  2IPO B;  2J8A A;  4Q44 A;  2KRR A;  1MML A;  1LWE B;  4P73 A;  1HQU B;  4P2F A;  2BAB A;  1KFD A;  4LUB A;  4RNH A;  3A3N B;  4CO5 A;  4J9P A;  4OZL A;  4MT1 A;  3A8E A;  1TEL A;  3R7B B;  4M1K A;  4RU9 A;  2BVZ A;  3CJ2 A;  2D74 B;  4NLX A;  5D0E A;  1UEV A;  1U47 A;  2C1E B;  4I56 A;  3JYT B;  3RRH A;  1HPZ A;  3D1O A;  1S1U B;  1Y10 A;  3GIR A;  3LUY A;  4DX5 A;  5L9N A;  3A3O B;  5HL7 Q;  2LQ9 A;  3LGN A;  1YIT S;  3CD7 A;  1P9Y A;  3ZFV A;  4XDC A;  4EEY A;  2QIF A;  4PYA A;  3EZU A;  4Y3C A;  1S9G B;  2NPF A;  4ECX A;  3P6Y C;  1R8P A;  3AJ2 A;  2VKZ G;  4FS2 A;  3SSR A;  1U6F A;  3KNA A;  4DR5 J;  3MCO A;  2E29 A;  1RDR A;  1X4E A;  4NZ6 A;  1RAF B;  4KKO B;  3OR2 B;  4NWB A;  4UZC A;  3RR7 A;  2OPP A;  2Y1L B;  2HHS A;  5CCL A;  2HMI A;  3R7N B;  3MUT P;  1EAR A;  1DRZ A;  2KYZ A;  5KG1 A;  3J7Z 5;  1KTV A;  1CJV A;  2VUG A;  2W2M P;  3MWB A;  3HCX A;  1RAA B;  2KH9 A;  1U6Z A;  3DRR B;  5LM7 E;  3H98 A;  4UT4 A;  2YQ3 A;  3LGH A;  4HVZ A;  4NA1 A;  2XO7 A;  2L48 A;  1VMB A;  1IR2 A;  1H0H B;  4A8F A;  3I82 A;  1VC5 A;  3HHL D;  1X9S A;  3UD3 P;  3QIP A;  2KJV A;  3H5X A;  3RBX A;  4IRK A;  2KT2 A;  2V9W A;  5HRO B;  1HKA A;  4OIX A;  2F4V J;  3NLC A;  2M88 A;  1VK3 A;  4IOB A;  3N28 A;  2ADC A;  5EUH A;  3OXG A;  4X66 F;  2GNK A;  2IAJ A;  1K47 A;  2OLW A;  3W8P A;  1X0F A;  1ARQ A;  2F4F A;  4ZJQ A;  3CO9 A;  3LA0 A;  2W7P A;  4NLG A;  2ILY A;  3TQE A;  2N7C A;  4MKB A;  1HNX F;  2FHM A;  4CYU B;  3CDU A;  4ZPW R;  3B4D A;  2UVW A;  1AW0 A;  3QO9 A;  3I5A A;  1IBL F;  2FGO A;  3AB2 B;  3M4X A;  2BBE A;  2R7O A;  2UXC F;  4UUX A;  5I3U B;  3CTR A;  2DO4 A;  2Z4P A;  3HUL A;  3BBB A;  3D6H B;  3HJF A;  1OSD A;  1CPZ A;  1WSV A;  1IBL J;  4QQB A;  1YGY A;  1KLM A;  3NGT A;  4NZ7 A;  2XLI A;  1U6B A;  4PG8 A;  5IC4 B;  1JLE A;  2HWI A;  2UXC J;  3N79 A;  2I8E A;  1LK5 A;  1NHU A;  1RJJ A;  3NY0 A;  5FLX U;  2GA7 A;  3V4I A;  1TUG B;  1RT2 A;  3NS5 A;  3K59 A;  2PGC A;  4Z2X A;  2KFN A;  2QGF B;  3PHT A;  4OX7 A;  4HI2 A;  3AOB A;  4WU2 A;  3SZ2 A;  5KFJ A;  3WDO A;  4TYA A;  4ZLN A;  3VWS A;  1H38 A;  5AE3 A;  2W9A A;  4PXE A;  3M2V A;  4R8U B;  3DOK A;  5KFG A;  1VQ7 S;  2IC3 B;  1S72 S;  3SQG B;  2AF6 A;  2F9J A;  4YN3 B;  2DIV A;  1ZM9 A;  3VVU A;  1WOO A;  4IG3 B;  4LF5 J;  4Q2M A;  1WF1 A;  3NCQ A;  1S7H A;  4GMK A;  2CNN B;  2KHC A;  2MDA A;  3G6X A;  1DLO A;  1FRK A;  2R4F A;  4OYB A;  3CW2 C;  4FYY B;  1S1X A;  4IG0 B;  4F04 B;  4DMZ A;  2DT9 A;  2HFS A;  4ID5 A;  1PAR A;  2CDR B;  1NSQ A;  2HFO A;  1OS5 A;  5HQM A;  5A8W B;  1RHR B;  3ZTP A;  2EFO A;  6AT1 B;  2MGZ A;  3DNC A;  1FK9 B;  5KFF A;  1H98 A;  2ZIT A;  2PD1 A;  1SQG A;  2X1G A;  3NCP A;  2SXL A;  1IVZ A;  3KKF A;  1HL6 A;  2DK2 A;  4RBV A;  2GIR A;  4USV A;  1SIW B;  2XMT A;  3HFV A;  3IR6 B;  3KG4 A;  3M8Q B;  2ZUG A;  3MAA B;  2BMB A;  3OL8 A;  1UVK A;  1JKH B;  4AL7 A;  4X65 J;  2QMW A;  3RBE A;  4FXD A;  1N5T A;  3ET6 A;  3AQO A;  3CJ5 A;  1TU0 B;  5F8L A;  3CCJ S;  2EBE A;  3CB4 A;  1HWU A;  4E98 A;  4PAB A;  1JLF B;  2G13 A;  3V6K A;  4CNY A;  2VPX B;  1D9A A;  4WU3 A;  2J0Q D;  2OPR A;  4OI4 A;  1RHQ B;  2VPZ B;  4PWD A;  3AOA A;  3KLI B;  3OFG A;  2ZBP A;  1NPP A;  3AT1 B;  3PXG a;  2RNE A;  1KR4 A;  2DCL A;  5HBM A;  4NA3 A;  1UWB B;  2I5J B;  3N9U C;  4ED8 A;  4OJG A;  4USJ C;  1T8E A;  1REV B;  2ZBQ A;  3W65 A;  2EWH A;  3MR2 A;  4QW9 A;  2NCK L;  2ZKU A;  4DX7 A;  2GGP B;  2W2N P;  2NYH A;  3MEC B;  3H20 A;  3R6G B;  2DHG A;  4F26 A;  1RAH B;  2MSS A;  2CQI A;  1RQ0 A;  3D3C J;  1KWM A;  3H5Y A;  2CPX A;  2DNN A;  3PCO B;  1WWH A;  3E2E A;  1ROF A;  3NGD A;  4K4Z A;  1OQ6 A;  3GYX B;  2XO6 A;  1VQ5 S;  2JSX A;  3BBC A;  2YWE A;  4DSL A;  3MEG B;  5LSO A;  2GJ2 A;  3LGM A;  2FC9 A;  1F2H A;  4K4X A;  3LP0 B;  3OJU A;  3TJ9 A;  4QWA A;  4J9S A;  2MY7 A;  4X4Q A;  2ZHO A;  4ZVQ B;  2FLO A;  2FTR A;  1X4G A;  2YQ0 A;  2P6T A;  1BDT A;  3MUV P;  2CAX A;  2HEK