2WVCA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
132
Chain Sequence
b'DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDEDNPNDESKIAVLVVIYDGGQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 32
structure length 132
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvcA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvcA02
1U9PA 2JXGA 2KELA 2NZCA 2BJ9A 2CAXA 2WVFA 2CA9A 2RBFA 2Y3YA 3PHTA 1QTGA 1MYLA 1X93A 4FXEA 2CADA 1ARQA 3OD2A 1PARA 2PC6A 2WVEA 1MNTA 3QSIA 3H87C 3GXQA 2BJ3A 2K9IA 2BJ8A 3QOQA 1B01A 3LGHA 1BDTA 1BAZA 1Q5YA 2CPGA 1Q5VA 2H1OE 2BA3A 3FT7A 1NLAA 4HV0A 1IRQA 3FMTA 2K5JA 2K6LA 3VEAA 1BDVA 2WVDA 1B28A 2HZAA 2K1OA 2HZVA 2F1FA 1EA4A 2BNWA 2WVBA 3VW4A 2BNZA 2BJ7A 4D8JA 2CAJA 3VEBA 1ARRA 2K29A 1MYKA 2BSQE 2JXIA 3BKUA 1P94A 2BJ1A 2AY0A 4ME7E 3BKTA 2JXHA 3BKFA 2GPEA 2WVCA 2FGCA
chains in the Genus database with same CATH superfamily
1Q0NA 1WOOA 3I4PA 4Y00A 1T3OA 2J8SA 2XNRA 2J0SD 2LFVA 1P9QC 2I0XA 3DOLA 3EDRB 3KLGB 5LMUF 2V50A 5HK4A 1HKAA 3P6YC 3RRKA 4Q5VA 1TL5A 2AJFE 2CFXA 4ETXA 1X5TA 3OTDA 3VQTA 3QOQA 2GQCA 1UVNA 3LGHA 3DM2A 1FVQA 4CT9A 2J0XA 2CPGA 4NEYA 1S1XB 3B4DA 3N79A 4KH1B 1P27B 4WP8A 1S99A 2BUNA 2ZKUA 3QGGA 2V94A 3AB2B 3NCPA 1NSPA 2R2RA 4LQ3A 5K8OA 2DR6A 1JJCB 1U24A 4DV4J 1WDTA 1N5YB 3EGNA 4MK9A 1XNQJ 4CLWA 4NZ6A 4X84A 1X9SA 1FJEB 3MPWA 5H9EK 5JJBA 4ZPBA 3SSRA 4RBTA 1U1LA 4ID8A 2BRKA 1QSLA 2CA9A 3JSRA 4XDDA 1K73T 3CIMA 2RU9A 1IWAA 2HBRB 4UOGA 4C7QA 3FBEA 5L46A 5C24B 2NPIA 1NK9A 2HNDA 2E1AA 2WBRA 4DCPB 4DUYJ 4F4KA 3MECA 5IM0A 4IG0A 1RWUA 4J9UE 2A18A 2XY5A 4LFBJ 2NXEA 3JXOA 2IDLA 3UR3C 2Z30B 1RU2A 1HNZF 1HWUA 2V4JA 4G3IA 1M5PC 2CQPA 1BWVA 2EKYA 1SC4B 5B0FA 3P5TL 1WC1A 1NJYA 1AZSA 2KN4A 1UJ5A 4ZVTB 2I6WA 1NBEB 4PYDA 4W4MA 2PO4A 7FDRA 3PKMA 2EFVA 4ZHRA 1UVIA 1GMWD 4DR6F 2VG5A 3OQ2A 1U4BA 1YG0A 2ZM6F 1U2RA 1YLXA 3EX7B 5J2QA 2VBWA 1CLFA 2G4BA 2EG1A 1EAYC 1Y00A 3M4XA 4R8UA 3LALA 2E5GA 2ZUAA 1NXIA 4CCHA 2D69A 1NSAA 2YNIA 2RRAA 3TUZC 2QMXA 3BYRA 2YWHA 3DLJA 4S0MA 5AE3A 2OEMA 1HR0F 5IT0A 1GMVA 2R8IA 3BN7A 4DQRA 2LDYA 3OUYA 5IS2A 1VC5A 2WCXA 1NK0A 5KFIA 2L9DA 3NY0A 3SIPB 3NNAA 3TUIC 4B9MA 3LP0B 2AYMA 3M9MB 2PSZA 2VZ9A 4QPXA 3JQJA 1HFEL 1RT3A 4Q8EA 5M2RA 2B7BB 2NXNA 3A3PB 2QLWA 3O44A 4OI2A 1QTNB 4KPCA 3TZWA 1U48A 3EPGA 3QT8A 2HHWA 2MKKA 3S8SA 2KKHA 3KK2A 1KQKA 4LF9J 2GMLA 4I1TA 3MCMA 4USWA 3QSYB 3D0GE 4HT5A 2DVIA 3FNNA 3OSNA 2W4PA 1B7YB 2K7KA 2FZCB 3F73A 1NPPA 5T7LB 4IG3A 4YUDA 4ATNA 2RMLA 3GJQB 2VF3A 3UVJA 2Q6CA 1FRMA 2HQ3A 2C42A 3CPWR 3B8HA 1ITPA 2V4RA 4PXCA 3RGIA 2Z58B 5L9NA 2QL7B 4B3SF 2XSJB 1J2VA 1UL3A 2EEYA 4JBCA 5K5MA 3ZTPA 4ED5A 4LSNB 3V81A 1FXRA 5DS7A 4QBUA 2B9XA 2E9TA 4M5LA 3K58A 3OR2A 1UJ4A 3MEKA 3CC4S 2CJXB 2G2ZA 2V2VA 2AZ3A 3W2VB 2V68A 3M05A 4A8KA 3GV7B 2HQCA 1R27B 3BQ0A 1YQHA 5LJ3Y 4U9RA 2HHHF 3UD3P 2CQIA 3RAXA 2X51A 5B0AA 4F4WA 4DR5J 4JB8B 2V6AA 4B9SA 3H0PA 3KXDA 1WF2A 3MD3A 1NUEA 4GKKJ 2YPZA 2LP4A 2ZDOA 2VPWB 3THVA 5B7WA 3ULHA 1NM2A 2RQ4A 2F4VJ 3M2UB 2E1RA 2DNKA 3MAAB 1RT7B 2Y9HA 4JV0A 2EVZA 3DU6A 3PW7A 4WFBQ 2W8LA 1R3NA 1AROP 4UT4A 3B54A 5SZTA 1FF2A 2DXDA 4FYDA 2BR0A 3PVXA 1WTFA 2WSEC 2P2CB 4U6PA 5ETNA 3R5JB 1HWLA 3I5CA 2GHWA 3MMCA 2CPYA 2K7JA 4K5RA 3BGRB 4QIVA 1SJ3P 3QLHA 2B9WA 4PXEA 2PFFB 3AD8C 3BKUA 1D0EA 2DKOB 2P5VA 4RNOA 3JYTB 3TP2A 3BPSP 1AFJA 4HLBA 1RT2A 2CPZA 4YDDB 2W9AA 1UW9A 3R5DA 2C2EA 1NLKL 2VFUA 3QT6A 4WZMA 4WIIA 2VG6B 1CJUA 1M1GA 4DV2J 1T05B 3I87A 1MWYA 3OTBA 4J5OA 3W8GA 1GT8A 2ADCA 2HEKA 2KT3A 3OBIA 4KB7A 2W2NP 4DV4F 3NS6A 2CQ0A 1XNQF 4OX9J 2GZOA 3EXCX 4OYZA 3BGFA 2FZGB 5J2PA 2A10A 1HHQA 4B3OB 2VPZB 2ALZA 1S6PA 3MEDB 1WC5A 4DS4A 3U1LA 2MB0B 1H38A 4Q43A 2H65B 1XC9A 3SV3A 4DV3F 3MUVP 3E3XA 2AQ4A 3GMGA 1B70B 4DL0C 1H72C 4J9LA 2YKAA 1LQ9A 4DU7A 5MLCV 2RRBA 4NASA 4DUYF 4I68A 5LSOA 2CPHA 3NWRA 4LFBF 3GJRB 1LWFB 3FC9A 4ERDA 1SQEA 4J9VA 1RCXB 2CVEA 4DEZA 4CLYA 5LSRA 1TTHB 3G82B 3UCZP 4ER8A 3RW7A 4ZLNA 4ZPCA 4F0MA 1JIHA 3HZGA 3B6BA 4NRUA 4LBHA 3V6JA 4TYBA 1T8EA 3HSGA 2X1BA 4F4YA 2H54B 3VAMA 1H3DA 3PX6A 1RKIA 4WXOA 2C2KB 1IKWB 3MOJB 2FLPA 2V8HA 1T3NA 1EKSA 2XMAA 4CM2A 1JLFB 2MZJA 2OHDA 3R6GB 4G6VB 4ZMMA 2HBZB 2WZ1A 2ZBRA 4MH8A 5HANA 1YZ6A 2QA4S 4YHHF 1HARA 5HMWA 2HFVA 1TV6B 4O23A 4BDPA 1EETB 1PC5A 4LQ9A 3AXKA 3B78A 3C15A 2OO4A 2XZWA 2R7UA 3AB4B 2J0QD 4H4OA 4J9QA 3EZ5A 5K9FA 3LP1A 2QV6A 3KNGA 4H54A 1PKUA 4PABA 4QWBA 2W2PP 3CXCR 2B5JB 2KM8C 3DLBA 3IR6B 3OHAA 3UD4P 5KFGA 1CQMA 3MM6A 2QTWA 2PN6A 2AJ2A 3R3TA 2OPPB 4BHQA 1YIJS 3LGMA 3IS9B 1J5OB 4K50A 4LF9F 3KMQA 2XLIA 3FMBA 3BO3A 1HNVA 4NLVA 5HJXA 2BANB 3ADAC 1SIWB 4WTYA 2ZH2A 1C1BB 3CJ4A 4QW9A 4UQTA 3T6JA 4KKOB 1GX5A 2M4MA 3K5PA 3G2XA 3C3LA 3G4SS 2RVJA 1WI8A 3H4DA 4CDIA 2MZTA 5CAAA 2R3VA 4M5KA 4PG6A 1RLCL 3KJNB 5I3UA 1Q79A 5F8LA 2I2YA 4C98A 3JSMA 4NYOA 4KGKA 2K29A 2F9DA 2M2BA 2MLXA 4JI3J 1RTJB 3IGNA 2KRRA 2DHXA 3KMSA 2HGLA 3NCQA 2P6SA 4ZJLA 1FX4A 3KLFA 5D3GB 2A6MA 4PG4A 1U2FA 5KG1A 5G0RA 2HS4A 3IC1A 2F9JA 3KG1A 5BXIA 2YX4A 1VRUA 3UNGC 1WSVA 1S57A 2FVCA 2DGXA 3QGIA 5BYSA 4WZQA 3IR7B 2UXCJ 3D54A 4A48A 3BM7A 3WBZA 2E1CA 2PC6A 1QUPA 4ZIWA 4GKKF 1XR7A 2V34A 4B3RJ 1P8GA 1Q5VA 3BS9A 1VJWA 4P2SA 2K8GA 3WDOA 5KAKA 2F4VF 3IM8A 4GVBB 4MIAA 4C8MA 2QLXA 1FE0A 4C0OC 4ED6A 4E98A 2MQPA 1RAFB 1WELA 3W5XA 1RTDB 3ENVA 5C25A 3Q2SC 1KTQA 4KY3A 1VQLS 5CZXA 4K8RA 2ZH8A 1D3WA 3I0RB 1SH3A 2EW9A 4NLOA 3OPKA 4X4QA 3MPUB 3D66A 2BOPA 1HBUA 3PYFA 3DDIA 2IBOA 4J90A 3WIVA 4ZLPA 2GVDA 3J7YU 4K4VA 5D4PA 3QO9B 1MWZA 4G1PA 4JP8A 2DNZA 3L3CA 3K5LA 1BGXT 2RBFA 2DNGA 3BSAA 4I7FB 2KL8A 4B17A 1XQIA 2OPRA 2YX1A 4IOBA 4W90B 3IG1B 4QYZJ 2HFUA 1N88A 3QSIA 3I5AA 2DHSA 4YB1P 3QRQA 4LF7J 5HP1B 4G1QB 4CH7A 4QIFA 2Y8WA 2CPEA 3KLHA 2ZD1B 4YS2A 5GMKa 2GW8A 3DDKA 3BEGB 4DV2F 1C4CA 1RISA 4ZP6A 2QLBB 4M5NA 4NLSA 3M8PB 4ED1A 5DGAA 4ZVOB 2DH7A 1MU2A 4Z37A 3CJKB 2QFJA 4OX9F 5AXKA 5HQMA 4P71A 5GAGU 4EFAC 4ZPVR 4XPCA 2WHOA 2BSQE 4N8OA 3MCNA 3GE9A 2NSBA 1IBKJ 1HMVA 1SI9A 2BKPA 1VQ8S 1NMEB 2AP6A 4HR2A 2G13A 3RJMB 2PMZD 3SSSA 3PIPQ 2W9CB 5K8MA 1NKCA 1N5TA 2BJ9A 1YDLA 2GO8A 2Q6BA 3SDEB 1BQNB 4PCQA 3TVKA 2AYBA 4M5HA 2XM3A 1MNTA 1Z4UA 3LP2B 2HHVA 2JC0A 1N5QA 4RL1A 2YKOA 2AJ1A 5F0UA 3DI6A 2F63A 3SYZA 4YB7A 3IN5A 2XMTA 3G6VA 1UZDA 1BQMA 2ALYB 4LF1A 4CNYA 3J81U 4URGA 1F1BB 1KTVA 2DBBA 1YJWS 4EZ9A 3EUNA 2I5JB 5A2QY 2NCKL 4TLRA 2VU5A 4QZVB 3CNQP 4IOAQ 2QT7A 2Q79A 3OFEA 1N56A 2YTCA 4M5JA 2UXDJ 3D68A 2MKSA 5HLFB 2KKEA 1WHVA 3ISZA 1MG7A 1JJ4A 2JX2A 2AZ1A 4UF4A 2QYGA 3EGVA 2HYIB 1X0PA 4JI2J 5GADI 1C0TA 1VQMS 3NGKA 1VISA 2CZ4A 3DKDA 1EJ7L 4MKVA 1JLGA 3M30B 1NSQA 4PKDB 5A8WA 4CNZA 2MKIA 1RYRA 1TKXB 1FKPA 2BQRA 3V6HA 3R8YA 2DITA 2AD9A 3Q24A 1O5JA 4OHWA 3US5A 1RKJA 2VH7A 3UO0A 4HV0A 2R2TA 2R7VA 3PYGA 3OL9A 3R27A 5DZ6A 2HZVA 4I4BA 4ED8A 4CI0B 4OI0A 4DSKA 4JI7J 1SV5B 2HRTA 5KG3A 1TELA 4DV1J 4XIUA 1WG5A 1YI2S 3CDBA 5CH7B 3BO2A 4IYQA 3DXBA 2RE1A 1WKJA 5ETKA 3SCKE 1VIXA 3OHBA 1DRZA 2ILYA 3FQKA 1L3KA 2NXJA 1YJRA 4AXIA 4KHPJ 4LRFA 3Q23A 4JI6J 2Q66A 3NNHA 5JUMA 3O1LA 4KT0C 2YH1A 1X4EA 3QAUA 2CQHA 2CZVC 1LWEA 2EC2A 2V9WA 4N5SA 3OVSA 4JI3F 1NK7A 1RHKB 7AT1B 3OFFA 3M2VB 2WAQD 2JDJA 2BQ3A 2ZC4A 2G2YA 4JI4F 1URRA 1JJ2R 2MKHA 3C14A 1HBNA 2M88A 3LOUA 4H4KC 1R0AB 2XB2D 1ZAWA 4LRVA 1WORA 3D6HB 4LF5J 5J2MB 2UXCF 2F1FA 5DQIA 4ZDNA 2DNMA 2C22A 2PI4A 3J7ZT 3GV8B 4ZIVA 4J9MA 4P2FA 3V5RA 4B3RF 4F2SA 2BE9B 2QE5A 4LR8A 2RHQB 1PBAA 2CKWA 2UUTA 4OJ1A 2H1YA 1MMDA 1YSJA 1QAXA 5A8KB 2D3OR 5A8RB 1VFJA 5KT3A 2O67A 3MM8A 2R7WA 4YQWA 5KFFA 4EGLA 5HMYA 4YEAA 2E29A 4DQQA 4C3MA 2EC0A 9ATCB 3RTVA 4MT1A 4A8QA 2HSEB 5IFMA 2NREA 3G71S 3W2WB 2ZJPQ 2G0CA 3GIMA 5CCLA 2R8KA 4NXMJ 1WHXA 4FF4A 1V3ZA 1QE1B 4Z7CA 3WHIA 1OY6A 4UQGA 4H4MA 4QIWD 1RB0A 1S9GB 1WOSA 2FJBB 2PGCA 1PAUB 4OI6A 5D0HA 1AT1B 1NH7A 2OD4A 5FDLA 3KWMA 4L73A 2HZCA 2DGSA 3VAHA 1PO6A 2JVRA 4OZLA 1P9YA 2K06A 3D1OA 3PRDA 4QPTA 1D9AA 3I31A 4NCGA 2CAJA 4LF7F 1WC3A 1ZA1B 1HA1A 2VA2A 1S77D 5D4OA 4K4TA 4DLGA 4YR2A 2LXIA 1C0UB 3N01A 1NK4A 2ROGA 1RWVB 3FEYB 5FLXY 2I1RA 4GO7X 4ZCIA 2AY0A 1CPZA 1B0TA 4FXDA 4N56A 2ZVIA 2HK2A 4NI2A 3UQSA 2XS5A 1FK9B 4LBPA 3O6QA 5GAEU 2Q2KA 5KFDA 5KOXA 3ILJA 4KFBB 1IBKF 2ABYA 2FY8A 2DR5A 2XGQA 3KUEA 5HBMB 2GNKA 4NZ7A 2G2OA 4OHVA 4DLEA 1JNRB 3D6MB 2L9WA 3I82A 3G6XA 2KTQA 2IVYA 3FVYA 1GQEA 2HQGA 2DXFA 3K8WA 1JLBB 3BQ2A 3GG1A 2PI5A 4ZLLA 4MKYA 3AJ1A 3CUNA 4Y2IA 1RT1A 4M1KA 3IRXA 1BD6A 2KU7A 3AOCA 3G8SA 4X2BA 1X7VA 3I4HX 1O0PA 1IBMJ 1SH0A 4BC9A 4B02A 3RBZA 2KFNA 4OZNA 3IBWA 2HS0A 2UUBJ 3UI3A 5F8NA 2EPIA 3F0NA 4ECYA 3DLKA 3Q0AA 2JHEA 2UXDF 4I56A 2MQ8A 4ZPAA 2BJ8A 4DQIA 3GP9A 2ZKTA 3CCQS 2AN7A 4CO1A 4JV2A 3M6UA 4JI2F 2C3PA 1HD0A 2HWHA 3A3NB 4PEOA 3MOZA 3A8KA 2X3DA 2XMKA 2PMHA 5H9EJ 1AYEA 5DM7Q 3E01B 4EEYA 4N7TA 2P8IA 3HMJG 2IRYA 4RW6A 2AEJA 2QYCA 2FD2A 3Q89A 4ICLB 5ETMA 1RLDA 2QZ8A 4HT7A 4QOTA 3AJ2A 1TR0A 3VV2B 2RDJA 3H5UA 4PQUA 3MTJA 5F3TA 3BKFA 3R5CA 4RBVA 4DF8A 4AD6A 4LMZA 2RIJA 4OYBA 1DURA 4DSIA 3HD2A 4DV1F 4X62F 3FMWA 1X8DA 3GWCA 1DAXA 1VRTB 3DYAA 3W60A 3KHGA 4DL5A 2JL9A 1FNOA 5J2NA 1QSYA 2MYFA 4PWWA 1FNMA 1YVFA 1FWLA 2JRSA 4ANEA 1QAIA 3HVTB 4KHPF 4CO2A 4JI6F 1WKKA 4J9OA 5KFEA 3NOCA 3MUMP 4BLGA 4OYOA 3UDVA 2W2MP 1NK8A 1RAEB 2UUAF 2YKNB 2W7OA 2XMUA 2Y0SD 4WE1A 3TUJC 4GVLA 3MPVA 3PKYA 5H9FJ 3KLGA 1IKXB 3GIRA 2AWZA 1S49A 1OYEA 4BWJA 5A0YB 4NLYA 3TAPA 4PWDB 2VIHA 1NB2A 1UPMB 3CDWA 2R7OA 1RWKB 2GIRA 3NXZA 4QW8A 4U7CA 3HK2A 3CO0P 4KPYA 4RR5A 4LF5F 4RW4B 1AFIA 1ZAVA 4USUA 3SCLE 2EG2A 4HL9A 1V3RA 2NPFA 3KTQA 4AL6A 3C19A 2KM8B 2QMUB 2ADBA 1T02A 4XO0A 2VKRA 5L1JA 3OVAA 2U1AA 2H4YB 4DSFA 3P49B 3TAMA 2K3KA 2XLJA 3SZ2A 4ZPDA 2RDIA 1GTHA 2XBPA 1LK5A 1RT4B 4KV8A 1CVJA 1Y9OA 1O8BA 5FD1A 1U09A 1HPZB 1YGYA 4B9UA 2CQBA 5HN0A 1G2EA 2OH2A 3FSXA 4CH1A 5E7OB 1V5VA 1XJWB 1WJ9A 1U25A 3QZ7A 4NXMF 2VONA 1KQFB 2IVFB 4ZLJA 1JLEB 4USIA 1QLNA 4CTAB 5C24A 3I0SA 1RT6B 1FTRA 3A8JA 5B0DA 5I3QA 3M8QB 2E5LJ 2F65A 4OI1A 2WVCA 1NKEA 5IQ6A 2K3IA 4DFMA 3G5OA 1N48A 1Y10A 4EO8A 3CEDA 1FT8A 4Q7AA 1OPIA 3OXLA 1CBKA 4KJIA 1U26A 1N5VA 1MYLA 2OEJA 2OSRA 2N3LA 4FDFA 4UUXA 1FRXA 2XI3A 2FHJD 5F3ZA 1IQZA 4Y2AA 1HYSB 5ETOA 2GJ2A 3K57A 2G9OA 2QRRA 3MM7B 4TNOA 2R7QA 1I6JA 1CS4A 2W01A 4DPYA 2VPXB 2F40A 3EXYA 4C8KA 4LF2A 4HI1A 2H4WB 4PUOB 2E5IA 2WRMA 1Q78A 4QCLA 5HQ8A 1KDNA 4A46A 4DHVA 5B0EA 6FDRA 4J9PA 2HRUA 3IR5B 4MIBA 2NSCA 3G8QA 3POTB 2UP1A 1LK7A 3IWNC 2CPJA 3KK3A 1HNIB 3DOMB 4FPRA 1KVIA 2J5AA 5C2CA 1XMOJ 3CDAA 3LP0A 2FQQB 3F41A 1W25A 1T9YA 3NS5A 2VL1A 3RAQA 3M8SA 2RH3A 3DMJB 1QDUB 3N0VA 1DQ8A 1IJEB 1SXLA 2PT0A 4DFPA 1VOMA 1XTZA 3Q8UA 1RAIB 1S76D 3M2RB 2KOEA 2Z56B 4FP9A 1UETA 5CA5A 4F0KA 4JV5J 4I0WA 4O3NA 5DDQC 1IBMF 3QJJA 3T5KA 2ZH5A 2B51A 2V63A 1TKZB 3ITHB 1S1VB 3W5ZA 2UUBF 3KJQB 5T7LA 1KQSR 1FFGB 3V4IA 1EA4A 1X4FA 2WVBA 4YMEA 2DISA 3HP6A 5LMNJ 2JLEA 3UN3A 3A12A 2OPQA 3V4MA 3TJ9A 2GJIA 2YWFA 1PSDA 4DX6A 1MWQA 1JB0C 2YNGB 3IWLA 3VAKA 3M1VB 1PBUA 3MF5A 2CQ4A 4O3SA 3PW2A 3RBEA 4RLEA 2VG7B 2JLFA 4KYZA 4LSNA 3T1AA 1S4FA 2AGPA 3VVTA 3N6NA 1CQNA 4W98A 1ZOTA 4OZJA 2W4DA 1VC6A 1R6VA 1I94J 4C2MA 5KG4A 2NZCA 4K4YA 3W2VA 4OI4A 2O3DA 3ILIA 1ZPWX 4FVCA 3M32B 2DNOA 3CD6S 2E7VA 3K0JA 2C3MA 2FGOA 2OI2A 4ECQA 3H2UB 1SJRA 3MR3A 1IBLJ 1YWXA 2DPJA 4RW8B 3K59A 3PDNA 3O3LA 3V6DB 3RBXA 3CGIA 5ITHA 1FXLA 3D28A 2HZAA 2YXLA 5IT4A 3PJXA 3TWZA 2UU9J 3K5NA 2FDNA 3M2UA 3UN2A 2VASA 3UDCA 3MAAA 3C2PA 3EJMA 3LTOA 4AFFA 1RT7A 4K4XA 3GIJA 1OO0B 4RKUC 4LFAJ 1Q82T 1VBZA 1HNWJ 3OT9A 1T9XA 2R7RA 1P6TA 1X4CA 1FEEA 2GQ2A 2WSFC 2HFZA 2U2FA 1IKYB 2NYHA 4QIEA 3G86A 1KLMA 3DOLB 3BDEA 3D0HE 3G6ES 3NL0A 2ILZA 1M5VC 4K4ZA 4PG7A 4B9VA 4V19X 1R43A 1FWPA 1KSPA 3DM2B 2Y3YA 3BGRA 1JX4A 2P9EA 3CJ3A 3H90A 4IKAA 1RI7A 2HIQA 2VKZG 2LMIA 4JV1A 3EPIA 1M5KC 3R5BA 1AXQA 2GMJA 3JYTA 5JXSA 1VHFA 2DCUB 2KG1A 2G0IA 4AE5A 3KUHA 3WX8A 3BN4A 4OZ1A 2Y1LB 2N4CA 2VG6A 1T05A 3CD5A 2IJFA 2GFFA 3PX4A 2V5HG 3NGRA 4FKYA 3CCJS 4I6WA 1M5HA 2BQUA 1KONA 3CCVS 1DLOB 4F02A 2AW0A 4C3LA 4RW9B 1NNDA 4I6YA 1NJXA 3WIUA 1NKBA 2FJDB 3OXFA 3AH6A 1KQGB 4B3OA 2KT2A 5KFAA 3MEDA 4CLTA 2RJZA 4BS2A 1F5AA 5B0GA 3KG4A 2E7XA 1OY9A 3MMBA 4A8XA 1U6BA 3D3CJ 3TZYA 2HNDB 1D09B 4MAKA 4ECTA 3QATA 5KT7A 4IG0B 4FXWA 2MJNA 3FRYA 3GV5B 1YJTA 2PE8A 4QR1A 1UCNA 1KN6A 2YKMB 2E5LF 1LNQA 3HZEA 2HQIA 2JJ4D 4DL7A 1N36J 4LF8F 1TAQA 1U0HB 1LWFA 2BABA 1HQ2A 4WU2A 3G82A 2HURA 3ZNUA 4PPDA 5L8RC 2CQ2A 1UFWA 1PJ5A 4L3KA 2IA6A 5EN1A 2XY6A 3PR4A 2QIFA 4C6AA 4DX5A 3K5OA 2M3DA 3QIDA 2QLFB 2AEFA 1RT5B 4DJBA 4OX8A 5EX0A 3JQKA 1OSCA 4L76A 3IFEA 1NU4A 3HHNB 5KFYA 5ETPA 2V8GA 8ATCB 2LQBA 2QJ3A 3OVBA 2O1PA 3MM9A 1IKVB 1CC8A 1HI8A 1F3FA 2CQ1A 1DTTB 4C48A 2JXHA 1YITS 3MEEA 4K0KJ 3D5MA 2C3YA 1TV6A 3HKZD 2XQCA 1EETA 2BE2B 4RWWA 4IH7A 2WVEA 2ZWOA 1MN9A 3LANA 2A0FB 1H74A 2XS7A 4K5SA 3U02A 5ADZA 3D0IE 1XMOF 1BC6A 4O4GA 4UW2A 1TL1B 1S12A 2B5JA 4EYHB 3VHQA 2EWHA 2NXUA 1R8BA 4OIXA 3R2DJ 1LXJA 3KK2B 1Y4ZB 1YRUA 1Q95G 2DR7A 3FBBA 3KK1B 3IS9A 4F2RA 1J5OA 4TYAA 2B9EA 1BUXA 4JV5F 3EM1A 2F8MA 2NUHA 5F0WA 4JYAJ 4ZCLA 2DH9A 2BANA 1SIWA 3VF0B 3QAEA 2ATCB 1U1PA 4C0HA 3FDSA 1C1BA 2FVQA 1ZPVA 2RUSA 1FKOB 3BB5A 3PRBA 4KKOA 3EVMA 5LMNF 4LSZB 1U6ZA 3ZZ0A 3HF5A 4N41A 4DDFA 3J7AN 3NMRA 2V69A 2RHSB 4JUZA 2LKZA 3RB4A 1NDPA 3EZOA 1RTJA 5L1LA 4QYRA 1RHMB 4DR4J 4HTJA 2BW2A 2QMWA 5D3GA 1UWBB 4R25A 1I94F 1MN7A 2O01C 4CO0A 4WCEQ 2D7SA 3GPAA 3R2CJ 3DLGB 1LWCA 4WKRA 2IM0A 4C3KA 1SC1B 4WYLA 2V9KA 3JTOA 4AXJA 1ELOA 2HHQA 1RDRA 1HWIA 2A1BA 2L9NA 1IBLF 3BQ1A 1M1HA 2RAQA 1R6YA 2KJVA 4OYAA 1GXLA 1QY7A 2R2UA 3FBCA 1DJ0A 4HDHA 3ZZUA 4ANCA 4ME7E 2QG9B 1FRJA 4USJC 2ZHBA 2CWKA 5AT1B 2UU9F 4GVBA 1WNEA 3T5LA 2CYYA 4DV6J 2VJUA 2V67A 2QLJB 4LFAF 2FVPA 4YB5A 5D77A 5DO2A 1HNWF 1DY3A 1RTDA 2HLUA 1TZ0A 2YNHB 3IRWP 2AEMA 3BGOP 3DNCA 1D9DA 1PG5B 2OPSB 3I0RA 4OZ5A 1EP4B 1FO1A 3W1YC 1AUDA 4F36A 3HFKA 2AYGA 1RK8A 3R1HA 2LQ5A 1S9EA 2IRUA 1BDVA 5M2UA 4OQJA 4ZVUB 3TANA 2ZZTA 4P10A 1FA0A 2ZBQA 2KB2A 2BNZA 4FF1A 2Q1LA 3RU0A 2M7SA 3TVYA 3IG1A 4DSEA 2MKYA 2WW8A 2GS8A 3D3BJ 2ASJA 1RAJA 2CRLA 1IJFB 2B8QA 4X4RA 5HP1A 1WOPA 1YBTA 3DLHA 2ZD1A 3C6UB 3K8VA 3LF0A 1I3OB 3G6YA 1LXNA 2BJEA 2KG0A 3DRPB 1VRQC 1S1TB 1XEZA 1QTGA 3CJKA 1S6PB 1RQ0A 4TN2A 3NNCA 3QZ8A 2K9IA 3BBFA 3HSDA 2CZ9A 4DPTA 2B56A 2MQNA 3HT3A 1TL3B 3FMTA 1RWMB 3G9CA 1TVRB 2W9CA 5AJ3J 5LJ5Y 2F7VA 4F25A 2ACMA 3DGVA 4JI8J 3SDEA 3OLBA 1ZAXA 1Y7PA 1BQNA 1N36F 4E0DA 3LP2A 4P9SA 2LDIA 1KD1T 3RR8A 3HM9A 3R1LA 2XWYA 4EZ6A 4FNIA 4RPFA 1HD1A 2CNOB 1X4HA 2IC3B 3FEXB 2ZITA 1H2UX 2DD8S 4CLSA 2DNHA 2ZOFA 2FC9A 2AIRB 3P8BB 4AT1B 3TEGA 2XS2A 1Q8LA 4IDKA 4O0NA 4FKXA 1ROFA 3I9V9 4ZVPB 4P52A 1CEZA 2VC0A 3U27A 1I5OB 1IRQA 2DNNA 2LECA 4DPXA 2AT1B 2YWGA 3AOBA 5F8IA 4LR7A 4CO3A 2KVQE 1Q81T 3BH7B 3M30A 4Q0BB 1SQGA 4K4WA 4L72B 2KZMA 2AGQA 3CMAS 2AF6A 3GCWP 2DGOA 2HQDA 2DTJA 4XAKA 2BEFA 3ENQA 3T1YJ 2FGCA 4MYTA 4NXNF 3KUGA 3QNWB 1HWJA 1GFWB 4B08A 2MQOA 1SV5A 2JEIA 1KVKA 1HNVB 4UY85 1NRKA 1LOUA 2ZWPA 5L1IA 2CUYA 4FBTA 1Y5LB 2MGZA 4JYAF 2EBEA 2HFOA 1K0TA 2A3JA 1RE1B 4RWXA 3FRZA 2J7UA 2BKNA 2NYIA 3A4TA 4DQPA 1NDLA 2I38A 3MR2A 1VC0A 2B43A 2WVDA 2Z57B 3ZZTA 5KT5A 1FEHA 4NYZA 4C11B 2WW4A 1SVDA 1QAJA 5E41A 4DU8A 3FK4A 4RW7A 5CCMA 4J9SA 4DR4F 2W7PA 5BYRA 2LU1A 3M2VA 1N0UA 2A2BA 5BJRA 2CWXA 3DU5A 3AQPA 4M5GA 4F7VA 3NWGA 4LRDA 1TUVA 1HQUB 3R9LA 2ASYA 1R0AA 1TK8A 2FHKA 4ZVQB 3HULA 2D1CA 4K59A 1NDKA 2E66A 5E33A 5K20B 2OJ3A 2IA0A 1XWLA 3VGVA 1EIYB 2GV1A 3OL7A 3AA9A 1Q53A 2GVZA 3MGJA 1FERA 2KXHA 1RTIB 4IFVB 4HYKA 1TFWA 5GMDA 1TK0A 3TEHB 3J81Y 5A8KA 1F0XA 2HHXA 1U1KA 4O3OA 5A8RA 3OTEA 1UAWA 4K2XA 3DLLQ 4IQXA 3H40A 5KFPA 5IXUA 1CG2A 5C25B 4QWEA 4DV6F 2XSFA 4PAAA 3I96A 2ZOMA 2WONA 3W3SA 2HQFA 3A3OB 1TQLA 2NXCA 5IT9Y 4OYXA 3W2WA 5HATA 1KFSA 2WOMA 1T0TV 2MDAA 3OR1B 4OZ3A 1QE1A 4JI1J 5D4LA 4QWCA 1XNRJ 4C8YA 5I3PA 5F41A 1T7PA 3AXMA 1F9FA 4MKBA 2DPIA 1QJHA 1LWXA 3AJDA 3KOAA 4NLGA 3D6TB 2CPXA 4DL6A 2CJBA 1YJ7A 2GGPB 1X9WA 3HVRA 3A8EA 4WKYA 1MLAA 3HLUA 3ZZOA 3AAWB 2UV8G 1O6XA 1S10A 5FJ4A 1SIZA 1UEVA 1Y11A 1JJHA 5E3CA 1C0UA 3BZQA 4TKTA 3THTA 2RILA 1RBAA 1B01A 2VBXA 1BAZA 5KT6A 1S79A 2M70A 5GADU 1IR1A 3UFCX 5F9NA 3W61A 3LWMA 1KLNA 4RNMA 1R0CB 3VZHA 3TZZA 1J27A 1FK9A 2IPOB 1S6UA 2D3ZA 4WJBA 3TAQA 3QPIA 4DFKA 4KFBA 4DUZJ 2X1AA 2AHOB 3KKFA 1N33J 5ETLA 3IWXA 5HBMA 2RKIA 3NCRA 5AJ3F 2B6AA 2AMCB 3HX9A 2XO7A 1REGX 2XCAA 3AHPA 4JI8F 3CDUA 1RXOB 1T03B 5DLFA 4KE5A 4KR0B 1JLBA 1RZMA 2OIHA 3DI6B 2DNYA 2W4CA 2DT9A 3BR9A 3CIZA 3IO1A 2MLYA 4C9DA 4WP3A 1BQMB 2R8GA 3J80Y 3CDEA 4FBUA 2H1OE 4JI5J 2QA1A 3EDQB 1YJUA 3CJ0A 1TFYA 1NSKL 4FPIA 4X64J 2VDIA 3CJ5A 1LFPA 3CJ2A 3DHWC 1FESA 3OLAA 3MDFA 1PYOB 4RUCA 2X1FA 4LF6J 2IJRA 2H5IB 2XG8A 2ZDPA 5KFJA 5HVHA 3CJRA 2FYXA 4WXWA 3RBDA 1WUUA 2ZVSA 1UFKA 5BR8J 1C0TB 3CCLS 1H6KX 2DCLA 3CMES 3E51A 5LT5A 4DF4A 4Y6IA 3F56A 4ECWA 4O3QA 1VI7A 3OJUA 3KYLA 4CIOA 3FJ2A 2RDDA 4MIWA 2ZE2A 2C2NA 2FVSA 2KFZA 3TA1A 1F9HA 2KYXA 1NPKA 3NAHA 2R7XA 2BACA 4FYXB 1T95A 3BBBA 1FKPB 1ZM9A 2HG4A 4TLQA 3CCES 2YQ1A 2XEXA 2CG4A 1DHMA 3ZO7A 4C0BA 3SBMA 2ACYA 3QRRA 4ILMA 4URQU 4V19J 1X0FA 2HAIA 3GXQA 4ICLA 3CT9A 2D41A 3T1YF 3MMJA 4KAIA 3KLEB 2DEJA 3T9NA 1T9VA 3TX0A 1ZZNA 3PACA 4MFBA 2NQPA 4NRTA 2VODA 2Z2ZA 3UDLA 1VRTA 3VAIA 2HIYA 4JOUA 3QGHA 4NLRA 2Z2LA 3VALA 1S0VA 2PFDA 2OD6A 1MYKA 3HSJA 3H42A 3SI8A 4WWSA 4ECSA 3HVTA 2P9GA 4PG5A 3UW1A 3MMAB 3IA0A 1PJ6A 3H4BA 2W9BB 2MZ1A 4KC5A 1N6QB 3FCWA 2PIIA 5HO4A 2HHUA 1DTQB 4NEZA 2BVZA 4CYUB 1T94A 3CC7S 5KOWA 1FFWB 1U1QA 4ZOSA 3BV8A 5A0YA 2DRBA 4PWDA 1SKRA 5KG0A 2VV5A 5D15A 4WFXA 4Q8FA 3PIOQ 1N32J 1YJVA 1UMJA 1FWKA 4RW4A 5HMZA 1VQ6S 3A1YG 3KLIB 2HFNA 4LBIA 4NZ0A 3D7SB 2MKJA 1OQ3A 3ELHA 3AY0A 4J91A 1XR5A 3VGUA 4LR9A 1YJ9S 2YNFB 4I64A 1VMBA 3PW0A 3NRBA 2YKPA 3QGPA 1VQKS 5HAOA 3QYYA 2Z2MA 1FD8A 4L6V3 4QR0A 4IRCA 1GK8A 1EZZB 4RJVA 3L7UA 2AYEA 1RT4A 4OX7A 2AKWB 1HPZA 1F6TA 4O3PA 4EUVA 1VQOS 2W24A 4CM0A 3UNYA 2ZH4A 4J7CA 3D1QA 3OJSA 1VQYA 1JLEA 4JI1F 4MYUA 3CCWA 1H73A 4CTAA 2OFHX 3L9ZA 1XNRF 1SB6A 2W2OP 4B9LA 1RT6A 3M8QA 2OELA 2OTJS 5A6WA 2EBGA 5DG9A 3OTOJ 4ILRA 4NCGB 1PCAA 3JAMY 3HXMA 3AT1B 1HHSA 3LQVA 4ED3A 4DPOA 4TU8A 1B4SA 1TKTB 3H98A 2AX0A 2ZBIA 3Q86A 4ZVFA 4HTIA 2R9LA 5L38A 4RX6A 2G1HA 1CJKB 2UUCJ 4NX9A 1HYSA 2GAHC 5DG7A 3FEZA 2RF2B 3MM7A 4DR5F 2V2QA 2BOAA 4YB6A 2MPUA 2OUGA 4LF4J 2Y0BB 1HBOB 3OV7A 5DDOC 2PMWA 2FHMA 3KHHA 2RQMA 3FQLA 2V8PA 4DUZF 3TVZA 5I4MA 3CSKA 2BXJA 4F4AA 2D9OA 3H5YA 5CYQB 1PILA 2DHAA 4ZCKA 1UTAA 1U49A 1N33F 3HHLC 2E9RX 2HNYB 3POTA 2C28A 1Q1KA 1QUVA 1S97A 1S4EA 1VGYA 2M8HA 2CJAA 1Y5IB 3THPA 1HNIA 1U47A 3ET6B 1NK6A 5EDWA 5HJYA 2K1OA 2YQ3A 4A8YA 3KJVB 3PYEA 3DMJA 2IJNA 4N8NA 2CDRB 3W64A 2R2SA 2R42A 3QIPA 5KTQA 3GSDA 3M2RA 5KFRA 4JI5F 4HI2A 2DR8A 1S1WB 3IGVA 3I6PA 4X64F 1SJQA 1TKZA 3ITHA 1IWGA 3BO4A 4HACB 2BDPA 1JWWA 4ECRA 4PXDA 1IM6A 4ZVEA 1S1VA 4X4VA 4ELUA 5J1EB 4LF6F 2VOPA 1HHTP 1U1RA 4IQMA 4N47A 3NGTA 1C4AA 3PHTA 4ZVSB 2DRAA 5GAHI 4NLQA 5BR8F 1RP5A 2YWWA 4ELVA 1NCLA 1RA6A 4UOHA 2YNGA 5EGYA 4QR2A 3MXHP 3DRSB 3PR5B 5KFQA 3AD7C 2FJEB 2VG7A 3DGPA 1UKUA 2NZ4A 3QWUA 4JI0J 1IR0A 1NJWA 2N7YA 4FVMA 3LPYA 2BX6A 3MAQA 1Q7YT 5KFOA 1SUQB 5RUBA 2YWEA 2B3TB 4PQUB 3EICA 5I42A 3M32A 3HHLD 3DCAA 