A;  2D69 A;  3DM2 A;  1GXU A;  2MEW A;  2VU5 A;  2KT3 A;  4C8Z A;  2QL9 B;  2DD8 S;  3KOA A;  1Y5L B;  1TKT B;  2YTC A;  5HQ8 A;  5EX3 A;  4K50 A;  4NLO A;  3H40 A;  3VAI A;  1HR0 J;  4N77 A;  1U02 A;  3J7A 1;  1M5P C;  3H7H B;  1URR A;  4NZ0 A;  3OJS A;  2VG6 B;  2FY1 A;  3RUB L;  1YK9 A;  2PSZ A;  5MLC V;  5J2Q A;  1LW0 B;  4DR3 J;  2YNH A;  4LT6 A;  2FJE B;  4LBH A;  3R2C J;  4DG1 B;  5E3C A;  3L9Z A;  3RR8 A;  1EET A;  2HVD A;  1E6V A;  2DNL A;  4ZVR B;  4K4Y A;  3OPK A;  4DCO B;  2VOO A;  2E5I A;  3GXQ A;  4I64 A;  2X3G A;  1WTB A;  2X51 A;  2KT5 A;  1W26 A;  1VQL S;  2BRL A;  3OW2 R;  2C2Z B;  3FZB A;  1D3W A;  4JI6 F;  4K2X A;  1EJ7 L;  4HH0 A;  3QJL A;  3MAH A;  5KG6 A;  2O01 C;  4P10 A;  4WK3 A;  1BHN A;  1CC7 A;  2NRE A;  4WCE Q;  3THV A;  1VI7 A;  1FKP B;  3D7S B;  2JXG A;  2I9S A;  4Z37 A;  4LIR A;  5FDL A;  1CUL B;  4OQJ A;  2MST A;  3MM9 A;  3RZA A;  4JI6 J;  5CYM A;  2V94 A;  3IXQ A;  3OD2 A;  2OI2 A;  3GB0 A;  3IRX B;  1Q82 T;  1R0A A;  2MB0 B;  3AXM A;  1YJT A;  5CZX A;  4DF4 A;  4C8N A;  3J80 U;  2FJV A;  2WVC A;  2KKE A;  4R25 A;  1HNZ F;  2UV8 A;  2H4Y B;  5LMN F;  1ULR A;  2HK3 A;  3BGF A;  4P71 A;  3LAN A;  3SFU A;  3KK3 B;  3NG8 A;  2ZBI A;  3CSK A;  3HSD A;  2DGS A;  1XR7 A;  4JBC A;  4PXB A;  5F8G A;  4V19 X;  3W66 A;  1UZH A;  1IM6 A;  1RT5 A;  3B8H A;  1HI0 P;  1HNZ J;  2VA3 A;  4J90 A;  5AT1 B;  2J6U A;  4WFA Q;  2D7S A;  1YWX A;  2V8P A;  2MJU A;  1UJ5 A;  3T6J A;  3DI6 B;  3Q89 A;  2OEK A;  1YJV A;  2QYG A;  2VPW B;  3EDQ B;  2ZH9 A;  3OT9 A;  2C2D A;  1BUX A;  1RHK B;  2HQC A;  4WTO B;  4IFY A;  1JLC B;  3K5O A;  4DDF A;  3M9M B;  4RO0 A;  1VRU B;  1C4A A;  2RHS B;  5D0G A;  3M05 A;  4YOE A;  3TAM A;  4K0K F;  2RBF A;  2I6W A;  2WW8 A;  1L3S A;  1ZH5 A;  2B8P A;  2V67 A;  1S9E A;  3NP5 A;  1RTJ B;  2BAC A;  1XBW A;  3QRQ A;  1NM2 A;  4LQ3 A;  1RIS A;  2CPD A;  2Z8Q A;  3V6H A;  4O0I A;  4F3O A;  3DOL A;  3NMR A;  1RT1 A;  2VJV A;  3CCW A;  5HP1 A;  1GH8 A;  4K0K J;  2ZWO A;  2IIH A;  1HQE B;  3G6E S;  2B6A B;  5DG8 A;  3GJR B;  4WIQ A;  4ZK7 M;  1RT7 B;  3H87 C;  2GO9 A;  3CUN A;  1IN0 A;  3ZTO A;  3FEZ A;  3GIL A;  1RWM B;  1ZPV A;  1R0B G;  2MQP A;  1IKV B;  2AJF E;  5KFB A;  4GKJ F;  2BDP A;  1D9F A;  4RW4 B;  2NLW A;  3ZZY A;  2V2V A;  1U9P A;  1D09 B;  4FBU A;  2C2O B;  3AD7 C;  4IFV A;  4EZ6 A;  1KTQ A;  3I0R A;  3MR3 A;  4C97 A;  6FDR A;  1F3V A;  2BM1 A;  3POT B;  4TN2 A;  2ADL A;  3WX8 A;  2M52 A;  3DGV A;  2QLW A;  5GMD A;  4K7Q A;  3PX4 A;  4GKJ J;  2HRT A;  4DSE A;  5A6W A;  1EB0 A;  2L3M A;  1GX5 A;  2C2E A;  1XMQ F;  2W4D A;  1VQO S;  4I2P B;  3BB5 A;  2MPU A;  1KBR A;  2H5E A;  4LF8 F;  1VJQ A;  5K14 B;  4MKY A;  1UMJ A;  2KYX A;  5DZ6 A;  1U0H B;  3T6B A;  4ATN A;  5LT5 A;  3HD2 A;  2C3Y A;  4NEY A;  1NJI T;  5ETT A;  2MZQ A;  1QSL A;  3VAH A;  1GT8 A;  3UDL A;  1XMQ J;  2E44 A;  4ECU A;  4LSZ B;  4LF8 J;  2P9G A;  4NCB A;  4MKA A;  2K6L A;  4OFZ A;  3ZZ0 A;  1FJG F;  3FBF A;  3TO8 A;  5A2Q Y;  4DOZ A;  2A3J A;  3E3X A;  3KLF B;  2FIU A;  2DGW A;  1WKK A;  1FDB A;  4C11 A;  3PW4 A;  1RGV A;  1Q79 A;  1F5A A;  3Q8P B;  2KG0 A;  3HMJ G;  3HD1 A;  3M9N B;  4C98 A;  2OPS A;  2XYH B;  3TA0 A;  5I3P A;  1JWW A;  4D8J A;  2RIL A;  4LF7 J;  1M5K C;  3WZ0 A;  4NLW A;  4PG4 A;  1XIQ A;  3THT A;  1HI1 A;  5BYQ A;  1VQN S;  4X4U A;  1N8R T;  3QT8 A;  3JSB A;  1R6V A;  2Y1I A;  3GJQ B;  4JI1 F;  4N41 A;  3GG1 A;  4OI3 A;  2IMW P;  1XNQ F;  1DAX A;  4IO1 A;  1ZM4 A;  1BQN A;  1S6Q A;  4CH7 A;  2NR0 A;  4DV3 F;  4HAC A;  3M1V A;  5C24 A;  2KEL A;  5KFA A;  4X64 F;  3W2V A;  3PJX A;  3KG1 A;  3K8V A;  4JI1 J;  4RU2 A;  2WAQ D;  1NU4 A;  4N5S A;  1L3K A;  2B7B B;  3TEH B;  2YKP A;  2HAF A;  1XNQ J;  5IFM A;  3C16 A;  3US5 A;  5KFT A;  4DV3 J;  2GIQ A;  4HT7 A;  3QAU A;  3FMT A;  4M94 A;  1IKY B;  1NSA A;  3H59 A;  3QGP A;  4GC7 A;  3CIM A;  3CPW R;  2M70 A;  3OTD A;  2XSJ A;  4NXM F;  1B0V A;  3OSN A;  3D66 A;  