1BE4A 4DFJA 2BM1A 2CVIA 3HI9A 3SQGB 3ISNC 4I2QA 5KT2A 4P72A 2YVSA 1VQ5S 2DB1A 2VFVA 1UVLA 2KYZA 3Q8SB 4RW8A 1KKHA 4DMZA 3PG9A 3V6DA 1YRXA 3C16B 2FIUA 2IFXA 4DR2J 2JEFA 5C2GA 1AUSL 2KDOA 4WU3A 2V8VA 4K4UA 2VQEJ 2JEGA 1X93A 4DR3J 2J9DA 4DCJB 3MEGA 4Y2KA 2W7AA 1JLAB 1S72S 2RD5C 5C42B 4WF9Q 5DDPC 4J37A 4OLPA 1IKYA 4WE1B 4USHA 4X4NA 3OL6A 3W7BA 1B3TA 1F5BA 1QVFR 4NLPA 4ZVGA 3BSCA 3P45B 3NAIA 2ZH7A 1RCOB 2CNNB 5M2PA 1BXNA 3NKYA 2DNRA 2UV8A 5LXRA 1LFWA 4GKJJ 2J7WA 3OXGA 1WKLA 5IT9U 3H5XA 1AA1B 2G0JA 4PYAA 4G1IA 2JVOA 1HW8A 1N32F 4USMA 1S6QB 1RTHB 2HW3A 3LPEA 2IYIA 4LUBA 2HNZB 4TU9A 1S7IA 1P1LA 4P75A 2IMWP 2APOA 1M5OC 4M95A 2C2RA 2VQFJ 2ZJRQ 3TAMB 1FHTA 5DM6Q 5K8PA 4HHHA 3ZFVA 2I9SA 3IAS9 4PR6A 4DG1B 2DNQA 3ISND 4KV8B 5IWAJ 5IV4A 1DLOA 1CULB 5LM7E 1MROB 5C5JA 3VVUA 1IXKA 4RW9A 3CO9A 2ZOGA 2LU2A 3DC2A 3FT7A 3N4WA 1F60B 4L3NA 1FCAA 4DV3J 1Q16B 3CW2C 4ALZA 3B82A 1MW7A 3PFEA 5IC6B 1L3TA 5K8NA 1M1KT 3I0SB 3LGNA 1F5CA 3VW4A 5B08A 5KFWA 4ITSA 5E3AA 3R7NB 3Q8PB 1HNXJ 2Y8YA 4Y2MA 3VAGA 1RAHB 3GB0A 3SV4A 1CJTA 2YKMA 3T3FA 2C1EB 1BLUA 2BZ2A 2IRXA 1U0HA 1WC4A 1LW0B 1OY8A 3OTOF 2E9ZA 3K5MA 2FJXA 1HL6A 2LEAA 3G8TA 3S1TA 2J0WA 4Q2MA 2UVVA 1RUSA 1RT5A 5KFNA 4H4KA 2XTJP 2HWIA 3GONA 4XPEA 3T1HJ 2UUCF 3K7RA 4AYBD 1UVKA 2D3UA 4BWMA 4OHXA 3JB9k 2SXLA 1CS4B 1IKVA 5KFXA 4WFAQ 4KHMA 3J80U 2GA7A 4ZJOA 5H9FK 4O44B 1DTTA 2I8EA 2DJWA 4XDCA 4YHHJ 4LF4F 3QT7A 1A9NB 1A6LA 2XNQA 2P6TA 3M8RA 1FRLA 2DY1A 5D4NA 1HLWA 2MSSA 5CYMB 2BE2A 4TVAB 4DR1J 3KK3B 4ENOA 1AW0A 1NO8A 2DGTA 3DN9A 1REVB 3HHDA 1IM4A 3NOGA 3G96A 2NS1B 3AA8A 5EWEA 3HHEA 1R7IA 2L08A 5HVGA 4ZN3A 3PV8A 1X5OA 1UVJA 3C6TB 4YN3B 2MMYA 1TL1A 4FZVA 4IR1A 2CNKB 2Q3PA 4NLWA 1N54B 1UP1A 1Y3KA 5LSLA 5DJBA 2HPUA 3NBPB 2VOOA 3RB0A 1GX6A 2KELA 4KQZA 3CWJA 2QN6B 1SJ4P 4EWTA 2VUGA 1B64A 2D74B 4F4ZA 3KK1A 4KBIA 1TL7B 4FXEA 3GYXB 1Q8BA 4NCAA 3LA0A 4M5DB 1J5EJ 3KDOA 4IRKA 3M8YA 3DDNA 4YP3A 5HSPA 4X4UA 3L95X 2J8AA 1Y3JA 3V4IB 2DIVA 2ZJQQ 2HMIA 3AODA 4B9TA 2ADLA 2HBQB 2OPQB 1FKOA 2XMMA 5ETVA 5DG8A 4CP5A 1ZYQA 2R7TA 1K9MT 1X4AA 2MEWA 2XZTB 1RHJB 3FSYA 1KS2A 1X60A 8RUCA 1SQFA 4I69A 4K2JA 3FFIB 1YBAA 3GIKA 1YJNS 2XULA 2MTLA 4RU9A 1SBRA 4JI0F 1YKWA 4EK2A 1UWBA 4RO0A 2G1DA 1KOHA 3CCTA 5HROB 1RGVA 2YH0A 3NGUA 3M8ZA 3DLGA 4A4JA 2B8PA 5LL6d 4RNFA 4TY8A 1T9TA 1VBYA 4IH6A 2EK6A 3SSQA 3DHXA 3RRHA 5CQGA 4C8NA 3MM5B 3LAMA 2E1MC 4LVOP 5B0BA 4F8RA 3H87C 4I2PB 4XTTA 2MXYA 1BQXA 5EHHA 1S0MA 2BKOA 4DR2F 1U7LA 5KG6A 2CPIA 1HBMB 3BBCA 3RG6A 2GMHA 2B7CB 2KVIA 2VQEF 3R97A 2QSFA 1WEZA 4KO0B 2HWTA 1E6YB 4KGMA 4DR3F 4ZA1A 5EWGA 1C2PA 2B4PA 4EYIB 4DL2A 4TQSA 2EFQA 1V9OA 3DRRB 4IRDA 1KLMB 4D8JA 3ZZPA 2UVUA 2YNHA 5IC4B 1S1UB 1VQSA 1C1CB 3FZBA 1CJVB 4ED7A 2OPSA 3A8IA 1EP4A 2ZZMA 2RS2A 4IFYA 4DZDA 3M8WA 4R5PB 2O66A 4EO6A 2XWXA 4USKA 3BKTA 2NR0A 4IR9A 2RRNA 2CJ9A 2N4DA 3TUPA 1NZAA 2MHEA 1ZA2B 4F26A 3UWTA 4GKJF 4DPWA 1KP6A 1JKHB 1R8PA 3DLEB 1OG7A 2JSXA 3UCUP 1JXEA 1UA0A 4ECVA 2AJQA 1JLQB 4Y2CA 4MK8A 1TK5A 4RUAA 2YWKA 1UPPA 3C66A 1X31C 1Q5YA 3C6UA 4O3RA 4P7TA 1WG4A 5KFLA 3R5AA 2VQFF 4F3QA 1OIAA 1S0NA 2K6LA 3DRPA 3JAMU 2JC1A 1S1TA 3CJSA 4A8OA 1DQ9A 1NDCA 5IZHA 4Q44A 5EWFA 1UA1A 1VQPS 3IAM9 5IWAF 2IDEA 1KC8T 4WP9A 5AXNA 2H5JB 4URSA 2XHWA 4TQRA 4JI7F 1XR6A 4FYWB 4K7QA 3KFWX 4R0JA 2JXIA 4RNHA 3MMBB 3BYPA 2XZDB 1PJ7A 2ASLA 2H3AA 4NPOA 4ELTA 1DFDA 3W66A 1TL3A 1XIQA 4KHRA 2HGMA 1IVZA 3U1MA 1WACA 2HFSA 2GJFA 3PRVA 1HI1A 2JXGA 1TVRA 1KBRA 4OJHA 4ILLA 2Y1IA 2CAXA 1HNXF 2RUGA 2C2ZB 3SMZA 1H98A 2C3OA 2VFTA 1JK9B 4YR0A 2UZAA 1KNZA 4USVA 3L7PA 2FLNA 4RBUA 3H20A 3AQOA 3TR5A 1BWEA 2UXBJ 2HRYA 9RUBA 4B3TJ 1HW9A 1Q8IA 2C2MB 2K5JA 4A8WA 2H5EA 2IC3A 3CVKA 1HQEB 2FHJA 3UD5A 3MM9B 3W9HA 3T1HF 1JLCB 4ZP7A 2FLOA 1S1XA 3AFGA 1G6BA 2K2PA 2VFSA 3TQ1A 3MEEB 3QWPA 4EBDA 3QJPA 2DIUA 5GMEA 5CHCB 1FDNA 4U7UK 4AL5A 3FGVA 2CXEA 4A8SA 1IBCB 2CQDA 3G87A 4YDXA 4AUKA 2F8HA 4C8ZA 2KHCA 3R7SB 4DR1F 1N5YA 4MKAA 1FJ7A 1JXLA 4X66J 4B3MJ 4ZP8A 2BMBA 3ILOA 4O4GB 3TJAA 3NG8A 4Q0BA 3H7HB 3QJLA 2J6TA 4LSLB 3BPDA 3HSZA 4RUHA 4DV5J 3ICLA 3F44A 1DQAA 2H48B 1R31A 2N3OA 1X4DA 2F8EX 4OLOA 1D1UA 1FDBA 2IVMA 2IAJB 1FRIA 4TXSA 2CJKA 1SL2A 2MQQA 4YY3J 2VFRA 3MUTP 2DK2A 1WI6A 1U1OA 4FS2A 1M90T 3IXQA 1J5EF 3EVOA 4PXBA 2MKCA 2XMVA 4KGXB 2XO6A 2B4VA 1LW2B 5D78A 3HVWA 1OMSA 1KFDA 3T41A 1Q7LB 1V3SA 1S0OA 2QL9B 4Q2LA 1R89A 2KI2A 4CLKA 4NLDA 3CMQA 1RWPB 4PWUA 2V4QA 2XGPA 1VHIA 1APSA 1EKRA 3DOKB 1SC3B 4C11A 3NGSA 5F8MA 1S48A 2IMOA 4P2MA 1JXVA 2JBVA 4ZP9A 4JI4J 1ZM2A 4RNNA 3PJWA 5KFVA 2MY8A 3CTRA 1G3OA 2F5GA 1LWCB 4OJ3A 1S9FA 4C8OA 2KT5A 2GQQA 3CCZA 4HH1A 3PYDA 3CCRS 3GFXA 4KGZB 1ZS6A 1HQUA 3UN5A 3HHLB 1VJQA 4YOEA 5K14B 1NLAA 1FTCA 4OYIA 4OYMA 3R7BB 4X4OA 1LV5A 1UEUA 4CO4A 2QFIA 4NE9C 3KNAA 4O0IA 5CD4A 2EI5A 1NHVA 1YZ7A 2LQJA 4IFVA 1ACMB 1RTIA 2X7IA 1E6VB 1OPZA 2PEHA 1O51A 2ZBPA 4OL8A 2MY7A 3EGWB 3GLJA 4DV0J 5FIIA 1SJ1A 4OJGA 3GYGA 3Q22A 4HHJA 3KHRA 1ZZFA 2BBEA 5HL7Q 2LA6A 3ZTOA 4UOCA 4ZVHA 3TX8A 3MAHA 3RB6A 1I51B 2JOQA 5CXTA 3QMQA 2QX0A 4M5MA 3PJ9A 3GU0A 2R4FA 4QU6A 4F4XA 1S9EB 3OR1A 5LXYA 1KHVA 5J1NA 3DRXA 2YY3A 4NLUA 1TAUA 1ZTWA 5KFTA 1A7GE 2WK4A 2HGNA 2XCPA 2B9YA 2KHDA 3UPFA 3HVAA 3OW2R 2BA9A 2XSJA 2GGPA 2LVWA 1XK8A 4NLTA 5HI7A 1WC0A 5F8GA 2BW7A 1TUGB 1N0VC 1XBWA 4DSLA 3TO8A 2ZH3A 5L1KA 4Z2XA 3BDPA 3OL8A 3KLVA 4NA3A 4ZITA 3CD0A 2HS3A 3J7Z5 1PYSB 3OSPA 4UTGA 5LOQA 1NB7A 1K1SA 4X4SA 5DETA 1T11A 3L09A 2K1RB 3I55S 2FLLA 2QEXS 2DNPA 4DL4A 5D8HB 4ID5B 1X5PA 3CCUS 2AV5A 3GIIA 1UZHA 3KG0A 3PFOA 4HH0A 4M63A 3T5JA 1U8WA 5DQHA 1VQ4S 4CLLA 2PDAA 4TU7A 4NMLA 1T03A 1JQGA 1G4CA 3NP5A 1VBKA 1IUJA 2GCFA 2UXBF 4CLUA 3TW0A 1WWHA 1HIYA 3CJ8A 1RYSA 2ASDA 4B3TF 4QU7A 3VWSA 1OHNA 4Z7YA 3PO5A 1FNXH 2WTFA 4GC7A 2OKQA 3SXLA 3W65A 4MJKA 2IIHA 5KG7A 3UDEA 4IDKB 2ZFHA 4EI2A 2V2KA 5CD4H 2OEKA 1NHUA 3NO7A 2HVIA 3LUYA 4F0HA 3CF5Q 2WB4A 4NA1A 1S5ZA 4OFZA 1SL1A 3K17A 4DV7J 2LEPA 2EFGA 3AD9C 3X3UA 3HFZB 2NLWA 4E8UA 2DHHA 5E0OA 2V2ZA 3HKWA 1SKUB 3JSYA 4KIAA 2M5YA 4I67A 3ENWA 5KFBA 1RHRB 3CJQA 4FXVA 4HVZA 4X66F 4B3MF 1UEKA 5IV3A 4X65J 4ZKAA 2LYVA 1UWAA 5F8HA 3JQMA 4DV5F 2XYPB 4D3HA 1RAGB 1N34J 2RQCA 2BRLA 3IBFB 1X4GA 5AXMA 2OP5A 3M6XA 2FY1A 1PGZA 1OQ6A 2VBYA 3S6EA 2FZKB 4M5IA 3LAKA 3ZZRA 4YY3F 3KLEA 3MECB 3KJFB 5IM0B 1MSWD 1ICEB 4X62J 3NGDA 1D9FA 3EZUA 1YRTA 3QRPA 1U2CA 3O5TB 4KRWA 2MGZB 1PAEX 1MMNA 2V4JB 4Y3CA 4CZCA 2QO3A 1H2VZ 1A0OB 1F3VA 2DGVA 2RQKA 5ETQA 3GYNA 4DBQA 3HT0A 2ZEJA 3MWBA 5AE2A 2DO4A 1OSDA 1AZSB 3W8PA 4YR3A 2EFOA 5DQGA 4MJWA 4FF3A 4ZCMA 3P4UB 1VQ9S 2DH8A 1L3VA 3MR7A 3MMAA 2W9BA 1N52B 3E2EA 2JEJA 2UUAJ 4ZHRB 5E3RA 1N6QA 3ZXWA 2VG5B 4RW7B 3L4BC 2V0NA 1U1MA 5J2QB 2DYAA 1DTQA 3K2YA 1IKWA 4CYUA 5B09A 4R8UB 2J6UA 2RS8A 5T41A 1JLFA 1RWOB 2RT3A 5KFKA 2YNIB 2YQ0A 5B0CA 1KRPA 2X3GA 3HD1A 1H7WA 2MSTA 2OMLA 4GO5X 2R7SA 3OUYB 4U7UD 2KXNB 4W92B 2GVZB 4LVNP 3KLIA 3PEJA 4HEA9 4GMKA 1ZBTA 4DCOB 3FBFA 2W1BA 1RT3B 1S59A 3FSIA 2YNFA 1QSSA 4ED0A 2IM2A 4PQAA 2CADA 2WB1D 2ZUGA 1VCTA 3BJYA 3LJPA 1FDDA 5A6PA 2C2DA 4DV0F 4L75A 2OPPA 2WONB 3HPOA 5HVFA 1YBUA 3N28A 2A2CA 1WEYA 4DL3A 2EK1A 1F2GA 1VK3A 2EFNA 2WOMB 3FKBA 3MPDA 3L7OA 4FYVB 1WSRA 3EMTA 4IG3B 3SCJE 2GIQA 3A13A 3Q8QB 4F3OA 3JSBA 4ETZA 3UVJB 3VR1A 4DR7J 4NWBA 1R8HA 3PW5A 1W7WA 2LLZA 5KFUA 1X5SA 1D8ZA 5CZVA 2GO9A 3RR7A 3PTWA 4NOHA 4LREA 4PG8A 4DN0A 1RBOB 3PEHA 3V81B 3GJTB 3PCOB 2JH3A 1VYAA 3MURP 5J1PA 4OZ0A 3OR2B 1FRKA 3M9NB 3ONQA 1TMJA 2YX7A 1X9MA 3UE2A 2C2OB 1TKTA 1YX2A 2JZ5A 1U45A 3GSIA 4AL7A 2Z2YB 4HDGA 1PARA 3O8WA 5G4DA 1VIOA 3OFHA 3TRGA 1CJKA 3MFHA 5KT4A 3I5BA 2MQLA 3EGZA 1WD6A 3H59A 3IR7A 2RF2A 1N4LA 4YFUA 3ZC4A 1Y5NB 4HKQA 1EARA 1UFLA 3OTCA 1FVSA 2KO1A 7FD1A 1U6FA 1HBOA 3CJTA 8AT1B 2M52A 4WK1A 1N8RT 2BNWA 3P5BP 1H2TZ 2RKIB 1FXDA 5CYQA 2N7CA 3D1HA 1OWXA 3GJSB 2B6AB 3V6KA 1QD1A 2JLGA 5GVQA 3BREA 1WF1A 2HNYA 3SCIE 1NAQA 2MQMA 4C4WA 1AB8A 2FPHX 3LH2S 3JTPA 2VPYB 3N6MA 3ET6A 4DZ6A 4LFCJ 1F9EB 5CYJA 3KJVA 3ETOA 5EX3A 3MMCB 3GTYX 2LQ8A 3QLHB 2XC9A 2JFKA 5IOLA 4U8YA 3QO9A 1ARQA 3TQEA 2FB0A 3PX0A 4ED4A 5KG5A 4BCAA 3MCSA 4QIGA 2A6OA 3NEKA 2HHTA 3DXSX 1S1WA 3U7JA 2HKEA 1WHYA 2H51B 4I7FA 2O5DA 1RT2B 4HACA 5KG2A 5DGBA 1SKSA 3T9ZA 4WPAA 5J1EA 3PM9A 3CCSS 4DV7F 1ZM4A 2DR9A 4G1QA 1CJUB 3H2LA 1EX8A 4DS5A 3MTKA 1RAOA 1Q8KA 2FJWA 2ZE2B 2GX8A 3PHEA 2MZRA 4KGVB 4AQYJ 3DRSA 3M8PA 4LIWA 5J2PB 2ZNYA 3BGUA 4XK8C 3R6LB 3JS9A 3W63A 3EYZA 1GTEA 4X65F 2RU3A 2CJYB 1JMTA 4WFNQ 3TA2A 4QJVA 1FX2A 2F3JA 1Q86T 2XYHB 2XMWA 1SUQA 1FKAF 2J7KA 1N34F 2OFGX 4IOCQ 4DSJA 3TA0A 3BSOA 1U0SA 4Y65A 4Q45A 2CQGA 4UZCA 4MFBB 4CLFA 2LQ9A 1GNKA 3SQGA 1S7HA 1FE4A 3QFHA 3RB3A 2Z4PA 3MFIA 1NJZA 4FNHA 2GC8A 2DO0A 2IY5B 2VC1A 3W62A 3VAFA 3C16A 2B4UA 2DXEA 2WBMA 4IUFA 1SL0A 4G65A 4U8VA 3D6FB 1UW4A 3J7YI 1DZ5A 5KFZA 5HMXA 2IM1A 3MD1A 3X1LB 3E8OA 3PW4A 2HAFA 1JLAA 3RYLA 3PO4A 1TU0B 5C42A 3Q2TC 1PYTA 3FCHA 1GMWA 2ZZNA 4LJMA 3D67A 3RRGA 3VTIA 2ZH9A 4FN5A 3KHLA 1NEEA 2I5JA 4NMXA 2IYGA 3RZAA 3N5FA 2RNEA 4X4TA 1Q4RA 4USTA 2P9CA 4TY9A 1K0VA 5ETTA 3DFEA 3GFZA 5HLFA 1YK9A 1VLOA 4K0KF 3UCGA 5KFHA 1TUWA 1XERA 5KFMA 4DXLA 4F04B 1IR2A 2EKNA 3C15B 4H4OB 2BE7D 1S6QA 1RTHA 2HNZA 1U1NA 2HHSA 3LP1B 3IP0A 2MZSA 4QWAA 5D0GA 5GAGI 4ECXA 3T5HA 3VEAA 1TKXA 2J9EA 3EE3A 1R8CA 1RTZA 3TI0A 2AGOA 3MM6B 3VAJA 4EU0A 3Q8YA 2QA2A 3VCDA 5ETRA 2LA4A 1VBXA 1RSCA 4CT8A 4LT6A 4DG1A 1S6OA 2DY9A 2A2DA 2UVWA 3BR8A 4MK7A 2HBYB 1CULA 1N5SA 1MROA 1Y0HA 2CPDA 2EFPA 5AE1A 1V5IB 3HJVA 1OS5A 1WG1A 1W2IA 2GPEA 2DHGA 1Q16A 4WIQA 1RA7A 4J9KA 2B4OA 2JWNA 3WQPA 3LW5C 4DR7F 4P7VA 3ZTRA 3M6VA 3GFHA 4DWIA 4OX6A 4J9RA 3QQCD 4LF8J 2X1GA 5I3UB 4P6QA 4K4SA 2CIMA 3R5GA 3JSMB 3SFUA 1LW0A 1JNZB 1VK8A 3WC0A 3T19A 3U1NA 4ZPWR 2R8JA 4WYWA 4OV6A 3ENAA 1PC4A 4B9NA 3KLFB 3SQOP 2GAGC 3NLCA 1ULRA 2IM3A 4ES1A 5IQQA 1H7XA 5G0RB 1CC7A 4U67Q 4WK3A 5D0EA 5GAHU 1PIEA 4EBEA 4NLXA 1FRHA 2E5JA 4NYPA 5E2QA 4NCBA 3BGLA 1VRUB 3N9UC 3CCMS 4WTOB 2Y1JA 4Y28C 1U8SA 1B7FA 2ZH1A 3VGTA 3N5BA 2DEIA 5J2MA 1SH2A 4CH0S 1G1XA 2BJDA 1ZTTA 2JNJA 2VA3A 4O44A 3NMAA 3Q8RB 1W26A 2W2QP 1HI0P 1Z2LA 5A2QU 1EQMA 2ERRA 5JVHQ 1LKZA 3PNIA 2LXUA 3PZPA 3HFVA 5CYMA 4DX7A 4WFYA 1I1GA 4OHYA 2D3O1 1REVA 4CWBA 2QSWA 5ETSA 1MNEA 4RUBA 3VGSA 5A76A 2COLA 3GR1A 3JTNA 1KOOA 4R0EA 4F50A 2MLZA 1FJGJ 3C6TA 3MR5A 2CNLB 1HBUB 5JVGQ 2HVHA 4LFCF 1RU1A 2GVDB 3ZTSA 3NBPA 2YKQA 3QIPB 5L39A 1B28A 2FUG9 3RUBL 3ZZZA 1ZH5A 3S01A 4RZRA 3SEOA 5D0RA 1BHNA 1GXTA 1S9GA 1GH8A 2E1PA 3HO1A 2OGUA 1TL7A 2HK3A 4M5DA 2EXUA 3VEBA 2OPRB 4ANDA 3P3DA 3M6WA 3P96A 3TYTA 4LRAA 1SCJB 1GMUA 3EWGA 3MI7X 3KLHB 4OMFG 5CABA 4DX8H 3GQCA 3M9OB 3H25A 3WC2A 2Y1RI 2POKA 2BYCA 3C8YA 3BH6B 1BY9A 2OAUA 1IN0A 2M0GB 1NK5A 4BC7A 3DGPB 2VDHA 3C46A 1MU2B 4AQYF 3HCXA 4CQ1A 2BM0A 1SJFA 3FFIA 2DNLA 3BSNA 4ZJQA 1V6HA 4M8LA 4IH5A 1NHKL 1M0SA 4PZVA 3W9IA 2FHOB 1VS3A 2LCWA 1Z1ZA 2BV3A 4UOFA 1HMVB 1EB0A 5I42B 2HHPA 1XMBA 5HROA 2FTRA 3HHKA 5T14A 4DPUA 2M9KA 4I2QB 2OSQA 3ZZYA 5H1SV 1OYDA 4FS1A 3MM5A 2CQ3A 3TARA 4WFZA 2CJQA 1ARRA 1KR4A 3D4JA 2XY7A 1URNA 3H2VE 1WC6A 4PPZA 4UY8T 4I2PA 4C97A 5THWA 3J81j 1P94A 4OYWA 5MAOA 1HBMA 5DZ7A 3MEGB 4ZPTR 2DRDA 5DDRC 2MHNA 4KO0A 1E6YA 5JMNA 4LRCA 2QA4G 2Q43A 3HJFA 3FZ2A 3MZIA 4U95A 3DRRA 3B4MA 1S1UA 1C1CA 4NA2A 2HVZA 4E2FB 3OD2A 1CJVA 2XI2A 4DOZA 4IO9Q 4R5PA 2ROEA 5EUHA 2R8HA 2KJWA 1RABB 4QQBA 4Y0FA 4OI3A 1NJIT 4MMOA 2OLWA 1JKHA 4OV1A 4F3MA 1DBDA 3K89A 3DLEA 3VQSA 4OHZA 4DN9A 1FI4A 4CRJA 1DARA 3GILA 2XHCA 1LEOA 4QYZK 1JLGB 3HDSA 4D3GA 1JLQA 3MHYA 3LO3A 5A8WB 2W25A 5GAEI 3E01A 3QFWA 4OZ2A 4C8LA 4J9NA 3GR0A 5KFCA 2YBVA 2ATLA 3TOQA 1KWMA 1RJJA 1U9PA 4ES2A 3CE8A 5DLGA 2D9PA 3TNVA 4ZK7M 2XYGB 1CSJA 3TZXA 5FLXU 2ZHOA 1G7CB 3ZTQA 3WX4A 3J7A1 4F67A 1RHUB 3Q83A 1RWWB 3BF4A 4A47A 3GCXP 1WDDA 5F8JA 4AAIA 2BJ3A 3S7RA 2QC3A 3I56S 1WHWA 2QGFB 1XMQJ 1TMMA 3Q8VA 3ETMA 1TP7A 1XN9A 1RHQB 2HLTA 1CJTB 3CULA 2F4FA 1B0VA 4UZBA 2ZNZA 1LWEB 1HWKA 4NL5A 2FJVA 3GG0A 1VR6A 2H9ZA 5E5NA 2J9CA 4P2XA 2YKNA 5LMUJ 5E3QA 1UJ6A 2FC8A 1ZM3A 1FFSB 2H3EB 2L48A 2XLKA 1RWXB 1IKXA 3C14B 1HBNB 2J76E 4ZS6A 1WTBA 1K1QA 1HQEA 3N6LA 1L5UA 3D2WA 1T9UA 1JLCA 5DRKA 2GIFA 1KEKA 4V1Ak 1K8AT 1WF0A 2GHPA 3PY8A 5SUHA 3NNEA 2VB6A 3QT5A 2N82B 3RAMA 3OFGA 2LEBA 1H0HB 4CO5A 3GZ7A 3TJ8A 3EVWA 3MM8B 1QTMA 2JFDA 2E7WA 3MPYA 4FF2A 2VJVA 4EBCA 4Y34A 1NPRA 3CB4A 3PXGa 3SFGA 2OTLS 4LIRA 1FJCA 3AOAA 3FUYA 4L74A 5E3PA 4I6AA 2BJ7A 2IBKA 4ZN1A 4LSLA 1GAOA 4A8MP 1M5SA 1VLYA 1FJGF 4CLPA 3W5YA 1Z2ZA 2AX1A 1KVJA 4NXNJ 3V2UC 2ZC3A 4H4MB 2IAJA 5L9XA 3MR6A 1RWNB 1EHWA 3QBCA 2HVDA 1T9WA 1VDHA 3LWLA 5FDLB 4OYPA 3O2IA 1D8YA 1SC6A 2VICA 4WBFA 2ZHAA 2UUWA 1FDAA 3IMQJ 2QL5B 2KFYA 1HNZJ 1U02A 2XMJA 5C7PA 2HMIB 4BBYA 2KRBA 4LRBA 2CPFA 1KHWA 1LW2A 2ZH6A 4DUTA 1QAYA 2GHVC 3T6BA 4N76A 2RB7A 1W2BR 1F2HA 2Z8QA 2L3MA 4DR6J 3DOKA 1L3SA 2ZM6J 4NI2B 5F9LA 2OMOA 3DRYA 2DGUA 3UR0A 4FYYB 4N77A 2ZBCA 1IQTA 4KSEB 1K44A 4PUOA 4U96A 4TY8B 4KTQA 5D6GA 2CQCA 1MMLA 1FD2A 3HHLA 2Z0GA 5K14A 1HR0J 1RACB 2WSCC 4ES3A 1YTYA 2AU0A 1B0PA 5KFSA 1X4BA 2NUUG 2HVEA 1YHQS 4ECZA 4GRSA 2WVFA 4QWDA 3DOMA 1TL4A 4X4PA 2MJUA 3MCOA 5BYQA 3RW6A 2E5HA 2VD3A 5AXLA 4UUWA 1E6VA 1P1TA 1RT1B 3IRXB 6AT1B 1BDTA 3VZIA 1NZ8A 2V8DA 4IO1A 3M7VA 6FD1A 4ECUA 1SPBP 4PRFA 2ROPA 2AJ0A 2IHR1 3GFYA 2L41A 2VBZA 4IFYB 2J6SA 1NH8A 1TKDA 1VQ7S 3FCVA 3WZ0A 2LXFA 3IM9A 1WEXA 3DLKB 2PEBA 1RBLA 2DGWA 2KH9A 2W8KA 2C3UA 1QVGR 1L3UA 4EMDA 2UVRA 4P73A 3I32A 2BJ1A 1RADB 4B3SJ 1RAAB 2KZZA 3CD7A 4RU2A 2B0GA 1ZETA 1GXUA 1R0BG 3M1VA 2FJAB 1SKWA 5U47A 2MZQA 2AJ4A 2VHGA 1VQNS 2M8DB 5HQLA 4DQSA 1BMQB 4RW6B 1GEHA 3D9BA 2YPYA 4ZVRB 2CDQA 2RSQA 1OJ4A 2DGQA 4MTPA 2KXFA 2HHHJ 4DI6A 2E44A 3I9ZA 2PA8D 3H5SA 3KDNA 4M94A 1QM9A 2BA3A 3IBCB 3H8YA 3W9JA 2CG8A 2PA3A 4CLZA 2FVRA 1EQ0A 4O4RA 4ED2A 3DYAB 3ILLA 1B99A 3NS7B 5J2NB 3CC2S 2J9DE 4HHUA 2K1RA 4A8FA 4P74A 1XMQF 1R8AA 4KH0B 1K47A 4ID5A 1UVMA 2PD1A 4GC6A 3ZNJ1
chains in the Genus database with same CATH topology
1U9PA 2JXGA 2KELA 2NZCA 2BJ9A 2CAXA 2WVFA 2CA9A 2RBFA 2Y3YA 3PHTA 1QTGA 1MYLA 1X93A 4FXEA 2CADA 1ARQA 3OD2A 1PARA 2PC6A 2WVEA 1MNTA 3QSIA 3H87C 3GXQA 2BJ3A 2K9IA 2BJ8A 3QOQA 1B01A 3LGHA 1BDTA 1BAZA 1Q5YA 2CPGA 1Q5VA 2H1OE 2BA3A 3FT7A 1NLAA 4HV0A 1IRQA 3FMTA 2K5JA 2K6LA 3VEAA 1BDVA 2WVDA 1B28A 2HZAA 2K1OA 2HZVA 2F1FA 1EA4A 2BNWA 2WVBA 3VW4A 2BNZA 2BJ7A 4D8JA 2CAJA 3VEBA 1ARRA 2K29A 1MYKA 2BSQE 2JXIA 3BKUA 1P94A 2BJ1A 2AY0A 4ME7E 3BKTA 2JXHA 3BKFA 2GPEA 2WVCA 2FGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9P A;  2JXG A;  2KEL A;  2NZC A;  2BJ9 A;  2CAX A;  2WVF A;  2CA9 A;  2RBF A;  2Y3Y A;  3PHT A;  1QTG A;  1MYL A;  1X93 A;  4FXE A;  2CAD A;  1ARQ A;  3OD2 A;  1PAR A;  2PC6 A;  2WVE A;  1MNT A;  3QSI A;  3H87 C;  3GXQ A;  2BJ3 A;  2K9I A;  2BJ8 A;  3QOQ A;  1B01 A;  3LGH A;  1BDT A;  1BAZ A;  1Q5Y A;  2CPG A;  1Q5V A;  2H1O E;  2BA3 A;  3FT7 A;  1NLA A;  4HV0 A;  1IRQ A;  3FMT A;  2K5J A;  2K6L A;  3VEA A;  1BDV A;  2WVD A;  1B28 A;  2HZA A;  2K1O A;  2HZV A;  2F1F A;  1EA4 A;  2BNW A;  2WVB A;  3VW4 A;  2BNZ A;  2BJ7 A;  4D8J A;  2CAJ A;  3VEB A;  1ARR A;  2K29 A;  1MYK A;  2BSQ E;  2JXI A;  3BKU A;  1P94 A;  2BJ1 A;  2AY0 A;  4ME7 E;  3BKT A;  2JXH A;  3BKF A;  2GPE A;  2WVC A;  2FGC A; 
#chains in the Genus database with same CATH topology
 1Q0N A;  1WOO A;  3I4P A;  4Y00 A;  1T3O A;  2J8S A;  2XNR A;  2J0S D;  2LFV A;  1P9Q C;  2I0X A;  3DOL A;  3EDR B;  3KLG B;  5LMU F;  2V50 A;  5HK4 A;  1HKA A;  3P6Y C;  3RRK A;  4Q5V A;  1TL5 A;  2AJF E;  2CFX A;  4ETX A;  1X5T A;  3OTD A;  3VQT A;  3QOQ A;  2GQC A;  1UVN A;  3LGH A;  3DM2 A;  1FVQ A;  4CT9 A;  2J0X A;  2CPG A;  4NEY A;  1S1X B;  3B4D A;  3N79 A;  4KH1 B;  1P27 B;  4WP8 A;  1S99 A;  2BUN A;  2ZKU A;  3QGG A;  2V94 A;  3AB2 B;  3NCP A;  1NSP A;  2R2R A;  4LQ3 A;  5K8O A;  2DR6 A;  1JJC B;  1U24 A;  4DV4 J;  1WDT A;  1N5Y B;  3EGN A;  4MK9 A;  1XNQ J;  4CLW A;  4NZ6 A;  4X84 A;  1X9S A;  1FJE B;  3MPW A;  5H9E K;  5JJB A;  4ZPB A;  3SSR A;  4RBT A;  1U1L A;  4ID8 A;  2BRK A;  1QSL A;  2CA9 A;  3JSR A;  4XDD A;  1K73 T;  3CIM A;  2RU9 A;  1IWA A;  2HBR B;  4UOG A;  4C7Q A;  3FBE A;  5L46 A;  5C24 B;  2NPI A;  1NK9 A;  2HND A;  2E1A A;  2WBR A;  4DCP B;  4DUY J;  4F4K A;  3MEC A;  5IM0 A;  4IG0 A;  1RWU A;  4J9U E;  2A18 A;  2XY5 A;  4LFB J;  2NXE A;  3JXO A;  2IDL A;  3UR3 C;  2Z30 B;  1RU2 A;  1HNZ F;  1HWU A;  2V4J A;  4G3I A;  1M5P C;  2CQP A;  1BWV A;  2EKY A;  1SC4 B;  5B0F A;  3P5T L;  1WC1 A;  1NJY A;  1AZS A;  2KN4 A;  1UJ5 A;  4ZVT B;  2I6W A;  1NBE B;  4PYD A;  4W4M A;  2PO4 A;  7FDR A;  3PKM A;  2EFV A;  4ZHR A;  1UVI A;  1GMW D;  4DR6 F;  2VG5 A;  3OQ2 A;  1U4B A;  1YG0 A;  2ZM6 F;  1U2R A;  1YLX A;  3EX7 B;  5J2Q A;  2VBW A;  1CLF A;  2G4B A;  2EG1 A;  1EAY C;  1Y00 A;  3M4X A;  4R8U A;  3LAL A;  2E5G A;  2ZUA A;  1NXI A;  4CCH A;  2D69 A;  1NSA A;  2YNI A;  2RRA A;  3TUZ C;  2QMX A;  3BYR A;  2YWH A;  3DLJ A;  4S0M A;  5AE3 A;  2OEM A;  1HR0 F;  5IT0 A;  1GMV A;  2R8I A;  3BN7 A;  4DQR A;  2LDY A;  3OUY A;  5IS2 A;  1VC5 A;  2WCX A;  1NK0 A;  5KFI A;  2L9D A;  3NY0 A;  3SIP B;  3NNA A;  3TUI C;  4B9M A;  3LP0 B;  2AYM A;  3M9M B;  2PSZ A;  2VZ9 A;  4QPX A;  3JQJ A;  1HFE L;  1RT3 A;  4Q8E A;  5M2R A;  2B7B B;  2NXN A;  3A3P B;  2QLW A;  3O44 A;  4OI2 A;  1QTN B;  4KPC A;  3TZW A;  1U48 A;  3EPG A;  3QT8 A;  2HHW A;  2MKK A;  3S8S A;  2KKH A;  3KK2 A;  1KQK A;  4LF9 J;  2GML A;  4I1T A;  3MCM A;  4USW A;  3QSY B;  3D0G E;  4HT5 A;  2DVI A;  3FNN A;  3OSN A;  2W4P A;  1B7Y B;  2K7K A;  2FZC B;  3F73 A;  1NPP A;  5T7L B;  4IG3 A;  4YUD A;  4ATN A;  2RML A;  3GJQ B;  2VF3 A;  3UVJ A;  2Q6C A;  1FRM A;  2HQ3 A;  2C42 A;  3CPW R;  3B8H A;  1ITP A;  2V4R A;  4PXC A;  3RGI A;  2Z58 B;  5L9N A;  2QL7 B;  4B3S F;  2XSJ B;  1J2V A;  1UL3 A;  2EEY A;  4JBC A;  5K5M A;  3ZTP A;  4ED5 A;  4LSN B;  3V81 A;  1FXR A;  5DS7 A;  4QBU A;  2B9X A;  2E9T A;  4M5L A;  3K58 A;  3OR2 A;  1UJ4 A;  3MEK A;  3CC4 S;  2CJX B;  2G2Z A;  2V2V A;  2AZ3 A;  3W2V B;  2V68 A;  3M05 A;  4A8K A;  3GV7 B;  2HQC A;  1R27 B;  3BQ0 A;  1YQH A;  5LJ3 Y;  4U9R A;  2HHH F;  3UD3 P;  2CQI A;  3RAX A;  2X51 A;  5B0A A;  4F4W A;  4DR5 J;  4JB8 B;  2V6A A;  4B9S A;  3H0P A;  3KXD A;  1WF2 A;  3MD3 A;  1NUE A;  4GKK J;  2YPZ A;  2LP4 A;  2ZDO A;  2VPW B;  3THV A;  5B7W A;  3ULH A;  1NM2 A;  2RQ4 A;  2F4V J;  3M2U B;  2E1R A;  2DNK A;  3MAA B;  1RT7 B;  2Y9H A;  4JV0 A;  2EVZ A;  3DU6 A;  3PW7 A;  4WFB Q;  2W8L A;  1R3N A;  1ARO P;  4UT4 A;  3B54 A;  5SZT A;  1FF2 A;  2DXD A;  4FYD A;  2BR0 A;  3PVX A;  1WTF A;  2WSE C;  2P2C B;  4U6P A;  5ETN A;  3R5J B;  1HWL A;  3I5C A;  2GHW A;  3MMC A;  2CPY A;  2K7J A;  4K5R A;  3BGR B;  4QIV A;  1SJ3 P;  3QLH A;  2B9W A;  4PXE A;  2PFF B;  3AD8 C;  3BKU A;  1D0E A;  2DKO B;  2P5V A;  4RNO A;  3JYT B;  3TP2 A;  3BPS P;  1AFJ A;  4HLB A;  1RT2 A;  2CPZ A;  4YDD B;  2W9A A;  1UW9 A;  3R5D A;  2C2E A;  1NLK L;  2VFU A;  3QT6 A;  4WZM A;  4WII A;  2VG6 B;  1CJU A;  1M1G A;  4DV2 J;  1T05 B;  3I87 A;  1MWY A;  3OTB A;  4J5O A;  3W8G A;  1GT8 A;  2ADC A;  