2FJB B;  3U1M A;  3JSM B;  1T7P A;  4RNF A;  4PUO A;  1BLU A;  5KT6 A;  1W2I A;  4JI8 F;  4YB5 A;  2GQQ A;  2LU2 A;  4ZJL A;  2QX0 A;  3IFE A;  5L9X A;  3TRG A;  3CCS S;  4WP8 A;  5G0R B;  3SDE B;  3BJY A;  2JC1 A;  1WG5 A;  4OZ5 A;  2HVH A;  4G1Q A;  1Y0H A;  3DLL Q;  4ED0 A;  1E6Y A;  2LMI A;  4JI8 J;  4Q0B A;  4DPW A;  5L8R C;  1SL0 A;  3GV5 B;  3RG6 A;  2ZDO A;  3NAI A;  2ZD1 B;  1KEK A;  3HHE A;  2Z2M A;  3FSY A;  1UA0 A;  3DHX A;  2N4D A;  3DFE A;  4O44 B;  2VG5 B;  4FXE A;  3HVA A;  3H2V E;  2RKI B;  1R43 A;  2YKM B;  3DGP B;  4HHH A;  4M5H A;  1S57 A;  3FMW A;  8AT1 B;  4F7V A;  5HO4 A;  3HHL C;  3IS9 B;  3CJ3 A;  2J7K A;  3J7A N;  5KFW A;  1LNQ A;  5J2P A;  3CJK B;  1ACM B;  4NLR A;  5C42 B;  3IO1 A;  2DGQ A;  2KL8 A;  2ALZ A;  2EKY A;  3CD0 A;  1N33 J;  5D0H A;  4B3M F;  4ZJO A;  2ZKT A;  1N54 B;  2HNY A;  3HM9 A;  2XYG B;  3AA8 A;  1WC6 A;  4LF9 J;  3MM6 B;  1S1W B;  2R7R A;  1WDT A;  2XCA A;  2BE2 A;  2K29 A;  3MD3 A;  2W1B A;  1VJW A;  4DU7 A;  3JTN A;  3SCK E;  4CRJ A;  1IKW B;  1H6K X;  4ECS A;  1RHU B;  3BQ1 A;  3D0G E;  4WPA A;  1WEL A;  1W2B R;  1C2P A;  1NND A;  1JX4 A;  2HGM A;  4Q2L A;  3GR0 A;  4NRU A;  1TP7 A;  1MNE A;  1ZPW X;  4ECT A;  4OHY A;  3T19 A;  1S0O A;  3R5B A;  4Q43 A;  4M5M A;  2F8H A;  4QIV A;  4OHW A;  3PM9 A;  1NK0 A;  2HVE A;  4DL2 A;  4Y28 C;  2FVP A;  3CC7 S;  3G71 S;  1KVJ A;  1T9T A;  1Z4U A;  3LPE A;  2ZH3 A;  2X1F A;  4DZD A;  2R2U A;  5GAE U;  4CLL A;  3MD1 A;  2C2K B;  3HKZ D;  3R1L A;  1ZTT A;  4CQ1 A;  4C6A A;  1F6T A;  2CJY B;  1T9X A;  4KAI A;  2QSF A;  1H2T Z;  4DL0 C;  2JNJ A;  4BHQ A;  1XK8 A;  1ZBT A;  2MKC A;  1L3U A;  2ASL A;  1T0T V;  1UW9 A;  2EC2 A;  2ZNZ A;  4TU9 A;  4J9U E;  4LBP A;  4OMF G;  2ZH8 A;  5E3P A;  3TZW A;  1XER A;  4F50 A;  5KFP A;  4TY8 B;  4FPR A;  1FER A;  2D9O A;  5KFR A;  4DPU A;  1YLX A;  4I6W A;  1JLG A;  1KOO A;  3PW0 A;  1XNR F;  2BW2 A;  1KQG B;  3BYP A;  3H2U B;  1K9M T;  1RTH A;  3KFW X;  1DTQ A;  1O6X A;  3Q8U A;  3MEK A;  3BDE A;  3HKW A;  3MPY A;  1TMM A;  2MKS A;  2EBG A;  5KG5 A;  1FWK A;  4OJH A;  2ZE2 A;  1QD1 A;  2YNI A;  5F8M A;  1FRI A;  1TAQ A;  1MSW D;  3R9L A;  1KNZ A;  1J5E F;  4IOC Q;  2B51 A;  2RQM A;  1P1L A;  1V3Z A;  1HNI B;  2DIT A;  4KB7 A;  3WC0 A;  2DCU B;  2DH7 A;  4R5P B;  2V0N A;  3KJV B;  4OYW A;  3ISN C;  1NB2 A;  3T1A A;  2RE1 A;  3T5L A;  4DEZ A;  5AXL A;  3J81 j;  3A8I A;  1LW2 B;  5EWF A;  1T9W A;  1NH7 A;  1IWA A;  4KSE B;  4ZHR B;  1VQ9 S;  5KFL A;  5C7P A;  1UEK A;  1PJ5 A;  2V2Q A;  1VK8 A;  1CS4 A;  1KVK A;  3EVW A;  1GMW A;  3NOC A;  3CO0 P;  3ZZR A;  3KK2 B;  4C0B A;  1RAB B;  2UUC F;  3KJN B;  4DSJ A;  5KFD A;  1RI7 A;  4ETZ A;  2E5H A;  1T05 A;  4DQI A;  4OX9 F;  1Q16 B;  5D0R A;  1P8G A;  4AAI A;  4U67 Q;  3PRB A;  2QFJ A;  3NGK A;  2OP5 A;  1S79 A;  1BQM B;  4LSN A;  1D8Y A;  4HLB A;  1DHM A;  1FD2 A;  3JAM Y;  3EPG A;  2UUC J;  1Q8B A;  4J5O A;  3MUR P;  3PAC A;  4NYZ A;  3GZ7 A;  2RML A;  1MG7 A;  3R27 A;  2RQK A;  3K5N A;  3B82 A;  3R1H A;  1QM9 A;  2Q1L A;  5CYQ A;  4TY9 A;  3QFW A;  4H4O A;  2W2P P;  1VQ8 S;  4UQT A;  1DQ8 A;  3TUI C;  5GMK a;  2AWZ A;  4LRF A;  4CLK A;  3H90 A;  5KFM A;  1Q53 A;  2W9B B;  3WIV A;  1NCL A;  3QPI A;  4RW7 B;  2OD6 A;  3PX0 A;  5HMZ A;  2D3U A;  4Q7A A;  2PMZ D;  2M7S A;  3GG0 A;  1L3V A;  3MPU B;  1UZD A;  3LH2 S;  3OL6 A;  1HBO B;  3Q8V A;  3CMQ A;  3WX4 A;  1U1N A;  2DY1 A;  4LVN P;  1RTD B;  1TUW A;  1QE1 B;  2DHH A;  1YJU A;  1F2G A;  4RBT A;  3NRB A;  2HQI A;  1FFW B;  4CLY A;  1HNW F;  2NQP A;  4H54 A;  1S1T B;  2Q2K A;  1BWE A;  4DFK A;  2JEJ A;  2LXF A;  1HWI A;  3GCX P;  2VQF J;  2MZT A;  4BWM A;  4JI5 F;  2E5G A;  3HPO A;  4L76 A;  1A7G E;  1SJR A;  3DDK A;  1RAD B;  5CAB A;  3NWR A;  1X5P A;  2NUH A;  4I6Y A;  3BPD A;  1HNW J;  4WK1 A;  4DLE A;  5L1I A;  3P8B B;  3BO2 A;  2QTW A;  3M8P B;  5F8H A;  3W2W B;  3QBC A;  3D54 A;  1FHT A;  3K58 A;  2HHQ A;  3W9H A;  1LWE A;  