2HEK A;  2KT3 A;  3OBI A;  4KB7 A;  2W2N P;  4DV4 F;  3NS6 A;  2CQ0 A;  1XNQ F;  4OX9 J;  2GZO A;  3EXC X;  4OYZ A;  3BGF A;  2FZG B;  5J2P A;  2A10 A;  1HHQ A;  4B3O B;  2VPZ B;  2ALZ A;  1S6P A;  3MED B;  1WC5 A;  4DS4 A;  3U1L A;  2MB0 B;  1H38 A;  4Q43 A;  2H65 B;  1XC9 A;  3SV3 A;  4DV3 F;  3MUV P;  3E3X A;  2AQ4 A;  3GMG A;  1B70 B;  4DL0 C;  1H72 C;  4J9L A;  2YKA A;  1LQ9 A;  4DU7 A;  5MLC V;  2RRB A;  4NAS A;  4DUY F;  4I68 A;  5LSO A;  2CPH A;  3NWR A;  4LFB F;  3GJR B;  1LWF B;  3FC9 A;  4ERD A;  1SQE A;  4J9V A;  1RCX B;  2CVE A;  4DEZ A;  4CLY A;  5LSR A;  1TTH B;  3G82 B;  3UCZ P;  4ER8 A;  3RW7 A;  4ZLN A;  4ZPC A;  4F0M A;  1JIH A;  3HZG A;  3B6B A;  4NRU A;  4LBH A;  3V6J A;  4TYB A;  1T8E A;  3HSG A;  2X1B A;  4F4Y A;  2H54 B;  3VAM A;  1H3D A;  3PX6 A;  1RKI A;  4WXO A;  2C2K B;  1IKW B;  3MOJ B;  2FLP A;  2V8H A;  1T3N A;  1EKS A;  2XMA A;  4CM2 A;  1JLF B;  2MZJ A;  2OHD A;  3R6G B;  4G6V B;  4ZMM A;  2HBZ B;  2WZ1 A;  2ZBR A;  4MH8 A;  5HAN A;  1YZ6 A;  2QA4 S;  4YHH F;  1HAR A;  5HMW A;  2HFV A;  1TV6 B;  4O23 A;  4BDP A;  1EET B;  1PC5 A;  4LQ9 A;  3AXK A;  3B78 A;  3C15 A;  2OO4 A;  2XZW A;  2R7U A;  3AB4 B;  2J0Q D;  4H4O A;  4J9Q A;  3EZ5 A;  5K9F A;  3LP1 A;  2QV6 A;  3KNG A;  4H54 A;  1PKU A;  4PAB A;  4QWB A;  2W2P P;  3CXC R;  2B5J B;  2KM8 C;  3DLB A;  3IR6 B;  3OHA A;  3UD4 P;  5KFG A;  1CQM A;  3MM6 A;  2QTW A;  2PN6 A;  2AJ2 A;  3R3T A;  2OPP B;  4BHQ A;  1YIJ S;  3LGM A;  3IS9 B;  1J5O B;  4K50 A;  4LF9 F;  3KMQ A;  2XLI A;  3FMB A;  3BO3 A;  1HNV A;  4NLV A;  5HJX A;  2BAN B;  3ADA C;  1SIW B;  4WTY A;  2ZH2 A;  1C1B B;  3CJ4 A;  4QW9 A;  4UQT A;  3T6J A;  4KKO B;  1GX5 A;  2M4M A;  3K5P A;  3G2X A;  3C3L A;  3G4S S;  2RVJ A;  1WI8 A;  3H4D A;  4CDI A;  2MZT A;  5CAA A;  2R3V A;  4M5K A;  4PG6 A;  1RLC L;  3KJN B;  5I3U A;  1Q79 A;  5F8L A;  2I2Y A;  4C98 A;  3JSM A;  4NYO A;  4KGK A;  2K29 A;  2F9D A;  2M2B A;  2MLX A;  4JI3 J;  1RTJ B;  3IGN A;  2KRR A;  2DHX A;  3KMS A;  2HGL A;  3NCQ A;  2P6S A;  4ZJL A;  1FX4 A;  3KLF A;  5D3G B;  2A6M A;  4PG4 A;  1U2F A;  5KG1 A;  5G0R A;  2HS4 A;  3IC1 A;  2F9J A;  3KG1 A;  5BXI A;  2YX4 A;  1VRU A;  3UNG C;  1WSV A;  1S57 A;  2FVC A;  2DGX A;  3QGI A;  5BYS A;  4WZQ A;  3IR7 B;  2UXC J;  3D54 A;  4A48 A;  3BM7 A;  3WBZ A;  2E1C A;  2PC6 A;  1QUP A;  4ZIW A;  4GKK F;  1XR7 A;  2V34 A;  4B3R J;  1P8G A;  1Q5V A;  3BS9 A;  1VJW A;  4P2S A;  2K8G A;  3WDO A;  5KAK A;  2F4V F;  3IM8 A;  4GVB B;  4MIA A;  4C8M A;  2QLX A;  1FE0 A;  4C0O C;  4ED6 A;  4E98 A;  2MQP A;  1RAF B;  1WEL A;  3W5X A;  1RTD B;  3ENV A;  5C25 A;  3Q2S C;  1KTQ A;  4KY3 A;  1VQL S;  5CZX A;  4K8R A;  2ZH8 A;  1D3W A;  3I0R B;  1SH3 A;  2EW9 A;  4NLO A;  3OPK A;  4X4Q A;  3MPU B;  3D66 A;  2BOP A;  1HBU A;  3PYF A;  3DDI A;  2IBO A;  4J90 A;  3WIV A;  4ZLP A;  2GVD A;  3J7Y U;  4K4V A;  5D4P A;  3QO9 B;  1MWZ A;  4G1P A;  4JP8 A;  2DNZ A;  3L3C A;  3K5L A;  1BGX T;  2RBF A;  2DNG A;  3BSA A;  4I7F B;  2KL8 A;  4B17 A;  1XQI A;  2OPR A;  2YX1 A;  4IOB A;  4W90 B;  3IG1 B;  4QYZ J;  2HFU A;  1N88 A;  3QSI A;  3I5A A;  2DHS A;  4YB1 P;  3QRQ A;  4LF7 J;  5HP1 B;  4G1Q B;  4CH7 A;  4QIF A;  2Y8W A;  2CPE A;  3KLH A;  2ZD1 B;  4YS2 A;  5GMK a;  2GW8 A;  3DDK A;  3BEG B;  4DV2 F;  1C4C A;  1RIS A;  4ZP6 A;  2QLB B;  4M5N A;  4NLS A;  3M8P B;  4ED1 A;  5DGA A;  4ZVO B;  2DH7 A;  1MU2 A;  4Z37 A;  3CJK B;  2QFJ A;  4OX9 F;  5AXK A;  5HQM A;  4P71 A;  5GAG U;  4EFA C;  4ZPV R;  4XPC A;  2WHO A;  2BSQ E;  4N8O A;  3MCN A;  3GE9 A;  2NSB A;  1IBK J;  1HMV A;  1SI9 A;  2BKP A;  1VQ8 S;  1NME B;  2AP6 A;  4HR2 A;  2G13 A;  3RJM B;  2PMZ D;  3SSS A;  3PIP Q;  2W9C B;  5K8M A;  1NKC A;  1N5T A;  2BJ9 A;  1YDL A;  2GO8 A;  2Q6B A;  3SDE B;  1BQN B;  4PCQ A;  3TVK A;  2AYB A;  4M5H A;  2XM3 A;  1MNT A;  1Z4U A;  3LP2 B;  2HHV A;  2JC0 A;  1N5Q A;  4RL1 A;  2YKO A;  2AJ1 A;  5F0U A;  3DI6 A;  2F63 A;  3SYZ A;  4YB7 A;  3IN5 A;  2XMT A;  3G6V A;  1UZD A;  1BQM A;  2ALY B;  4LF1 A;  4CNY A;  3J81 U;  4URG A;  1F1B B;  1KTV A;  2DBB A;  1YJW S;  4EZ9 A;  3EUN A;  2I5J B;  5A2Q Y;  2NCK L;  4TLR A;  2VU5 A;  4QZV B;  3CNQ P;  4IOA Q;  2QT7 A;  2Q79 A;  3OFE A;  1N56 A;  2YTC A;  4M5J A;  2UXD J;  3D68 A;  2MKS A;  5HLF B;  2KKE A;  1WHV A;  3ISZ A;  1MG7 A;  1JJ4 A;  2JX2 A;  2AZ1 A;  4UF4 A;  2QYG A;  3EGV A;  2HYI B;  1X0P A;  4JI2 J;  5GAD I;  1C0T A;  1VQM S;  3NGK A;  1VIS A;  2CZ4 A;  3DKD A;  1EJ7 L;  4MKV A;  1JLG A;  3M30 B;  1NSQ A;  4PKD B;  5A8W A;  4CNZ A;  2MKI A;  1RYR A;  1TKX B;  1FKP A;  2BQR A;  3V6H A;  3R8Y A;  2DIT A;  2AD9 A;  3Q24 A;  1O5J A;  4OHW A;  3US5 A;  1RKJ A;  2VH7 A;  3UO0 A;  4HV0 A;  2R2T A;  2R7V A;  3PYG A;  3OL9 A;  3R27 A;  5DZ6 A;  2HZV A;  4I4B A;  4ED8 A;  4CI0 B;  4OI0 A;  4DSK A;  4JI7 J;  1SV5 B;  2HRT A;  5KG3 A;  1TEL A;  4DV1 J;  4XIU A;  1WG5 A;  1YI2 S;  3CDB A;  5CH7 B;  3BO2 A;  4IYQ A;  3DXB A;  2RE1 A;  1WKJ A;  5ETK A;  3SCK E;  1VIX A;  3OHB A;  1DRZ A;  2ILY A;  3FQK A;  1L3K A;  2NXJ A;  1YJR A;  4AXI A;  4KHP J;  4LRF A;  3Q23 A;  4JI6 J;  2Q66 A;  3NNH A;  5JUM A;  3O1L A;  4KT0 C;  2YH1 A;  1X4E A;  3QAU A;  2CQH A;  2CZV C;  1LWE A;  2EC2 A;  2V9W A;  4N5S A;  3OVS A;  4JI3 F;  1NK7 A;  1RHK B;  7AT1 B;  3OFF A;  3M2V B;  2WAQ D;  2JDJ A;  2BQ3 A;  2ZC4 A;  2G2Y A;  4JI4 F;  1URR A;  1JJ2 R;  2MKH A;  3C14 A;  1HBN A;  2M88 A;  3LOU A;  4H4K C;  1R0A B;  2XB2 D;  1ZAW A;  4LRV A;  1WOR A;  3D6H B;  4LF5 J;  5J2M B;  2UXC F;  2F1F A;  5DQI A;  4ZDN A;  2DNM A;  2C22 A;  2PI4 A;  3J7Z T;  3GV8 B;  4ZIV A;  4J9M A;  4P2F A;  3V5R A;  4B3R F;  4F2S A;  2BE9 B;  2QE5 A;  4LR8 A;  2RHQ B;  1PBA A;  2CKW A;  2UUT A;  4OJ1 A;  2H1Y A;  1MMD A;  1YSJ A;  1QAX A;  5A8K B;  2D3O R;  5A8R B;  1VFJ A;  5KT3 A;  2O67 A;  3MM8 A;  2R7W A;  4YQW A;  5KFF A;  4EGL A;  5HMY A;  4YEA A;  2E29 A;  4DQQ A;  4C3M A;  2EC0 A;  9ATC B;  3RTV A;  4MT1 A;  4A8Q A;  2HSE B;  5IFM A;  2NRE A;  3G71 S;  3W2W B;  2ZJP Q;  2G0C A;  3GIM A;  5CCL A;  2R8K A;  4NXM J;  1WHX A;  4FF4 A;  1V3Z A;  1QE1 B;  4Z7C A;  3WHI A;  1OY6 A;  4UQG A;  4H4M A;  4QIW D;  1RB0 A;  1S9G B;  1WOS A;  2FJB B;  2PGC A;  1PAU B;  4OI6 A;  5D0H A;  1AT1 B;  1NH7 A;  2OD4 A;  5FDL A;  3KWM A;  4L73 A;  2HZC A;  2DGS A;  3VAH A;  1PO6 A;  2JVR A;  4OZL A;  1P9Y A;  2K06 A;  3D1O A;  3PRD A;  4QPT A;  1D9A A;  3I31 A;  4NCG A;  2CAJ A;  4LF7 F;  1WC3 A;  1ZA1 B;  1HA1 A;  2VA2 A;  1S77 D;  5D4O A;  4K4T A;  4DLG A;  4YR2 A;  2LXI A;  1C0U B;  3N01 A;  1NK4 A;  2ROG A;  1RWV B;  3FEY B;  5FLX Y;  2I1R A;  4GO7 X;  4ZCI A;  2AY0 A;  1CPZ A;  1B0T A;  4FXD A;  4N56 A;  2ZVI A;  2HK2 A;  4NI2 A;  3UQS A;  2XS5 A;  1FK9 B;  4LBP A;  3O6Q A;  5GAE U;  2Q2K A;  5KFD A;  5KOX A;  3ILJ A;  4KFB B;  1IBK F;  2ABY A;  2FY8 A;  2DR5 A;  2XGQ A;  3KUE A;  5HBM B;  2GNK A;  4NZ7 A;  2G2O A;  4OHV A;  4DLE A;  1JNR B;  3D6M B;  2L9W A;  3I82 A;  3G6X A;  2KTQ A;  2IVY A;  3FVY A;  1GQE A;  2HQG A;  2DXF A;  3K8W A;  1JLB B;  3BQ2 A;  3GG1 A;  2PI5 A;  4ZLL A;  4MKY A;  3AJ1 A;  3CUN A;  4Y2I A;  1RT1 A;  4M1K A;  3IRX A;  1BD6 A;  2KU7 A;  3AOC A;  3G8S A;  4X2B A;  1X7V A;  3I4H X;  1O0P A;  1IBM J;  1SH0 A;  4BC9 A;  4B02 A;  3RBZ A;  2KFN A;  4OZN A;  3IBW A;  2HS0 A;  2UUB J;  3UI3 A;  5F8N A;  2EPI A;  3F0N A;  4ECY A;  3DLK A;  3Q0A A;  2JHE A;  2UXD F;  4I56 A;  2MQ8 A;  4ZPA A;  2BJ8 A;  4DQI A;  3GP9 A;  2ZKT A;  3CCQ S;  2AN7 A;  4CO1 A;  4JV2 A;  3M6U A;  4JI2 F;  2C3P A;  1HD0 A;  2HWH A;  3A3N B;  4PEO A;  3MOZ A;  3A8K A;  2X3D A;  2XMK A;  2PMH A;  5H9E J;  1AYE A;  5DM7 Q;  3E01 B;  4EEY A;  4N7T A;  2P8I A;  3HMJ G;  2IRY A;  4RW6 A;  2AEJ A;  2QYC A;  2FD2 A;  3Q89 A;  4ICL B;  5ETM A;  1RLD A;  2QZ8 A;  4HT7 A;  4QOT A;  3AJ2 A;  1TR0 A;  3VV2 B;  2RDJ A;  3H5U A;  4PQU A;  3MTJ A;  5F3T A;  3BKF A;  3R5C A;  4RBV A;  4DF8 A;  4AD6 A;  4LMZ A;  2RIJ A;  4OYB A;  1DUR A;  4DSI A;  3HD2 A;  4DV1 F;  4X62 F;  3FMW A;  1X8D A;  3GWC A;  1DAX A;  1VRT B;  3DYA A;  3W60 A;  3KHG A;  4DL5 A;  2JL9 A;  1FNO A;  5J2N A;  1QSY A;  2MYF A;  4PWW A;  1FNM A;  1YVF A;  1FWL A;  2JRS A;  4ANE A;  1QAI A;  3HVT B;  4KHP F;  4CO2 A;  4JI6 F;  1WKK A;  4J9O A;  5KFE A;  3NOC A;  3MUM P;  4BLG A;  4OYO A;  3UDV A;  2W2M P;  1NK8 A;  1RAE B;  2UUA F;  2YKN B;  2W7O A;  2XMU A;  2Y0S D;  4WE1 A;  3TUJ C;  4GVL A;  3MPV A;  3PKY A;  5H9F J;  3KLG A;  1IKX B;  3GIR A;  2AWZ A;  1S49 A;  1OYE A;  4BWJ A;  5A0Y B;  4NLY A;  3TAP A;  4PWD B;  2VIH A;  1NB2 A;  1UPM B;  3CDW A;  2R7O A;  1RWK B;  2GIR A;  3NXZ A;  4QW8 A;  4U7C A;  3HK2 A;  3CO0 P;  4KPY A;  4RR5 A;  4LF5 F;  4RW4 B;  1AFI A;  1ZAV A;  4USU A;  3SCL E;  2EG2 A;  4HL9 A;  1V3R A;  2NPF A;  3KTQ A;  4AL6 A;  3C19 A;  2KM8 B;  2QMU B;  2ADB A;  1T02 A;  4XO0 A;  2VKR A;  5L1J A;  3OVA A;  2U1A A;  2H4Y B;  4DSF A;  3P49 B;  3TAM A;  2K3K A;  2XLJ A;  3SZ2 A;  4ZPD A;  2RDI A;  1GTH A;  2XBP A;  1LK5 A;  1RT4 B;  4KV8 A;  1CVJ A;  1Y9O A;  1O8B A;  5FD1 A;  1U09 A;  1HPZ B;  1YGY A;  4B9U A;  2CQB A;  5HN0 A;  1G2E A;  2OH2 A;  3FSX A;  4CH1 A;  5E7O B;  1V5V A;  1XJW B;  1WJ9 A;  1U25 A;  3QZ7 A;  4NXM F;  2VON A;  1KQF B;  2IVF B;  4ZLJ A;  1JLE B;  4USI A;  1QLN A;  4CTA B;  5C24 A;  3I0S A;  1RT6 B;  1FTR A;  3A8J A;  5B0D A;  5I3Q A;  3M8Q B;  2E5L J;  2F65 A;  4OI1 A;  2WVC A;  1NKE A;  5IQ6 A;  2K3I A;  4DFM A;  3G5O A;  1N48 A;  1Y10 A;  4EO8 A;  3CED A;  1FT8 A;  4Q7A A;  1OPI A;  3OXL A;  1CBK A;  4KJI A;  1U26 A;  1N5V A;  1MYL A;  2OEJ A;  2OSR A;  2N3L A;  4FDF A;  4UUX A;  1FRX A;  2XI3 A;  2FHJ D;  5F3Z A;  1IQZ A;  4Y2A A;  1HYS B;  5ETO A;  2GJ2 A;  3K57 A;  2G9O A;  2QRR A;  3MM7 B;  4TNO A;  2R7Q A;  1I6J A;  1CS4 A;  2W01 A;  4DPY A;  2VPX B;  2F40 A;  3EXY A;  4C8K A;  4LF2 A;  4HI1 A;  2H4W B;  4PUO B;  2E5I A;  2WRM A;  1Q78 A;  4QCL A;  5HQ8 A;  1KDN A;  4A46 A;  4DHV A;  5B0E A;  6FDR A;  4J9P A;  2HRU A;  3IR5 B;  4MIB A;  2NSC A;  3G8Q A;  3POT B;  2UP1 A;  1LK7 A;  3IWN C;  2CPJ A;  3KK3 A;  1HNI B;  3DOM B;  4FPR A;  1KVI A;  2J5A A;  5C2C A;  1XMO J;  3CDA A;  3LP0 A;  2FQQ B;  3F41 A;  1W25 A;  1T9Y A;  3NS5 A;  2VL1 A;  3RAQ A;  3M8S A;  2RH3 A;  3DMJ B;  1QDU B;  3N0V A;  1DQ8 A;  1IJE B;  1SXL A;  2PT0 A;  4DFP A;  1VOM A;  1XTZ A;  3Q8U A;  1RAI B;  1S76 D;  3M2R B;  2KOE A;  2Z56 B;  4FP9 A;  1UET A;  5CA5 A;  4F0K A;  4JV5 J;  4I0W A;  4O3N A;  5DDQ C;  1IBM F;  3QJJ A;  3T5K A;  2ZH5 A;  2B51 A;  2V63 A;  1TKZ B;  3ITH B;  1S1V B;  3W5Z A;  2UUB F;  3KJQ B;  5T7L A;  1KQS R;  1FFG B;  3V4I A;  1EA4 A;  1X4F A;  2WVB A;  4YME A;  2DIS A;  3HP6 A;  5LMN J;  2JLE A;  3UN3 A;  3A12 A;  2OPQ A;  3V4M A;  3TJ9 A;  2GJI A;  2YWF A;  1PSD A;  4DX6 A;  1MWQ A;  1JB0 C;  2YNG B;  3IWL A;  3VAK A;  3M1V B;  1PBU A;  3MF5 A;  2CQ4 A;  4O3S A;  3PW2 A;  3RBE A;  4RLE A;  2VG7 B;  2JLF A;  4KYZ A;  4LSN A;  3T1A A;  1S4F A;  2AGP A;  3VVT A;  3N6N A;  1CQN A;  4W98 A;  1ZOT A;  4OZJ A;  2W4D A;  1VC6 A;  1R6V A;  1I94 J;  4C2M A;  5KG4 A;  2NZC A;  4K4Y A;  3W2V A;  4OI4 A;  2O3D A;  3ILI A;  1ZPW X;  4FVC A;  3M32 B;  2DNO A;  3CD6 S;  2E7V A;  3K0J A;  2C3M A;  2FGO A;  2OI2 A;  4ECQ A;  3H2U B;  1SJR A;  3MR3 A;  1IBL J;  1YWX A;  2DPJ A;  4RW8 B;  3K59 A;  3PDN A;  3O3L A;  3V6D B;  3RBX A;  3CGI A;  5ITH A;  1FXL A;  3D28 A;  2HZA A;  2YXL A;  5IT4 A;  3PJX A;  3TWZ A;  2UU9 J;  3K5N A;  2FDN A;  3M2U A;  3UN2 A;  2VAS A;  3UDC A;  3MAA A;  3C2P A;  3EJM A;  3LTO A;  4AFF A;  1RT7 A;  4K4X A;  3GIJ A;  1OO0 B;  4RKU C;  4LFA J;  1Q82 T;  1VBZ A;  1HNW J;  3OT9 A;  1T9X A;  2R7R A;  1P6T A;  1X4C A;  1FEE A;  2GQ2 A;  2WSF C;  2HFZ A;  2U2F A;  1IKY B;  2NYH A;  4QIE A;  3G86 A;  1KLM A;  3DOL B;  3BDE A;  3D0H E;  3G6E S;  3NL0 A;  2ILZ A;  1M5V C;  4K4Z A;  4PG7 A;  4B9V A;  4V19 X;  1R43 A;  1FWP A;  1KSP A;  3DM2 B;  2Y3Y A;  3BGR A;  1JX4 A;  2P9E A;  3CJ3 A;  3H90 A;  4IKA A;  1RI7 A;  2HIQ A;  2VKZ G;  2LMI A;  4JV1 A;  3EPI A;  1M5K C;  3R5B A;  1AXQ A;  2GMJ A;  3JYT A;  5JXS A;  1VHF A;  2DCU B;  2KG1 A;  2G0I A;  4AE5 A;  3KUH A;  3WX8 A;  3BN4 A;  4OZ1 A;  2Y1L B;  2N4C A;  2VG6 A;  1T05 A;  3CD5 A;  2IJF A;  2GFF A;  3PX4 A;  2V5H G;  3NGR A;  4FKY A;  3CCJ S;  4I6W A;  1M5H A;  2BQU A;  1KON A;  3CCV S;  1DLO B;  4F02 A;  2AW0 A;  4C3L A;  4RW9 B;  1NND A;  4I6Y A;  1NJX A;  3WIU A;  1NKB A;  2FJD B;  3OXF A;  3AH6 A;  1KQG B;  4B3O A;  2KT2 A;  5KFA A;  3MED A;  4CLT A;  2RJZ A;  4BS2 A;  1F5A A;  5B0G A;  3KG4 A;  2E7X A;  1OY9 A;  3MMB A;  4A8X A;  1U6B A;  3D3C J;  3TZY A;  2HND B;  1D09 B;  4MAK A;  4ECT A;  3QAT A;  5KT7 A;  4IG0 B;  4FXW A;  2MJN A;  3FRY A;  3GV5 B;  1YJT A;  2PE8 A;  4QR1 A;  1UCN A;  1KN6 A;  2YKM B;  2E5L F;  1LNQ A;  3HZE A;  2HQI A;  2JJ4 D;  4DL7 A;  1N36 J;  4LF8 F;  1TAQ A;  1U0H B;  1LWF A;  2BAB A;  1HQ2 A;  4WU2 A;  3G82 A;  2HUR A;  3ZNU A;  4PPD A;  5L8R C;  2CQ2 A;  1UFW A;  1PJ5 A;  4L3K A;  2IA6 A;  5EN1 A;  2XY6 A;  3PR4 A;  2QIF A;  4C6A A;  4DX5 A;  3K5O A;  2M3D A;  3QID A;  2QLF B;  2AEF A;  1RT5 B;  4DJB A;  4OX8 A;  5EX0 A;  3JQK A;  1OSC A;  4L76 A;  3IFE A;  1NU4 A;  3HHN B;  5KFY A;  5ETP A;  2V8G A;  8ATC B;  2LQB A;  2QJ3 A;  3OVB A;  2O1P A;  3MM9 A;  1IKV B;  1CC8 A;  1HI8 A;  1F3F A;  2CQ1 A;  1DTT B;  4C48 A;  2JXH A;  1YIT S;  3MEE A;  4K0K J;  3D5M A;  2C3Y A;  1TV6 A;  3HKZ D;  2XQC A;  1EET A;  2BE2 B;  4RWW A;  4IH7 A;  2WVE A;  2ZWO A;  1MN9 A;  3LAN A;  2A0F B;  1H74 A;  2XS7 A;  4K5S A;  3U02 A;  5ADZ A;  3D0I E;  1XMO F;  1BC6 A;  4O4G A;  4UW2 A;  1TL1 B;  1S12 A;  2B5J A;  4EYH B;  3VHQ A;  2EWH A;  2NXU A;  1R8B A;  4OIX A;  3R2D J;  1LXJ A;  3KK2 B;  1Y4Z B;  1YRU A;  1Q95 G;  2DR7 A;  3FBB A;  3KK1 B;  3IS9 A;  4F2R A;  1J5O A;  4TYA A;  2B9E A;  1BUX A;  4JV5 F;  3EM1 A;  2F8M A;  2NUH A;  5F0W A;  4JYA J;  4ZCL A;  2DH9 A;  2BAN A;  1SIW A;  3VF0 B;  3QAE A;  2ATC B;  1U1P A;  4C0H A;  3FDS A;  1C1B A;  2FVQ A;  1ZPV A;  2RUS A;  1FKO B;  3BB5 A;  3PRB A;  4KKO A;  3EVM A;  5LMN F;  4LSZ B;  1U6Z A;  3ZZ0 A;  3HF5 A;  4N41 A;  4DDF A;  3J7A N;  3NMR A;  2V69 A;  2RHS B;  4JUZ A;  2LKZ A;  3RB4 A;  1NDP A;  3EZO A;  1RTJ A;  5L1L A;  4QYR A;  1RHM B;  4DR4 J;  4HTJ A;  2BW2 A;  2QMW A;  5D3G A;  1UWB B;  4R25 A;  1I94 F;  1MN7 A;  2O01 C;  4CO0 A;  4WCE Q;  2D7S A;  3GPA A;  3R2C J;  3DLG B;  1LWC A;  4WKR A;  2IM0 A;  4C3K A;  1SC1 B;  4WYL A;  2V9K A;  3JTO A;  4AXJ A;  1ELO A;  2HHQ A;  1RDR A;  1HWI A;  2A1B A;  2L9N A;  1IBL F;  3BQ1 A;  1M1H A;  2RAQ A;  1R6Y A;  2KJV A;  4OYA A;  1GXL A;  1QY7 A;  2R2U A;  3FBC A;  1DJ0 A;  4HDH A;  3ZZU A;  4ANC A;  4ME7 E;  2QG9 B;  1FRJ A;  4USJ C;  2ZHB A;  2CWK A;  5AT1 B;  2UU9 F;  4GVB A;  1WNE A;  3T5L A;  2CYY A;  4DV6 J;  2VJU A;  2V67 A;  2QLJ B;  4LFA F;  2FVP A;  4YB5 A;  5D77 A;  5DO2 A;  1HNW F;  1DY3 A;  1RTD A;  2HLU A;  1TZ0 A;  2YNH B;  3IRW P;  2AEM A;  3BGO P;  3DNC A;  1D9D A;  1PG5 B;  2OPS B;  3I0R A;  4OZ5 A;  1EP4 B;  1FO1 A;  3W1Y C;  1AUD A;  4F36 A;  3HFK A;  2AYG A;  1RK8 A;  3R1H A;  2LQ5 A;  1S9E A;  2IRU A;  1BDV A;  5M2U A;  4OQJ A;  4ZVU B;  3TAN A;  2ZZT A;  4P10 A;  1FA0 A;  2ZBQ A;  2KB2 A;  2BNZ A;  4FF1 A;  2Q1L A;  3RU0 A;  2M7S A;  3TVY A;  3IG1 A;  4DSE A;  2MKY A;  2WW8 A;  2GS8 A;  3D3B J;  2ASJ A;  1RAJ A;  2CRL A;  1IJF B;  2B8Q A;  4X4R A;  5HP1 A;  1WOP A;  1YBT A;  3DLH A;  2ZD1 A;  3C6U B;  3K8V A;  3LF0 A;  1I3O B;  3G6Y A;  1LXN A;  2BJE A;  2KG0 A;  3DRP B;  1VRQ C;  1S1T B;  1XEZ A;  1QTG A;  3CJK A;  1S6P B;  1RQ0 A;  4TN2 A;  3NNC A;  3QZ8 A;  2K9I A;  3BBF A;  3HSD A;  2CZ9 A;  4DPT A;  2B56 A;  2MQN A;  3HT3 A;  1TL3 B;  3FMT A;  1RWM B;  3G9C A;  1TVR B;  2W9C A;  5AJ3 J;  5LJ5 Y;  2F7V A;  4F25 A;  2ACM A;  3DGV A;  4JI8 J;  3SDE A;  3OLB A;  1ZAX A;  1Y7P A;  1BQN A;  1N36 F;  4E0D A;  3LP2 A;  4P9S A;  2LDI A;  1KD1 T;  3RR8 A;  3HM9 A;  3R1L A;  2XWY A;  4EZ6 A;  4FNI A;  4RPF A;  1HD1 A;  2CNO B;  1X4H A;  2IC3 B;  3FEX B;  2ZIT A;  1H2U X;  2DD8 S;  4CLS A;  2DNH A;  2ZOF A;  2FC9 A;  2AIR B;  3P8B B;  4AT1 B;  3TEG A;  2XS2 A;  1Q8L A;  4IDK A;  4O0N A;  4FKX A;  1ROF A;  3I9V 9;  4ZVP B;  4P52 A;  1CEZ A;  2VC0 A;  3U27 A;  1I5O B;  1IRQ A;  2DNN A;  2LEC A;  4DPX A;  2AT1 B;  2YWG A;  3AOB A;  5F8I A;  4LR7 A;  4CO3 A;  2KVQ E;  1Q81 T;  3BH7 B;  3M30 A;  4Q0B B;  1SQG A;  4K4W A;  4L72 B;  2KZM A;  2AGQ A;  3CMA S;  2AF6 A;  3GCW P;  2DGO A;  2HQD A;  2DTJ A;  4XAK A;  2BEF A;  3ENQ A;  3T1Y J;  2FGC A;  4MYT A;  4NXN F;  3KUG A;  3QNW B;  1HWJ A;  1GFW B;  4B08 A;  2MQO A;  1SV5 A;  2JEI A;  1KVK A;  1HNV B;  4UY8 5;  1NRK A;  1LOU A;  2ZWP A;  5L1I A;  2CUY A;  4FBT A;  1Y5L B;  2MGZ A;  4JYA F;  2EBE A;  2HFO A;  1K0T A;  2A3J A;  1RE1 B;  4RWX A;  3FRZ A;  2J7U A;  2BKN A;  2NYI A;  3A4T A;  4DQP A;  1NDL A;  2I38 A;  3MR2 A;  1VC0 A;  2B43 A;  2WVD A;  2Z57 B;  3ZZT A;  5KT5 A;  1FEH A;  4NYZ A;  4C11 B;  2WW4 A;  1SVD A;  1QAJ A;  5E41 A;  4DU8 A;  3FK4 A;  4RW7 A;  5CCM A;  4J9S A;  4DR4 F;  2W7P A;  5BYR A;  2LU1 A;  3M2V A;  1N0U A;  2A2B A;  5BJR A;  2CWX A;  3DU5 A;  3AQP A;  4M5G A;  4F7V A;  3NWG A;  4LRD A;  1TUV A;  1HQU B;  3R9L A;  2ASY A;  1R0A A;  1TK8 A;  2FHK A;  4ZVQ B;  3HUL A;  2D1C A;  4K59 A;  1NDK A;  2E66 A;  5E33 A;  5K20 B;  2OJ3 A;  2IA0 A;  1XWL A;  3VGV A;  1EIY B;  2GV1 A;  3OL7 A;  3AA9 A;  1Q53 A;  2GVZ A;  3MGJ A;  1FER A;  2KXH A;  1RTI B;  4IFV B;  4HYK A;  1TFW A;  5GMD A;  1TK0 A;  3TEH B;  3J81 Y;  5A8K A;  1F0X A;  2HHX A;  1U1K A;  4O3O A;  5A8R A;  3OTE A;  1UAW A;  4K2X A;  3DLL Q;  4IQX A;  3H40 A;  5KFP A;  5IXU A;  1CG2 A;  5C25 B;  4QWE A;  4DV6 F;  2XSF A;  4PAA A;  3I96 A;  2ZOM A;  2WON A;  3W3S A;  2HQF A;  3A3O B;  1TQL A;  2NXC A;  5IT9 Y;  4OYX A;  3W2W A;  5HAT A;  1KFS A;  2WOM A;  1T0T V;  2MDA A;  3OR1 B;  4OZ3 A;  1QE1 A;  4JI1 J;  5D4L A;  4QWC A;  1XNR J;  4C8Y A;  5I3P A;  5F41 A;  1T7P A;  3AXM A;  1F9F A;  4MKB A;  2DPI A;  1QJH A;  1LWX A;  3AJD A;  3KOA A;  4NLG A;  3D6T B;  2CPX A;  4DL6 A;  2CJB A;  1YJ7 A;  2GGP B;  1X9W A;  3HVR A;  3A8E A;  4WKY A;  1MLA A;  3HLU A;  3ZZO A;  3AAW B;  2UV8 G;  1O6X A;  1S10 A;  5FJ4 A;  1SIZ A;  1UEV A;  1Y11 A;  1JJH A;  5E3C A;  1C0U A;  3BZQ A;  4TKT A;  3THT A;  2RIL A;  1RBA A;  1B01 A;  2VBX A;  1BAZ A;  5KT6 A;  1S79 A;  2M70 A;  5GAD U;  1IR1 A;  3UFC X;  5F9N A;  3W61 A;  3LWM A;  1KLN A;  4RNM A;  1R0C B;  3VZH A;  3TZZ A;  1J27 A;  1FK9 A;  2IPO B;  1S6U A;  2D3Z A;  4WJB A;  3TAQ A;  3QPI A;  4DFK A;  4KFB A;  4DUZ J;  2X1A A;  2AHO B;  3KKF A;  1N33 J;  5ETL A;  3IWX A;  5HBM A;  2RKI A;  3NCR A;  5AJ3 F;  2B6A A;  