1HQU A;  4JP8 A;  2HVI A;  2A2B A;  1IR1 A;  5KFK A;  2LLZ A;  2EW9 A;  2RS2 A;  3JTP A;  2HK2 A;  3V6J A;  1U1K A;  3BKU A;  5E2Q A;  2LEA A;  5KT5 A;  3GE9 A;  1HBM B;  3JS9 A;  3IBW A;  4ED7 A;  3RU0 A;  5F0U A;  1S1U A;  3AJD A;  4ZP7 A;  2DGT A;  1P9Q C;  3LP2 A;  2IM1 A;  4B9M A;  3ZZU A;  1UA1 A;  2WON A;  3FDS A;  1XR6 A;  2AP6 A;  4PYD A;  2V4Q A;  3D1H A;  2WOM B;  1B0P A;  1SC3 B;  1J27 A;  5IT4 A;  1FWL A;  3HVW A;  1SBR A;  3AJ1 A;  1I5O B;  1AZS B;  1CLF A;  1DUR A;  2LEC A;  4IKA A;  3MMC B;  4KKO A;  4DU8 A;  4EFA C;  3OR2 A;  4O3R A;  1YVF A;  1VIO A;  4RNM A;  3TJ8 A;  5J1E A;  2OTL S;  2HPU A;  2JH3 A;  4PZV A;  1AT1 B;  1FRL A;  3H42 A;  4AD6 A;  2VHG A;  2BV3 A;  2C3U A;  2M5Y A;  7FDR A;  2LFV A;  2ATC B;  1IJE B;  2KFZ A;  1Q7L B;  4A8K A;  2KO1 A;  2BKN A;  5A6P A;  1WSR A;  1RAI B;  3DRS B;  4J9M A;  1OHN A;  1VRQ C;  2J5A A;  3BKF A;  5U47 A;  5T7L B;  2HFV A;  2B4O A;  3DRR A;  1WC0 A;  2FQQ B;  2KVI A;  3OLA A;  5HVF A;  4RW6 B;  4F2S A;  3KUG A;  3C14 B;  3EZ5 A;  3PYE A;  4KYZ A;  4F25 A;  2IRY A;  2AHO B;  5HRO A;  4QYR A;  2D3Z A;  3OTB A;  1Q78 A;  3K2Y A;  4CLT A;  4ZVS B;  3KUH A;  4J9K A;  2DO0 A;  3NCR A;  5HAO A;  3TZY A;  4FS1 A;  4NI2 A;  2MQO A;  3GYN A;  3BO4 A;  1DTT B;  2B4V A;  1FVS A;  1NLA A;  4FZV A;  1EKR A;  4LFA J;  2JZ5 A;  4KQZ A;  4CYU A;  4CTA B;  2CDQ A;  4HKQ A;  1FKO B;  4DUY J;  2COL A;  4RNN A;  2CAJ A;  1NB7 A;  4DR6 F;  2K3K A;  4OI1 A;  2HQD A;  5I3U A;  5CZV A;  4ME7 E;  3P3D A;  4JV0 A;  4F02 A;  3PHE A;  3AH6 A;  4YFU A;  4NMX A;  4NYO A;  4RW9 A;  4TQS A;  4E8U A;  3QZ8 A;  1OJ4 A;  3DOM B;  3ZXW A;  2K5J A;  2A2C A;  4ZS6 A;  5EHH A;  1N0V C;  2MY8 A;  4M8L A;  3O3L A;  5D15 A;  2NZC A;  2I0X A;  1ZZF A;  4KR0 B;  2BA3 A;  4YHH J;  5GAD U;  1C0U B;  2ZFH A;  1FDA A;  5HLF B;  3MR6 A;  3TJA A;  3ISZ A;  4LSL B;  4X4N A;  1VYA A;  3BSN A;  2UP1 A;  4LRA A;  1H72 C;  1ZAX A;  2BE7 D;  4MK8 A;  3DDN A;  4WJB A;  4CLZ A;  3HT0 A;  3NMA A;  4UOF A;  4NXN F;  3MI7 X;  3MOJ B;  4QIW D;  2VB6 A;  3CJT A;  1LQ9 A;  1U7L A;  3SBM A;  3FVY A;  4KC5 A;  3U1N A;  2YWF A;  4ZA1 A;  3RRK A;  2F63 A;  3LP1 B;  2DNZ A;  3M2R B;  2RS8 A;  3N01 A;  5KT4 A;  3K8W A;  1ZA1 B;  1GK8 A;  4NXN J;  1RT6 A;  2Y8W A;  2DH8 A;  3JQM A;  3NNA A;  3B6B A;  4QR0 A;  1CG2 A;  2IVM A;  3VGU A;  2DH9 A;  1TR0 A;  4OJ1 A;  4Y00 A;  4IG3 A;  3IMQ J;  1N5Y A;  4F3Q A;  1RA6 A;  1NKC A;  5CXT A;  3I96 A;  4BBY A;  4IG0 A;  4M5D B;  3I6P A;  1QAY A;  3U7J A;  1NJY A;  4U96 A;  3QAE A;  3ZZT A;  3FJ2 A;  4U8V A;  2PI5 A;  5A8W A;  1T02 A;  1TFY A;  3FBC A;  5T41 A;  4DSK A;  1V5V A;  4FKX A;  4PWW A;  4CT9 A;  4ID8 A;  4CI0 B;  5E3R A;  3QYY A;  2EKN A;  5ETN A;  1JJC B;  2HBY B;  4LVO P;  2F40 A;  4B3O B;  3HDS A;  3MM5 B;  4YB1 P;  1EHW A;  2IVY A;  5GAG U;  1KQF B;  2R7V A;  1SIW A;  4PPD A;  3M8Q A;  3EUN A;  3MAA A;  3VHQ A;  4JV2 A;  3EGZ A;  4PQU B;  4E0D A;  1BWV A;  3QSY B;  2GV1 A;  3QOQ A;  4YQW A;  3C2P A;  5JVG Q;  2CAD A;  2YX4 A;  3EVM A;  4F4K A;  1VHF A;  1VQ6 S;  3NNH A;  5KFE A;  1EQ0 A;  4GRS A;  1F1B B;  2IJR A;  1RKI A;  1EIY B;  1SV5 B;  1JLF A;  2DEI A;  5CH7 B;  4TU8 A;  1IWG A;  3L3C A;  1NHV A;  3BRE A;  4LQ9 A;  3W5X A;  3Q2S C;  4DQP A;  3VAK A;  4G1I A;  4BC7 A;  1M0S A;  3TAN A;  3N5B A;  2XNR A;  4RWW A;  2J0S D;  4ZLJ A;  1HPZ B;  2RVJ A;  3PTW A;  1UWB A;  2I5J A;  4ZPV R;  1S6O A;  4CM0 A;  2YQ1 A;  3THP A;  1KQK A;  2J9D E;  3QQC D;  3X1L B;  1S0N A;  2GGP A;  4B9S A;  2E7X A;  1TV6 B;  3MEC A;  2FGC A;  1GMW D;  2W9C B;  3C15 B;  4FDF A;  2JHE A;  3K5L A;  3CMA S;  1X5O A;  3OL9 A;  1KLN A;  2VJU A;  3P4U B;  2DNY A;  3UNG C;  1HAR A;  3MM8 B;  1C0T B;  3EDR B;  2CPE A;  1FRJ A;  3LTO A;  3CCV S;  4WFZ A;  3EX7 B;  3DLE A;  1K0T A;  2XC9 A;  4Y65 A;  1SVD A;  3MEG A;  4EBD A;  3EZO A;  4WZQ A;  1UL3 A;  3ETO A;  5KG2 A;  1WKJ A;  2OPP B;  4C8Y A;  2XI2 A;  3FZ2 A;  5KAK A;  2KZZ A;  1M1H A;  3D28 A;  4YUD A;  2WZ1 A;  4JI4 J;  1AUD A;  4WYL A;  4NCG A;  3KMQ A;  3VAM A;  3G82 B;  3OL7 A;  1HA1 A;  4TXS A;  1UWA A;  4B9V A;  4U7U K;  3FBE A;  5HAT A;  4DZ6 A;  1M5S A;  4NYP A;  5IS2 A;  1YBA A;  2A18 A;  2AGP A;  3UNY A;  3ULH A;  1Q81 T;  4PKD B;  4OYM A;  3V81 B;  2DXE A;  1Q8I A;  1B7Y B;  5E3A A;  4DLG A;  1NJW A;  4WKR A;  3W5Z A;  5IT9 U;  3H8Y A;  1RSC A;  1S10 A;  4QWE A;  2VG6 A;  3PG9 A;  4NLS A;  3O8W A;  2FHJ A;  3I0S B;  1LW0 A;  5KFX A;  4EMD A;  4UY8 T;  4KHP J;  4DG1 A;  3HF5 A;  5IWA F;  3VZI A;  4RUH A;  2KFY A;  4O23 A;  1X4A A;  1N0U A;  5HMY A;  2P2C B;  2D41 A;  2GC8 A;  4IDK B;  4OZ1 A;  3N4W A;  1Z1Z A;  1B28 A;  4QWD A;  4B3T F;  1VIS A;  3EYZ A;  2WB1 D;  5B0B A;  4X62 F;  2AZ3 A;  1S49 A;  5MAO A;  4ICL B;  2BKP A;  3QO9 B;  5FJ4 A;  1AA1 B;  3M32 B;  1SL1 A;  2MTL A;  1B99 A;  1C1B B;  3BSC A;  2RUS A;  4EYH B;  4JI7 F;  3KTQ A;  5KFH A;  2DHS A;  1OPZ A;  4I2Q A;  5C25 B;  4B3T J;  4YEA A;  4DXL A;  4X62 J;  4WP3 A;  2V50 A;  2ZOG A;  1CUL A;  4YR2 A;  2L41 A;  4C2M A;  2HHW A;  3PFO A;  1X8D A;  1NLK L;  3G4S S;  5KG3 A;  1J2V A;  1LV5 A;  4F4X A;  4JI7 J;  5JMN A;  4PAA A;  2XY5 A;  3V4I B;  2GCF A;  1T9U A;  4DV7 F;  1HBU A;  4NPO A;  3AA9 A;  2HS4 A;  4O3S A;  3GJS B;  1OYD A;  2JVO A;  3PYG A;  4IH7 A;  3J7Y I;  2JWN A;  3ADA C;  4RWX A;  1HI8 A;  4KHR A;  2AY0 A;  1UTA A;  3IC1 A;  3U02 A;  4U6P A;  3HI9 A;  4LFB J;  1S77 D;  2OEL A;  2F1F A;  1KDN A;  3M30 B;  5B08 A;  2E7W A;  1R7I A;  4DI6 A;  1DAR A;  2EFP A;  3PRD A;  4R0E A;  3KK3 A;  1QLN A;  1ELO A;  4F4W A;  4MK7 A;  4EU0 A;  2VQE J;  3M2V B;  3J81 U;  3DOK B;  1RAG B;  2PDA A;  4DCP B;  1U45 A;  2LVW A;  1F60 B;  2AYM A;  1IM4 A;  1OG7 A;  1NXI A;  2Y1R I;  2J6T A;  2WW4 A;  3MMA A;  2VDI A;  3GIK A;  4YS2 A;  3DLH A;  1VS3 A;  3E8O A;  2R7T A;  1R27 B;  3CCT A;  3DI6 A;  2X3D A;  1TKX B;  5JUM A;  1MYK A;  3CC2 S;  1CJK B;  2XCP A;  2HBZ B;  2AJ1 A;  2B9W A;  1MWY A;  3PJ9 A;  2VOD A;  2QE5 A;  2WSC C;  1JLC A;  4M5K A;  2OSQ A;  1CC8 A;  2AX1 A;  2O1P A;  2XNQ A;  1AYE A;  2QA2 A;  3VF0 B;  2Z56 B;  2GJF A;  1IXK A;  4RW8 A;  2DGU A;  2YKN B;  3IAM 9;  3R7S B;  2MKH A;  1RWU A;  4GO5 X;  2MGZ B;  4A8Y A;  4KH1 B;  2RT3 A;  3M8Y A;  2AN7 A;  2YNG A;  5H9F J;  4RX6 A;  1RTJ A;  4F0M A;  1KKH A;  3LAL A;  4F0H A;  2K9I A;  4JI0 J;  1UEU A;  3KMS A;  4G6V B;  1U0S A;  3DRP B;  1X4C A;  2PEH A;  3VEA A;  1IBM F;  4ES2 A;  1HQE A;  2B6A A;  1N36 J;  2GJI A;  3GPA A;  3HX9 A;  3KLH B;  1RT7 A;  3P96 A;  1F9F A;  4O0N A;  2ABY A;  3SMZ A;  1B70 B;  1R6Y A;  1K44 A;  1U1Q A;  4P6Q A;  3ENA A;  4RKU C;  5CYJ A;  2VH7 A;  1IKV A;  1Y3K A;  2Y0B B;  3T1Y J;  1G2E A;  2IYG A;  4BCA A;  2E9T A;  3UPF A;  4RW4 A;  4URG A;  5DDO C;  3Q22 A;  5LXY A;  3CD5 A;  1NHK L;  3N6L A;  1YI2 S;  4W92 B;  2I2Y A;  5E3Q A;  2IM0 A;  3A8K A;  2OPR B;  2QC3 A;  4G1P A;  3GII A;  4PWD B;  3M7V A;  3POT A;  2GX8 A;  3P5B P;  2UV8 G;  9ATC B;  2HZC A;  2W4C A;  1KS2 A;  1Q0N A;  1A9N B;  1XJW B;  2OEJ A;  2MZR A;  3N6M A;  4I2P A;  1N34 F;  3RRG A;  5B0F A;  5K14 A;  2HHV A;  1MMN A;  2DGX A;  3DRX A;  1U0H A;  2JLE A;  2FYX A;  4JI3 F;  4HTI A;  5F8J A;  5ADZ A;  2RRN A;  4DFM A;  1H2U X;  3FBB A;  2OTJ S;  2GPE A;  2V8V A;  3KLE B;  3BO3 A;  1NO8 A;  4CO3 A;  4QCL A;  2K1O A;  3KWM A;  4P72 A;  3RBZ A;  4OX8 A;  1SIZ A;  2BZ2 A;  4L6V 3;  3LOU A;  3KLF A;  3NO7 A;  3IRW P;  3CCL S;  4QPX A;  3IR5 B;  2MQ8 A;  5M2R A;  3W5Y A;  3DM2 B;  2RQ4 A;  5K8P A;  1N5S A;  3MMB B;  1Y7P A;  3MXH P;  3RYL A;  2VBX A;  4DV5 F;  4MK9 A;  4ZMM A;  3CJR A;  3TVZ A;  1R8H A;  3PEJ A;  1RZM A;  3MOZ A;  3TUZ C;  3HO1 A;  2Z0G A;  2MQN A;  4I4B A;  2VFR A;  3ZZZ A;  3JSR A;  5CAA A;  2UU9 F;  3D9B A;  3T9Z A;  4C8L A;  3BGU A;  2HBQ B;  3G96 A;  3EM1 A;  2W01 A;  3DLG B;  2F7V A;  3G6Y A;  4P2S A;  3CME S;  2RRA A;  1HFE L;  3HHK A;  2RSQ A;  4USI A;  4ZP8 A;  2UU9 J;  1Z2Z