2AMC B;  3HX9 A;  2XO7 A;  1REG X;  2XCA A;  3AHP A;  4JI8 F;  3CDU A;  1RXO B;  1T03 B;  5DLF A;  4KE5 A;  4KR0 B;  1JLB A;  1RZM A;  2OIH A;  3DI6 B;  2DNY A;  2W4C A;  2DT9 A;  3BR9 A;  3CIZ A;  3IO1 A;  2MLY A;  4C9D A;  4WP3 A;  1BQM B;  2R8G A;  3J80 Y;  3CDE A;  4FBU A;  2H1O E;  4JI5 J;  2QA1 A;  3EDQ B;  1YJU A;  3CJ0 A;  1TFY A;  1NSK L;  4FPI A;  4X64 J;  2VDI A;  3CJ5 A;  1LFP A;  3CJ2 A;  3DHW C;  1FES A;  3OLA A;  3MDF A;  1PYO B;  4RUC A;  2X1F A;  4LF6 J;  2IJR A;  2H5I B;  2XG8 A;  2ZDP A;  5KFJ A;  5HVH A;  3CJR A;  2FYX A;  4WXW A;  3RBD A;  1WUU A;  2ZVS A;  1UFK A;  5BR8 J;  1C0T B;  3CCL S;  1H6K X;  2DCL A;  3CME S;  3E51 A;  5LT5 A;  4DF4 A;  4Y6I A;  3F56 A;  4ECW A;  4O3Q A;  1VI7 A;  3OJU A;  3KYL A;  4CIO A;  3FJ2 A;  2RDD A;  4MIW A;  2ZE2 A;  2C2N A;  2FVS A;  2KFZ A;  3TA1 A;  1F9H A;  2KYX A;  1NPK A;  3NAH A;  2R7X A;  2BAC A;  4FYX B;  1T95 A;  3BBB A;  1FKP B;  1ZM9 A;  2HG4 A;  4TLQ A;  3CCE S;  2YQ1 A;  2XEX A;  2CG4 A;  1DHM A;  3ZO7 A;  4C0B A;  3SBM A;  2ACY A;  3QRR A;  4ILM A;  4URQ U;  4V19 J;  1X0F A;  2HAI A;  3GXQ A;  4ICL A;  3CT9 A;  2D41 A;  3T1Y F;  3MMJ A;  4KAI A;  3KLE B;  2DEJ A;  3T9N A;  1T9V A;  3TX0 A;  1ZZN A;  3PAC A;  4MFB A;  2NQP A;  4NRT A;  2VOD A;  2Z2Z A;  3UDL A;  1VRT A;  3VAI A;  2HIY A;  4JOU A;  3QGH A;  4NLR A;  2Z2L A;  3VAL A;  1S0V A;  2PFD A;  2OD6 A;  1MYK A;  3HSJ A;  3H42 A;  3SI8 A;  4WWS A;  4ECS A;  3HVT A;  2P9G A;  4PG5 A;  3UW1 A;  3MMA B;  3IA0 A;  1PJ6 A;  3H4B A;  2W9B B;  2MZ1 A;  4KC5 A;  1N6Q B;  3FCW A;  2PII A;  5HO4 A;  2HHU A;  1DTQ B;  4NEZ A;  2BVZ A;  4CYU B;  1T94 A;  3CC7 S;  5KOW A;  1FFW B;  1U1Q A;  4ZOS A;  3BV8 A;  5A0Y A;  2DRB A;  4PWD A;  1SKR A;  5KG0 A;  2VV5 A;  5D15 A;  4WFX A;  4Q8F A;  3PIO Q;  1N32 J;  1YJV A;  1UMJ A;  1FWK A;  4RW4 A;  5HMZ A;  1VQ6 S;  3A1Y G;  3KLI B;  2HFN A;  4LBI A;  4NZ0 A;  3D7S B;  2MKJ A;  1OQ3 A;  3ELH A;  3AY0 A;  4J91 A;  1XR5 A;  3VGU A;  4LR9 A;  1YJ9 S;  2YNF B;  4I64 A;  1VMB A;  3PW0 A;  3NRB A;  2YKP A;  3QGP A;  1VQK S;  5HAO A;  3QYY A;  2Z2M A;  1FD8 A;  4L6V 3;  4QR0 A;  4IRC A;  1GK8 A;  1EZZ B;  4RJV A;  3L7U A;  2AYE A;  1RT4 A;  4OX7 A;  2AKW B;  1HPZ A;  1F6T A;  4O3P A;  4EUV A;  1VQO S;  2W24 A;  4CM0 A;  3UNY A;  2ZH4 A;  4J7C A;  3D1Q A;  3OJS A;  1VQY A;  1JLE A;  4JI1 F;  4MYU A;  3CCW A;  1H73 A;  4CTA A;  2OFH X;  3L9Z A;  1XNR F;  1SB6 A;  2W2O P;  4B9L A;  1RT6 A;  3M8Q A;  2OEL A;  2OTJ S;  5A6W A;  2EBG A;  5DG9 A;  3OTO J;  4ILR A;  4NCG B;  1PCA A;  3JAM Y;  3HXM A;  3AT1 B;  1HHS A;  3LQV A;  4ED3 A;  4DPO A;  4TU8 A;  1B4S A;  1TKT B;  3H98 A;  2AX0 A;  2ZBI A;  3Q86 A;  4ZVF A;  4HTI A;  2R9L A;  5L38 A;  4RX6 A;  2G1H A;  1CJK B;  2UUC J;  4NX9 A;  1HYS A;  2GAH C;  5DG7 A;  3FEZ A;  2RF2 B;  3MM7 A;  4DR5 F;  2V2Q A;  2BOA A;  4YB6 A;  2MPU A;  2OUG A;  4LF4 J;  2Y0B B;  1HBO B;  3OV7 A;  5DDO C;  2PMW A;  2FHM A;  3KHH A;  2RQM A;  3FQL A;  2V8P A;  4DUZ F;  3TVZ A;  5I4M A;  3CSK A;  2BXJ A;  4F4A A;  2D9O A;  3H5Y A;  5CYQ B;  1PIL A;  2DHA A;  4ZCK A;  1UTA A;  1U49 A;  1N33 F;  3HHL C;  2E9R X;  2HNY B;  3POT A;  2C28 A;  1Q1K A;  1QUV A;  1S97 A;  1S4E A;  1VGY A;  2M8H A;  2CJA A;  1Y5I B;  3THP A;  1HNI A;  1U47 A;  3ET6 B;  1NK6 A;  5EDW A;  5HJY A;  2K1O A;  2YQ3 A;  4A8Y A;  3KJV B;  3PYE A;  3DMJ A;  2IJN A;  4N8N A;  2CDR B;  3W64 A;  2R2S A;  2R42 A;  3QIP A;  5KTQ A;  3GSD A;  3M2R A;  5KFR A;  4JI5 F;  4HI2 A;  2DR8 A;  1S1W B;  3IGV A;  3I6P A;  4X64 F;  1SJQ A;  1TKZ A;  3ITH A;  1IWG A;  3BO4 A;  4HAC B;  2BDP A;  1JWW A;  4ECR A;  4PXD A;  1IM6 A;  4ZVE A;  1S1V A;  4X4V A;  4ELU A;  5J1E B;  4LF6 F;  2VOP A;  1HHT P;  1U1R A;  4IQM A;  4N47 A;  3NGT A;  1C4A A;  3PHT A;  4ZVS B;  2DRA A;  5GAH I;  4NLQ A;  5BR8 F;  1RP5 A;  2YWW A;  4ELV A;  1NCL A;  1RA6 A;  4UOH A;  2YNG A;  5EGY A;  4QR2 A;  3MXH P;  3DRS B;  3PR5 B;  5KFQ A;  3AD7 C;  2FJE B;  2VG7 A;  3DGP A;  1UKU A;  2NZ4 A;  3QWU A;  4JI0 J;  1IR0 A;  1NJW A;  2N7Y A;  4FVM A;  3LPY A;  2BX6 A;  3MAQ A;  1Q7Y T;  5KFO A;  1SUQ B;  5RUB A;  2YWE A;  2B3T B;  4PQU B;  3EIC A;  5I42 A;  3M32 A;  3HHL D;  3DCA A;  1BE4 A;  4DFJ A;  2BM1 A;  2CVI A;  3HI9 A;  3SQG B;  3ISN C;  4I2Q A;  5KT2 A;  4P72 A;  2YVS A;  1VQ5 S;  2DB1 A;  2VFV A;  1UVL A;  2KYZ A;  3Q8S B;  4RW8 A;  1KKH A;  4DMZ A;  3PG9 A;  3V6D A;  1YRX A;  3C16 B;  2FIU A;  2IFX A;  4DR2 J;  2JEF A;  5C2G A;  1AUS L;  2KDO A;  4WU3 A;  2V8V A;  4K4U A;  2VQE J;  2JEG A;  1X93 A;  4DR3 J;  2J9D A;  4DCJ B;  3MEG A;  4Y2K A;  2W7A A;  1JLA B;  1S72 S;  2RD5 C;  5C42 B;  4WF9 Q;  5DDP C;  4J37 A;  4OLP A;  1IKY A;  4WE1 B;  4USH A;  4X4N A;  3OL6 A;  3W7B A;  1B3T A;  1F5B A;  1QVF R;  4NLP A;  4ZVG A;  3BSC A;  3P45 B;  3NAI A;  2ZH7 A;  1RCO B;  2CNN B;  5M2P A;  1BXN A;  3NKY A;  2DNR A;  2UV8 A;  5LXR A;  1LFW A;  4GKJ J;  2J7W A;  3OXG A;  1WKL A;  5IT9 U;  3H5X A;  1AA1 B;  2G0J A;  4PYA A;  4G1I A;  2JVO A;  1HW8 A;  1N32 F;  4USM A;  1S6Q B;  1RTH B;  2HW3 A;  3LPE A;  2IYI A;  4LUB A;  2HNZ B;  4TU9 A;  1S7I A;  1P1L A;  4P75 A;  2IMW P;  2APO A;  1M5O C;  4M95 A;  2C2R A;  2VQF J;  2ZJR Q;  3TAM B;  1FHT A;  5DM6 Q;  5K8P A;  4HHH A;  3ZFV A;  2I9S A;  3IAS 9;  4PR6 A;  4DG1 B;  2DNQ A;  3ISN D;  4KV8 B;  5IWA J;  5IV4 A;  1DLO A;  1CUL B;  5LM7 E;  1MRO B;  5C5J A;  3VVU A;  1IXK A;  4RW9 A;  3CO9 A;  2ZOG A;  2LU2 A;  3DC2 A;  3FT7 A;  3N4W A;  1F60 B;  4L3N A;  1FCA A;  4DV3 J;  1Q16 B;  3CW2 C;  4ALZ A;  3B82 A;  1MW7 A;  3PFE A;  5IC6 B;  1L3T A;  5K8N A;  1M1K T;  3I0S B;  3LGN A;  1F5C A;  3VW4 A;  5B08 A;  5KFW A;  4ITS A;  5E3A A;  3R7N B;  3Q8P B;  1HNX J;  2Y8Y A;  4Y2M A;  3VAG A;  1RAH B;  3GB0 A;  3SV4 A;  1CJT A;  2YKM A;  3T3F A;  2C1E B;  1BLU A;  2BZ2 A;  2IRX A;  1U0H A;  1WC4 A;  1LW0 B;  1OY8 A;  3OTO F;  2E9Z A;  3K5M A;  2FJX A;  1HL6 A;  2LEA A;  3G8T A;  3S1T A;  2J0W A;  4Q2M A;  2UVV A;  1RUS A;  1RT5 A;  5KFN A;  4H4K A;  2XTJ P;  2HWI A;  3GON A;  4XPE A;  3T1H J;  2UUC F;  3K7R A;  4AYB D;  1UVK A;  2D3U A;  4BWM A;  4OHX A;  3JB9 k;  2SXL A;  1CS4 B;  1IKV A;  5KFX A;  4WFA Q;  4KHM A;  3J80 U;  2GA7 A;  4ZJO A;  5H9F K;  4O44 B;  1DTT A;  2I8E A;  2DJW A;  4XDC A;  4YHH J;  4LF4 F;  3QT7 A;  1A9N B;  1A6L A;  2XNQ A;  2P6T A;  3M8R A;  1FRL A;  2DY1 A;  5D4N A;  1HLW A;  2MSS A;  5CYM B;  2BE2 A;  4TVA B;  4DR1 J;  3KK3 B;  4ENO A;  1AW0 A;  1NO8 A;  2DGT A;  3DN9 A;  1REV B;  3HHD A;  1IM4 A;  3NOG A;  3G96 A;  2NS1 B;  3AA8 A;  5EWE A;  3HHE A;  1R7I A;  2L08 A;  5HVG A;  4ZN3 A;  3PV8 A;  1X5O A;  1UVJ A;  3C6T B;  4YN3 B;  2MMY A;  1TL1 A;  4FZV A;  4IR1 A;  2CNK B;  2Q3P A;  4NLW A;  1N54 B;  1UP1 A;  1Y3K A;  5LSL A;  5DJB A;  2HPU A;  3NBP B;  2VOO A;  3RB0 A;  1GX6 A;  2KEL A;  4KQZ A;  3CWJ A;  2QN6 B;  1SJ4 P;  4EWT A;  2VUG A;  1B64 A;  2D74 B;  4F4Z A;  3KK1 A;  4KBI A;  1TL7 B;  4FXE A;  3GYX B;  1Q8B A;  4NCA A;  3LA0 A;  4M5D B;  1J5E J;  3KDO A;  4IRK A;  3M8Y A;  3DDN A;  4YP3 A;  5HSP A;  4X4U A;  3L95 X;  2J8A A;  1Y3J A;  3V4I B;  2DIV A;  2ZJQ Q;  2HMI A;  3AOD A;  4B9T A;  2ADL A;  2HBQ B;  2OPQ B;  1FKO A;  2XMM A;  5ETV A;  5DG8 A;  4CP5 A;  1ZYQ A;  2R7T A;  1K9M T;  1X4A A;  2MEW A;  2XZT B;  1RHJ B;  3FSY A;  1KS2 A;  1X60 A;  8RUC A;  1SQF A;  4I69 A;  4K2J A;  3FFI B;  1YBA A;  3GIK A;  1YJN S;  2XUL A;  2MTL A;  4RU9 A;  1SBR A;  4JI0 F;  1YKW A;  4EK2 A;  1UWB A;  4RO0 A;  2G1D A;  1KOH A;  3CCT A;  5HRO B;  1RGV A;  2YH0 A;  3NGU A;  3M8Z A;  3DLG A;  4A4J A;  2B8P A;  5LL6 d;  4RNF A;  4TY8 A;  1T9T A;  1VBY A;  4IH6 A;  2EK6 A;  3SSQ A;  3DHX A;  3RRH A;  5CQG A;  4C8N A;  3MM5 B;  3LAM A;  2E1M C;  4LVO P;  5B0B A;  4F8R A;  3H87 C;  4I2P B;  4XTT A;  2MXY A;  1BQX A;  5EHH A;  1S0M A;  2BKO A;  4DR2 F;  1U7L A;  5KG6 A;  2CPI A;  1HBM B;  3BBC A;  3RG6 A;  2GMH A;  2B7C B;  2KVI A;  2VQE F;  3R97 A;  2QSF A;  1WEZ A;  4KO0 B;  2HWT A;  1E6Y B;  4KGM A;  4DR3 F;  4ZA1 A;  5EWG A;  1C2P A;  2B4P A;  4EYI B;  4DL2 A;  4TQS A;  2EFQ A;  1V9O A;  3DRR B;  4IRD A;  1KLM B;  4D8J A;  3ZZP A;  2UVU A;  2YNH A;  5IC4 B;  1S1U B;  1VQS A;  1C1C B;  3FZB A;  1CJV B;  4ED7 A;  2OPS A;  3A8I A;  1EP4 A;  2ZZM A;  2RS2 A;  4IFY A;  4DZD A;  3M8W A;  4R5P B;  2O66 A;  4EO6 A;  2XWX A;  4USK A;  3BKT A;  2NR0 A;  4IR9 A;  2RRN A;  2CJ9 A;  2N4D A;  3TUP A;  1NZA A;  2MHE A;  1ZA2 B;  4F26 A;  3UWT A;  4GKJ F;  4DPW A;  1KP6 A;  1JKH B;  1R8P A;  3DLE B;  1OG7 A;  2JSX A;  3UCU P;  1JXE A;  1UA0 A;  4ECV A;  2AJQ A;  1JLQ B;  4Y2C A;  4MK8 A;  1TK5 A;  4RUA A;  2YWK A;  1UPP A;  3C66 A;  1X31 C;  1Q5Y A;  3C6U A;  4O3R A;  4P7T A;  1WG4 A;  5KFL A;  3R5A A;  2VQF F;  4F3Q A;  1OIA A;  1S0N A;  2K6L A;  3DRP A;  3JAM U;  2JC1 A;  1S1T A;  3CJS A;  4A8O A;  1DQ9 A;  1NDC A;  5IZH A;  4Q44 A;  5EWF A;  1UA1 A;  1VQP S;  3IAM 9;  5IWA F;  2IDE A;  1KC8 T;  4WP9 A;  5AXN A;  2H5J B;  4URS A;  2XHW A;  4TQR A;  4JI7 F;  1XR6 A;  4FYW B;  4K7Q A;  3KFW X;  4R0J A;  2JXI A;  4RNH A;  3MMB B;  3BYP A;  2XZD B;  1PJ7 A;  2ASL A;  2H3A A;  4NPO A;  4ELT A;  1DFD A;  3W66 A;  1TL3 A;  1XIQ A;  4KHR A;  2HGM A;  1IVZ A;  3U1M A;  1WAC A;  2HFS A;  2GJF A;  3PRV A;  1HI1 A;  2JXG A;  1TVR A;  1KBR A;  4OJH A;  4ILL A;  2Y1I A;  2CAX A;  1HNX F;  2RUG A;  2C2Z