A;  3MR5 A;  4YME A;  3QAT A;  1Y00 A;  1LWF B;  2MHE A;  4IH5 A;  5D77 A;  2ZHA A;  4ERD A;  2W8K A;  3FFI B;  3DXS X;  4OI0 A;  2V2K A;  3IR7 B;  3JB9 k;  1CQM A;  2HKE A;  2CQ4 A;  5D4P A;  4ZVH A;  4WYW A;  2LDI A;  1XEZ A;  1LWC A;  2DB1 A;  2M0G B;  4NE9 C;  5SUH A;  3O1L A;  2OH2 A;  3TNV A;  2A0F B;  5EX0 A;  3U1L A;  4CLF A;  3A8J A;  1J5O B;  4DFP A;  4DR5 F;  3HVT A;  3ILL A;  1JLB B;  1SQE A;  4LRC A;  2UUT A;  1S0M A;  1O5J A;  5FDL B;  1FI4 A;  2ZH2 A;  1UFK A;  1RUS A;  1TL4 A;  2AJ2 A;  1N48 A;  2JDJ A;  2NXE A;  2BQ3 A;  2X1A A;  3JSM A;  1NME B;  3VAG A;  3IG1 A;  4KIA A;  1R0A B;  3ETM A;  2W25 A;  1SL2 A;  4U7C A;  2D3O R;  1SQF A;  4ZDN A;  4ZCM A;  3SDE A;  1VFJ A;  4ZPT R;  2BSQ E;  4B3S F;  1KN6 A;  1WTF A;  2I1R A;  2QA4 S;  4H4K C;  3SIP B;  3QT7 A;  4ED1 A;  5ETL A;  4I7F B;  1RLC L;  3KYL A;  2H48 B;  1KHV A;  1KD1 T;  1HHQ A;  4ELU A;  2F4V F;  3HZG A;  2ZD1 A;  1VR6 A;  4OHV A;  3J7Z T;  4TKT A;  4X4R A;  2GHV C;  2IBK A;  2FVR A;  4DV1 F;  5F9L A;  2CPI A;  4O44 A;  4B3S J;  2O66 A;  2ZH6 A;  3BGL A;  4ZVT B;  3UI3 A;  2L9N A;  2RKI A;  2YKM A;  2OFG X;  3DGP A;  3CJ4 A;  5D3G B;  4LF2 A;  1WAC A;  3IGN A;  3QZ7 A;  2KM8 B;  2ZH4 A;  5L1J A;  4LF6 J;  1UVJ A;  3CJK A;  1RWP B;  2OHD A;  3M8Z A;  3UE2 A;  5C42 A;  4DV1 J;  4LMZ A;  3DLK B;  2HGN A;  2ZOF A;  3GTY X;  1X4F A;  3TAM B;  2WSE C;  5L1K A;  4NAS A;  2HLT A;  2OPQ A;  3OTC A;  5D4N A;  2QFI A;  1F5C A;  1NK4 A;  1U1P A;  1WC3 A;  2IMO A;  3MM6 A;  1S1W A;  2NSB A;  4KGZ B;  4KRW A;  2UUA J;  1CJU A;  1N52 B;  3GR1 A;  2WRM A;  4I1T A;  2GMJ A;  3C3L A;  4OZJ A;  3VGS A;  4CP5 A;  2ZDP A;  1JXV A;  1K1S A;  1IKW A;  2FHJ D;  5GAH I;  1S59 A;  2VA2 A;  1OWX A;  1XN9 A;  3MMJ A;  1OPI A;  1HYS B;  5KT3 A;  2IJF A;  4L75 A;  2CG8 A;  5HVH A;  3ENV A;  3VGT A;  5DZ7 A;  5DQH A;  1REG X;  2BJ9 A;  1FA0 A;  4ZIT A;  2IJN A;  1HWL A;  1O8B A;  1YHQ S;  3MZI A;  2DGV A;  4ILL A;  3QRR A;  4RNO A;  4FP9 A;  2H54 B;  3RAM A;  1TL3 B;  4WF9 Q;  3HSZ A;  4Q8E A;  1GX6 A;  3R5C A;  3ICL A;  3GWC A;  4CDI A;  2YWW A;  3ITH B;  5AE2 A;  3CJ8 A;  4WE1 B;  3DHW C;  2OUG A;  1VCT A;  1SUQ B;  2P6S A;  4EZ9 A;  4LF5 F;  2FJX A;  5EDW A;  1W25 A;  1PAE X;  3DKD A;  3EIC A;  4JUZ A;  4AE5 A;  1G6B A;  1FFS B;  3UCZ P;  3EGV A;  2P8I A;  4DL3 A;  2Y3Y A;  3VQT A;  4KPY A;  4YR0 A;  2B0G A;  2RB7 A;  1NBE B;  3B54 A;  2BAN B;  1F3F A;  3M2U A;  2FPH X;  3NXZ A;  5BYS A;  3QGG A;  1SPB P;  4TY8 A;  3KHR A;  4J9O A;  4H4M B;  1YZ6 A;  3R97 A;  2G0C A;  4ZP9 A;  4F36 A;  1JIH A;  4RR5 A;  2F8M A;  3D6T B;  2FJA B;  2CJB A;  5A8R B;  3VGV A;  1RAE B;  3T5K A;  4OYX A;  4M5J A;  3F44 A;  3W62 A;  1Q8K A;  4X65 F;  2ZH1 A;  1VBY A;  4O4G B;  4BDP A;  2OPS B;  3Q83 A;  2KDO A;  5DG7 A;  3ISN D;  1HNI A;  2H5I B;  4KE5 A;  3AOD A;  3H0P A;  2GZO A;  1JNR B;  3KJV A;  1AFI A;  1YRT A;  3C6U B;  4MIA A;  2R2S A;  4EO8 A;  2FJW A;  2VPY B;  1ZTW A;  2RJZ A;  3PDN A;  1LW2 A;  2CJK A;  1SJ1 A;  4ZHR A;  1DQ9 A;  4DV2 J;  1S6Q B;  4LBI A;  1PJ7 A;  3M1V B;  4DV4 F;  2VF3 A;  1BDV A;  3W2V B;  4Y2M A;  1BY9 A;  2DHA A;  2XY6 A;  3KK2 A;  1JLA B;  3CJ0 A;  3ILO A;  2YKQ A;  2O5D A;  1FEH A;  2XMU A;  4Y2A A;  1EQM A;  2R42 A;  1B4S A;  1JXE A;  4WXW A;  2Z2L A;  7AT1 B;  1Q16 A;  3ZTR A;  4AT1 B;  4KGX B;  2XBP A;  2GW8 A;  4DV4 J;  2E5J A;  3BH7 B;  3UVJ B;  3ZZO A;  1SJF A;  1SKS A;  3CDB A;  4FVM A;  5GME A;  1ZS6 A;  5ITH A;  2X1B A;  2NPI A;  2CQB A;  2CQG A;  1RU2 A;  3UDE A;  5BXI A;  4WBF A;  1RWK B;  1X93 A;  2HHP A;  3KJQ B;  1UFW A;  2XS2 A;  2WVF A;  1VRT A;  2IDE A;  3G8T A;  5BJR A;  1WKL A;  3WIU A;  2B4P A;  2ZC4 A;  3A4T A;  4C8O A;  2JFK A;  4C0H A;  2QJ3 A;  3QID A;  1LFP A;  1HR0 F;  2W9B A;  3QJJ A;  2HLU A;  4G1Q B;  3AHP A;  5DLF A;  3GQC A;  1FRX A;  1YJ9 S;  4RW7 A;  2B43 A;  3RGI A;  2B9X A;  4RPF A;  4RUA A;  5LJ5 Y;  1WHX A;  4K2J A;  3JQK A;  2KVQ E;  3HP6 A;  3TA1 A;  4XPC A;  4DR3 F;  4LR9 A;  3HVR A;  3ZNJ 1;  4DBQ A;  3PFE A;  3GFZ A;  1H7X A;  2GO8 A;  3TX0 A;  4NOH A;  1HBO A;  2PII A;  1RTD A;  1QE1 A;  3BM7 A;  3SXL A;  1U26 A;  3MEE B;  1OMS A;  2ILZ A;  1LXJ A;  5F8I A;  1PSD A;  1YDL A;  4M63 A;  5J2P B;  1AFJ A;  1XMB A;  3BYR A;  1T11 A;  3KLV A;  3CC4 S;  3B78 A;  3FCW A;  4HEA 9;  2CNL B;  3MCS A;  1QUP A;  1NJX A;  2VG7 B;  2R7X A;  2HNY B;  2IA6 A;  1UPM B;  4ZVU B;  1UCN A;  2MZ1 A;  2H1O E;  5KTQ A;  2OIH A;  4MYU A;  3GON A;  2R8J A;  2AEJ A;  3M8P A;  5I4M A;  2KI2 A;  1L3T A;  3R2D J;  3W2W A;  3MUM P;  4PWU A;  1N32 J;  2OD4 A;  4DR2 J;  1Q7Y T;  3KNG A;  1GAO A;  1U2C A;  1VLO A;  2FVC A;  3G87 A;  2VBY A;  2YBV A;  4K4W A;  3PKY A;  5DG9 A;  3BZQ A;  3TQ1 A;  5B0E A;  1PG5 B;  2F65 A;  1RE1 B;  1MN7 A;  2K1R B;  3HLU A;  4P2X A;  3I56 S;  4FYV B;  3WQP A;  1RAO A;  2V5H G;  3HT3 A;  4JYA F;  2YKA A;  1R0C B;  3ENQ A;  1SJ3 P;  2RRB A;  3TAR A;  2WOM A;  3FCH A;  3FRZ A;  2OAU A;  3OVS A;  2R8I A;  2HIQ A;  1FJC A;  1MLA A;  3KHG A;  1AZS A;  3I9V 9;  3MMC A;  4CT8 A;  4JYA J;  3Q86 A;  3Q8S B;  1KC8 T;  4CO4 A;  1FE0 A;  1CBK A;  4QR1 A;  4QZV B;  2QZ8 A;  1S1V B;  2PA8 D;  5B0C A;  2AIR B;  4ZVG A;  3SSQ A;  3IN5 A;  2CFX A;  1FT8 A;  1CVJ A;  5DDR C;  4X4S A;  3DRS A;  2ZOM A;  1RT3 A;  2XS5 A;  3CT9 A;  5IOL A;  3MTJ A;  4HHJ A;  5T7L A;  2FY8 A;  2A10 A;  3MPD A;  3CUL A;  4DR7 F;  3PY8 A;  4F0K A;  3ILI A;  3LO3 A;  4PG5 A;  1JLG B;  2W8L A;  3PR5 B;  4RW6 A;  5AE1 A;  1X5S A;  1DTQ B;  1IQT A;  4CLS A;  2D1C A;  3KG0 A;  2V63 A;  1N5Q A;  1GTH A;  4WP9 A;  1CSJ A;  3R3T A;  1U09 A;  4FVC A;  4DR7 J;  2M4M A;  3NKY A;  6FD1 A;  1NZ8 A;  2ZJR Q;  3QLH B;  1GFW B;  1YRU A;  2WTF A;  4ELV A;  1U2F A;  1X7V A;  3FCV A;  2PI4 A;  3NGU A;  1HQ2 A;  2AYB A;  1T3N A;  2J9D A;  2P5V A;  3VZH A;  2BJ7 A;  2Q6C A;  1FVQ A;  4CTA A;  2K8G A;  3DRY A;  1FKO A;  1TKZ A;  3PKM A;  1SJQ A;  3V6D B;  2R3V A;  2HRU A;  4DFJ A;  3QT6 A;  2ZM6 F;  4O3O A;  4N8N A;  4O4R A;  1Q86 T;  3PZP A;  4EO6 A;  2C3O A;  2HHH J;  3RW6 A;  1S6P B;  1EP4 B;  3DOM A;  2CQ3 A;  1SKR A;  5AXM A;  5A76 A;  2YWK A;  1P1T A;  1C0U A;  3TUJ C;  2C2M B;  3I32 A;  5HLF A;  2ZM6 J;  2XS7 A;  2BOA A;  4LSL A;  3Q23 A;  2YY3 A;  4RLE A;  2W7A A;  2QL5 B;  3BDP A;  5D8H B;  3A13 A;  1M5V C;  4LFC F;  5A8K A;  1FJ7 A;  3T5J A;  1V5I B;  3LAK A;  4N47 A;  3PW7 A;  4J7C A;  3MPV A;  2HVZ A;  3MM7 A;  4WFX A;  4B9T A;  1I3O B;  2ZC3 A;  2YPZ A;  3NNE A;  4DUT A;  3LP1 A;  3G5O A;  1D9D A;  4IO9 Q;  1DBD A;  4X2B A;  3M2R A;  3QFH A;  1JLQ A;  4DUZ F;  5BR8 J;  5D78 A;  5ETO A;  4LFC J;  1QVG R;  4ZPA A;  4C0O C;  3LJP A;  5FLX Y;  4H4O B;  5LSL A;  3MF5 A;  4OHZ A;  2QL7 B;  4XIU A;  2HQF A;  3R8Y A;  3TOQ A;  3QJP A;  2M2B A;  4F4A A;  2V4J A;  4LF7 F;  2M8H A;  2V34 A;  5F8N A;  1LKZ A;  3RW7 A;  1TK5 A;  4DUZ J;  3FMB A;  1RB0 A;  1QY7 A;  4NLV A;  4M5D A;  2H1Y A;  1WC4 A;  2FVQ A;  5J2M B;  2O67 A;  4KBI A;  4DCJ B;  2AEF A;  4P75 A;  4HI1 A;  1NEE A;  3CXC R;  4FNI A;  2JEI A;  5IXU A;  5CD4 A;  1U8S A;  3SSS A;  3HSJ A;  4MJK A;  3OFH A;  2OFH X;  2CJX B;  1H3D A;  3BH6 B;  2BM0 A;  3FQL A;  2F3J A;  1V6H A;  2IRX A;  4CNZ A;  4NL5 A;  4USW A;  3S7R A;  1YX2 A;  2FZK B;  3MM5 A;  1WOP A;  2HWT A;  2YKO A;  3QMQ A;  4B9U A;  5KT2 A;  2XMM A;  3F0N A;  4PQU A;  2E7V A;  4DS4 A;  2CQ2 A;  4LJM A;  3ILJ A;  4IRD A;  2IRU A;  4OI6 A;  1X9M A;  4S0M A;  1VQM S;  3BKT A;  1VBK A;  5ETP A;  1SV5 A;  4I6A A;  4UF4 A;  5KFQ A;  2DNP A;  1G1X A;  5KFZ A;  2DNO A;  1F0X A;  1FWP A;  1T03 A;  3SV3 A;  3BS9 A;  1RT4 B;  2E1R A;  3ENW A;  3I31 A;  4H4K A;  1R3N A;  2AYG A;  1HBN B;  1FNO A;  3UD4 P;  3NBP B;  1R8C A;  3LP2 B;  4Q8F A;  2JX2 A;  1TVR A;  3QWU A;  2WON B;  1TV6 A;  2QSW A;  2GFF A;  1N5V A;  2W9C A;  4O3Q A;  3C15 A;  3TAQ A;  4Y0F A;  4KV8 B;  2W7O A;  2PE8 A;  3BN7 A;  5J2N A;  3EJM A;  5GVQ A;  3CCU S;  4B08 A;  1PBA A;  1GXL A;  2ZVI A;  4GVB B;  3MM8 A;  1C0T A;  2BXJ A;  2RF2 B;  3UN2 A;  4K5S A;  3V4M A;  3H5S A;  4M5N A;  5E7O B;  4UW2 A;  3OR1 B;  1TL1 B;  4A46 A;  4CO1 A;  1Y5I B;  4X4O A;  2AV5 A;  4K5R A;  2OEM A;  1DY3 A;  3MED A;  3BGR B;  5C2C A;  5J1E B;  1RLD A;  2IA0 A;  1XMO F;  2HG4 A;  1X0P A;  2U1A A;  3QGI A;  2Q79 A;  5JVH Q;  1FXD A;  2DYA A;  3CE8 A;  2CNO B;  1LFW A;  3O2I A;  4GO7 X;  3C6T B;  4OHX A;  3IA0 A;  1N6Q A;  3K17 A;  1N33 F;  3G82 A;  5JXS A;  1PCA A;  1TZ0 A;  4JV5 F;  4PG7 A;  3MFI A;  4BC9 A;  4A8X A;  4LRV A;  2DVI A;  2IYI A;  1S48 A;  2P9E A;  1XMO J;  2PT0 A;  1DJ0 A;  4QIE A;  4LF9 F;  1YQH A;  4NLY A;  2XLK A;  1RK8 A;  2XZD B;  4D3G A;  5D4O A;  3V81 A;  5C5J A;  4CLP A;  2DPI A;  2Q66 A;  4LRE A;  2BNW A;  4JV5 J;  1PAU B;  4KO0 B;  4ZPD A;  2UXB F;  3W63 A;  3BPS P;  2PC6 A;  3I0S A;  3LQV A;  4XDD A;  5IV3 A;  3UWT A;  5M2P A;  3I55 S;  2C3M A;  3FEX B;  4ZVO B;  4NI2 B;  3EWG A;  3NS6 A;  4RZR A;  4X4P A;  4OL8 A;  1CEZ A;  2J7W A;  4IDK A;  2FB0 A;  3KK1 B;  3EGW B;  5D6G A;  2UXB J;  1JJ2 R;  1SKU B;  1KRP A;  4ICL A;  1ITP A;  4QU7 A;  2DEJ A;  1VC6 A;  3M32 A;  2YWG A;  4ANE A;  2ZUA A;  4M5G A;  1X60 A;  3AXK A;  2ADB A;  1C1B A;  3W9J A;  4X66 J;  2DBB A;  4A8Q A;  2HUR A;  2G2Z A;  3AFG A;  3OXF A;  1TFW A;  1K1Q A;  2QYC A;  3D67 A;  3F41 A;  2J76 E;  3V2U C;  5CHC B;  5C25 A;  5B0D A;  1HNX J;  4RW9 B;  2B3T B;  2VBW A;  2J0X A;  1S9F A;  3UDC A;  2RU3 A;  4QIG A;  1NPR A;  1OY8 A;  4Z7Y A;  1PO6 A;  2L9D A;  2BOP A;  4ER8 A;  2C2R A;  4K4U A;  1LXN A;  4CH0 S;  2YH0 A;  4B9L A;  2RDI A;  4YB7 A;  1L5U A;  2CVI A;  4F4Z A;  4QOT A;  3N0V A;  4UOC A;  5A2Q U;  2VFU A;  4IUF A;  3GV7 B;  3M30 A;  1O51 A;  2C42 A;  2H65 B;  2N4C A;  4QJV A;  2VFS A;  3C19 A;  2R8K A;  1DFD A;  5HVG A;  4MIW A;  2CQH A;  1VLY A;  3GIJ A;  2E1A A;  3T3F A;  2BQR A;  2CWK A;  3MFH A;  2J0W A;  1RT6 B;  1C4C A;  3W9I A;  3IM9 A;  1URN A;  4OYP A;  3J80 Y;  2G0I A;  3DDI A;  2HS0 A;  4DL6 A;  2LQJ A;  4ZVE A;  1N5Y B;  1TKX A;  4MFB B;  4KPC A;  3NAH A;  5T14 A;  3FUY A;  1CJK A;  5J1P A;  3LPY A;  3UDV A;  3OUY B;  1OQ3 A;  3ZZP A;  2BRK A;  4HTJ A;  2DRD A;  2LA6 A;  1RTI B;  1TMJ A;  4L74 A;  2YKN A;  2RDJ A;  2CPZ A;  2GVD A;  4KFB A;  4V1A k;  2P9C A;  3QWP A;  5KOW A;  3TAP A;  3OFF A;  4RJV A;  4QYZ J;  2L9W A;  2N82 B;  4KGM A;  1QUV A;  4ZVP B;  1VQS A;  3MGJ A;  1FEE A;  3DRP A;  4C3K A;  2XI3 A;  2ROE A;  1T94 A;  3CJQ A;  4I67 A;  2VFT A;  3TR5 A;  1WUU A;  4OV6 A;  1W7W A;  2DIU A;  3KLH A;  1VC0 A;  4ALZ A;  2HNZ B;  2ASJ A;  1ZAV A;  1HNV B;  3SI8 A;  4A47 A;  4YP3 A;  1JNZ B;  5LOQ A;  2GHW A;  3HZE A;  2IM3 A;  3BQ0 A;  2LQ5 A;  4C8K A;  4DPY A;  3L09 A;  3NEK A;  2Y1J A;  3TVY A;  5LSR A;  2HZV A;  3WC2 A;  1HLW A;  2A2D A;  4PG6 A;  5B0G A;  2PMW A;  4NLU A;  4HV0 A;  5K9F A;  2YPY A;  4O3P A;  1SC6 A;  1IR0 A;  1IRQ A;  3NNC A;  5H9E J;  4ELT A;  2CRL A;  4L3K A;  2R7U A;  2FD2 A;  2QLF B;  3S1T A;  3TA2 A;  3GLJ A;  4LR7 A;  4MH8 A;  1AXQ A;  4QIF A;  2H4W B;  2I38 A;  2EVZ A;  1XR5 A;  3PR4 A;  1GXT A; 
#chains in the Genus database with same CATH homology
 2BJ3 A;  1EA4 A;  1BDV A;  3GXQ A;  2WVE A;  2CPG A;  2WVB A;  1MNT A;  3BKT A;  2BNZ A;  3VEB A;  3QSI A;  2JXI A;  2BJ9 A;  1P94 A;  2KEL A;  2FGC A;  3FT7 A;  1NLA A;  3H87 C;  3LGH A;  1BDT A;  2K29 A;  1ARR A;  2CAX A;  1B01 A;  2K6L A;  1PAR A;  2CA9 A;  2BJ8 A;  3VW4 A;  2AY0 A;  2JXG A;  2K9I A;  2BJ1 A;  2CAJ A;  1U9P A;  2F1F A;  3QOQ A;  1B28 A;  2HZV A;  2CAD A;  1Q5Y A;  3FMT A;  4ME7 E;  3OD2 A;  1X93 A;  4FXE A;  4HV0 A;  3VEA A;  2GPE A;  3PHT A;  3BKF A;  2HZA A;  1ARQ A;  2WVD A;  1IRQ A;  3BKU A;  2WVF A;  2JXH A;  2BNW A;  2BSQ E;  1QTG A;  2RBF A;  4D8J A;  2K5J A;  2PC6 A;  2K1O A;  2BJ7 A;  2NZC A;  2Y3Y A;  2WVC A;  2H1O E;  2BA3 A;  1BAZ A;  1MYL A;  1Q5V A;  1MYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...