B;  3SMZ A;  1H98 A;  2C3O A;  2VFT A;  1JK9 B;  4YR0 A;  2UZA A;  1KNZ A;  4USV A;  3L7P A;  2FLN A;  4RBU A;  3H20 A;  3AQO A;  3TR5 A;  1BWE A;  2UXB J;  2HRY A;  9RUB A;  4B3T J;  1HW9 A;  1Q8I A;  2C2M B;  2K5J A;  4A8W A;  2H5E A;  2IC3 A;  3CVK A;  1HQE B;  2FHJ A;  3UD5 A;  3MM9 B;  3W9H A;  3T1H F;  1JLC B;  4ZP7 A;  2FLO A;  1S1X A;  3AFG A;  1G6B A;  2K2P A;  2VFS A;  3TQ1 A;  3MEE B;  3QWP A;  4EBD A;  3QJP A;  2DIU A;  5GME A;  5CHC B;  1FDN A;  4U7U K;  4AL5 A;  3FGV A;  2CXE A;  4A8S A;  1IBC B;  2CQD A;  3G87 A;  4YDX A;  4AUK A;  2F8H A;  4C8Z A;  2KHC A;  3R7S B;  4DR1 F;  1N5Y A;  4MKA A;  1FJ7 A;  1JXL A;  4X66 J;  4B3M J;  4ZP8 A;  2BMB A;  3ILO A;  4O4G B;  3TJA A;  3NG8 A;  4Q0B A;  3H7H B;  3QJL A;  2J6T A;  4LSL B;  3BPD A;  3HSZ A;  4RUH A;  4DV5 J;  3ICL A;  3F44 A;  1DQA A;  2H48 B;  1R31 A;  2N3O A;  1X4D A;  2F8E X;  4OLO A;  1D1U A;  1FDB A;  2IVM A;  2IAJ B;  1FRI A;  4TXS A;  2CJK A;  1SL2 A;  2MQQ A;  4YY3 J;  2VFR A;  3MUT P;  2DK2 A;  1WI6 A;  1U1O A;  4FS2 A;  1M90 T;  3IXQ A;  1J5E F;  3EVO A;  4PXB A;  2MKC A;  2XMV A;  4KGX B;  2XO6 A;  2B4V A;  1LW2 B;  5D78 A;  3HVW A;  1OMS A;  1KFD A;  3T41 A;  1Q7L B;  1V3S A;  1S0O A;  2QL9 B;  4Q2L A;  1R89 A;  2KI2 A;  4CLK A;  4NLD A;  3CMQ A;  1RWP B;  4PWU A;  2V4Q A;  2XGP A;  1VHI A;  1APS A;  1EKR A;  3DOK B;  1SC3 B;  4C11 A;  3NGS A;  5F8M A;  1S48 A;  2IMO A;  4P2M A;  1JXV A;  2JBV A;  4ZP9 A;  4JI4 J;  1ZM2 A;  4RNN A;  3PJW A;  5KFV A;  2MY8 A;  3CTR A;  1G3O A;  2F5G A;  1LWC B;  4OJ3 A;  1S9F A;  4C8O A;  2KT5 A;  2GQQ A;  3CCZ A;  4HH1 A;  3PYD A;  3CCR S;  3GFX A;  4KGZ B;  1ZS6 A;  1HQU A;  3UN5 A;  3HHL B;  1VJQ A;  4YOE A;  5K14 B;  1NLA A;  1FTC A;  4OYI A;  4OYM A;  3R7B B;  4X4O A;  1LV5 A;  1UEU A;  4CO4 A;  2QFI A;  4NE9 C;  3KNA A;  4O0I A;  5CD4 A;  2EI5 A;  1NHV A;  1YZ7 A;  2LQJ A;  4IFV A;  1ACM B;  1RTI A;  2X7I A;  1E6V B;  1OPZ A;  2PEH A;  1O51 A;  2ZBP A;  4OL8 A;  2MY7 A;  3EGW B;  3GLJ A;  4DV0 J;  5FII A;  1SJ1 A;  4OJG A;  3GYG A;  3Q22 A;  4HHJ A;  3KHR A;  1ZZF A;  2BBE A;  5HL7 Q;  2LA6 A;  3ZTO A;  4UOC A;  4ZVH A;  3TX8 A;  3MAH A;  3RB6 A;  1I51 B;  2JOQ A;  5CXT A;  3QMQ A;  2QX0 A;  4M5M A;  3PJ9 A;  3GU0 A;  2R4F A;  4QU6 A;  4F4X A;  1S9E B;  3OR1 A;  5LXY A;  1KHV A;  5J1N A;  3DRX A;  2YY3 A;  4NLU A;  1TAU A;  1ZTW A;  5KFT A;  1A7G E;  2WK4 A;  2HGN A;  2XCP A;  2B9Y A;  2KHD A;  3UPF A;  3HVA A;  3OW2 R;  2BA9 A;  2XSJ A;  2GGP A;  2LVW A;  1XK8 A;  4NLT A;  5HI7 A;  1WC0 A;  5F8G A;  2BW7 A;  1TUG B;  1N0V C;  1XBW A;  4DSL A;  3TO8 A;  2ZH3 A;  5L1K A;  4Z2X A;  3BDP A;  3OL8 A;  3KLV A;  4NA3 A;  4ZIT A;  3CD0 A;  2HS3 A;  3J7Z 5;  1PYS B;  3OSP A;  4UTG A;  5LOQ A;  1NB7 A;  1K1S A;  4X4S A;  5DET A;  1T11 A;  3L09 A;  2K1R B;  3I55 S;  2FLL A;  2QEX S;  2DNP A;  4DL4 A;  5D8H B;  4ID5 B;  1X5P A;  3CCU S;  2AV5 A;  3GII A;  1UZH A;  3KG0 A;  3PFO A;  4HH0 A;  4M63 A;  3T5J A;  1U8W A;  5DQH A;  1VQ4 S;  4CLL A;  2PDA A;  4TU7 A;  4NML A;  1T03 A;  1JQG A;  1G4C A;  3NP5 A;  1VBK A;  1IUJ A;  2GCF A;  2UXB F;  4CLU A;  3TW0 A;  1WWH A;  1HIY A;  3CJ8 A;  1RYS A;  2ASD A;  4B3T F;  4QU7 A;  3VWS A;  1OHN A;  4Z7Y A;  3PO5 A;  1FNX H;  2WTF A;  4GC7 A;  2OKQ A;  3SXL A;  3W65 A;  4MJK A;  2IIH A;  5KG7 A;  3UDE A;  4IDK B;  2ZFH A;  4EI2 A;  2V2K A;  5CD4 H;  2OEK A;  1NHU A;  3NO7 A;  2HVI A;  3LUY A;  4F0H A;  3CF5 Q;  2WB4 A;  4NA1 A;  1S5Z A;  4OFZ A;  1SL1 A;  3K17 A;  4DV7 J;  2LEP A;  2EFG A;  3AD9 C;  3X3U A;  3HFZ B;  2NLW A;  4E8U A;  2DHH A;  5E0O A;  2V2Z A;  3HKW A;  1SKU B;  3JSY A;  4KIA A;  2M5Y A;  4I67 A;  3ENW A;  5KFB A;  1RHR B;  3CJQ A;  4FXV A;  4HVZ A;  4X66 F;  4B3M F;  1UEK A;  5IV3 A;  4X65 J;  4ZKA A;  2LYV A;  1UWA A;  5F8H A;  3JQM A;  4DV5 F;  2XYP B;  4D3H A;  1RAG B;  1N34 J;  2RQC A;  2BRL A;  3IBF B;  1X4G A;  5AXM A;  2OP5 A;  3M6X A;  2FY1 A;  1PGZ A;  1OQ6 A;  2VBY A;  3S6E A;  2FZK B;  4M5I A;  3LAK A;  3ZZR A;  4YY3 F;  3KLE A;  3MEC B;  3KJF B;  5IM0 B;  1MSW D;  1ICE B;  4X62 J;  3NGD A;  1D9F A;  3EZU A;  1YRT A;  3QRP A;  1U2C A;  3O5T B;  4KRW A;  2MGZ B;  1PAE X;  1MMN A;  2V4J B;  4Y3C A;  4CZC A;  2QO3 A;  1H2V Z;  1A0O B;  1F3V A;  2DGV A;  2RQK A;  5ETQ A;  3GYN A;  4DBQ A;  3HT0 A;  2ZEJ A;  3MWB A;  5AE2 A;  2DO4 A;  1OSD A;  1AZS B;  3W8P A;  4YR3 A;  2EFO A;  5DQG A;  4MJW A;  4FF3 A;  4ZCM A;  3P4U B;  1VQ9 S;  2DH8 A;  1L3V A;  3MR7 A;  3MMA A;  2W9B A;  1N52 B;  3E2E A;  2JEJ A;  2UUA J;  4ZHR B;  5E3R A;  1N6Q A;  3ZXW A;  2VG5 B;  4RW7 B;  3L4B C;  2V0N A;  1U1M A;  5J2Q B;  2DYA A;  1DTQ A;  3K2Y A;  1IKW A;  4CYU A;  5B09 A;  4R8U B;  2J6U A;  2RS8 A;  5T41 A;  1JLF A;  1RWO B;  2RT3 A;  5KFK A;  2YNI B;  2YQ0 A;  5B0C A;  1KRP A;  2X3G A;  3HD1 A;  1H7W A;  2MST A;  2OML A;  4GO5 X;  2R7S A;  3OUY B;  4U7U D;  2KXN B;  4W92 B;  2GVZ B;  4LVN P;  3KLI A;  3PEJ A;  4HEA 9;  4GMK A;  1ZBT A;  4DCO B;  3FBF A;  2W1B A;  1RT3 B;  1S59 A;  3FSI A;  2YNF A;  1QSS A;  4ED0 A;  2IM2 A;  4PQA A;  2CAD A;  2WB1 D;  2ZUG A;  1VCT A;  3BJY A;  3LJP A;  1FDD A;  5A6P A;  2C2D A;  4DV0 F;  4L75 A;  2OPP A;  2WON B;  3HPO A;  5HVF A;  1YBU A;  3N28 A;  2A2C A;  1WEY A;  4DL3 A;  2EK1 A;  1F2G A;  1VK3 A;  2EFN A;  2WOM B;  3FKB A;  3MPD A;  3L7O A;  4FYV B;  1WSR A;  3EMT A;  4IG3 B;  3SCJ E;  2GIQ A;  3A13 A;  3Q8Q B;  4F3O A;  3JSB A;  4ETZ A;  3UVJ B;  3VR1 A;  4DR7 J;  4NWB A;  1R8H A;  3PW5 A;  1W7W A;  2LLZ A;  5KFU A;  1X5S A;  1D8Z A;  5CZV A;  2GO9 A;  3RR7 A;  3PTW A;  4NOH A;  4LRE A;  4PG8 A;  4DN0 A;  1RBO B;  3PEH A;  3V81 B;  3GJT B;  3PCO B;  2JH3 A;  1VYA A;  3MUR P;  5J1P A;  4OZ0 A;  3OR2 B;  1FRK A;  3M9N B;  3ONQ A;  1TMJ A;  2YX7 A;  1X9M A;  3UE2 A;  2C2O B;  1TKT A;  1YX2 A;  2JZ5 A;  1U45 A;  3GSI A;  4AL7 A;  2Z2Y B;  4HDG A;  1PAR A;  3O8W A;  5G4D A;  1VIO A;  3OFH A;  3TRG A;  1CJK A;  3MFH A;  5KT4 A;  3I5B A;  2MQL A;  3EGZ A;  1WD6 A;  3H59 A;  3IR7 A;  2RF2 A;  1N4L A;  4YFU A;  3ZC4 A;  1Y5N B;  4HKQ A;  1EAR A;  1UFL A;  3OTC A;  1FVS A;  2KO1 A;  7FD1 A;  1U6F A;  1HBO A;  3CJT A;  8AT1 B;  2M52 A;  4WK1 A;  1N8R T;  2BNW A;  3P5B P;  1H2T Z;  2RKI B;  1FXD A;  5CYQ A;  2N7C A;  3D1H A;  1OWX A;  3GJS B;  2B6A B;  3V6K A;  1QD1 A;  2JLG A;  5GVQ A;  3BRE A;  1WF1 A;  2HNY A;  3SCI E;  1NAQ A;  2MQM A;  4C4W A;  1AB8 A;  2FPH X;  3LH2 S;  3JTP A;  2VPY B;  3N6M A;  3ET6 A;  4DZ6 A;  4LFC J;  1F9E B;  5CYJ A;  3KJV A;  3ETO A;  5EX3 A;  3MMC B;  3GTY X;  2LQ8 A;  3QLH B;  2XC9 A;  2JFK A;  5IOL A;  4U8Y A;  3QO9 A;  1ARQ A;  3TQE A;  2FB0 A;  3PX0 A;  4ED4 A;  5KG5 A;  4BCA A;  3MCS A;  4QIG A;  2A6O A;  3NEK A;  2HHT A;  3DXS X;  1S1W A;  3U7J A;  2HKE A;  1WHY A;  2H51 B;  4I7F A;  2O5D A;  1RT2 B;  4HAC A;  5KG2 A;  5DGB A;  1SKS A;  3T9Z A;  4WPA A;  5J1E A;  3PM9 A;  3CCS S;  4DV7 F;  1ZM4 A;  2DR9 A;  4G1Q A;  1CJU B;  3H2L A;  1EX8 A;  4DS5 A;  3MTK A;  1RAO A;  1Q8K A;  2FJW A;  2ZE2 B;  2GX8 A;  3PHE A;  2MZR A;  4KGV B;  4AQY J;  3DRS A;  3M8P A;  4LIW A;  5J2P B;  2ZNY A;  3BGU A;  4XK8 C;  3R6L B;  3JS9 A;  3W63 A;  3EYZ A;  1GTE A;  4X65 F;  2RU3 A;  2CJY B;  1JMT A;  4WFN Q;  3TA2 A;  4QJV A;  1FX2 A;  2F3J A;  1Q86 T;  2XYH B;  2XMW A;  1SUQ A;  1FKA F;  2J7K A;  1N34 F;  2OFG X;  4IOC Q;  4DSJ A;  3TA0 A;  3BSO A;  1U0S A;  4Y65 A;  4Q45 A;  2CQG A;  4UZC A;  4MFB B;  4CLF A;  2LQ9 A;  1GNK A;  3SQG A;  1S7H A;  1FE4 A;  3QFH A;  3RB3 A;  2Z4P A;  3MFI A;  1NJZ A;  4FNH A;  2GC8 A;  2DO0 A;  2IY5 B;  2VC1 A;  3W62 A;  3VAF A;  3C16 A;  2B4U A;  2DXE A;  2WBM A;  4IUF A;  1SL0 A;  4G65 A;  4U8V A;  3D6F B;  1UW4 A;  3J7Y I;  1DZ5 A;  5KFZ A;  5HMX A;  2IM1 A;  3MD1 A;  3X1L B;  3E8O A;  3PW4 A;  2HAF A;  1JLA A;  3RYL A;  3PO4 A;  1TU0 B;  5C42 A;  3Q2T C;  1PYT A;  3FCH A;  1GMW A;  2ZZN A;  4LJM A;  3D67 A;  3RRG A;  3VTI A;  2ZH9 A;  4FN5 A;  3KHL A;  1NEE A;  2I5J A;  4NMX A;  2IYG A;  3RZA A;  3N5F A;  2RNE A;  4X4T A;  1Q4R A;  4UST A;  2P9C A;  4TY9 A;  1K0V A;  5ETT A;  3DFE A;  3GFZ A;  5HLF A;  1YK9 A;  1VLO A;  4K0K F;  3UCG A;  5KFH A;  1TUW A;  1XER A;  5KFM A;  4DXL A;  4F04 B;  1IR2 A;  2EKN A;  3C15 B;  4H4O B;  2BE7 D;  1S6Q A;  1RTH A;  2HNZ A;  1U1N A;  2HHS A;  3LP1 B;  3IP0 A;  2MZS A;  4QWA A;  5D0G A;  5GAG I;  4ECX A;  3T5H A;  3VEA A;  1TKX A;  2J9E A;  3EE3 A;  1R8C A;  1RTZ A;  3TI0 A;  2AGO A;  3MM6 B;  3VAJ A;  4EU0 A;  3Q8Y A;  2QA2 A;  3VCD A;  5ETR A;  2LA4 A;  1VBX A;  1RSC A;  4CT8 A;  4LT6 A;  4DG1 A;  1S6O A;  2DY9 A;  2A2D A;  2UVW A;  3BR8 A;  4MK7 A;  2HBY B;  1CUL A;  1N5S A;  1MRO A;  1Y0H A;  2CPD A;  2EFP A;  5AE1 A;  1V5I B;  3HJV A;  1OS5 A;  1WG1 A;  1W2I A;  2GPE A;  2DHG A;  1Q16 A;  4WIQ A;  1RA7 A;  4J9K A;  2B4O A;  2JWN A;  3WQP A;  3LW5 C;  4DR7 F;  4P7V A;  3ZTR A;  3M6V A;  3GFH A;  4DWI A;  4OX6 A;  4J9R A;  3QQC D;  4LF8 J;  2X1G A;  5I3U B;  4P6Q A;  4K4S A;  2CIM A;  3R5G A;  3JSM B;  3SFU A;  1LW0 A;  1JNZ B;  1VK8 A;  3WC0 A;  3T19 A;  3U1N A;  4ZPW R;  2R8J A;  4WYW A;  4OV6 A;  3ENA A;  1PC4 A;  4B9N A;  3KLF B;  3SQO P;  2GAG C;  3NLC A;  1ULR A;  2IM3 A;  4ES1 A;  5IQQ A;  1H7X A;  5G0R B;  1CC7 A;  4U67 Q;  4WK3 A;  5D0E A;  5GAH U;  1PIE A;  4EBE A;  4NLX A;  1FRH A;  2E5J A;  4NYP A;  5E2Q A;  4NCB A;  3BGL A;  1VRU B;  3N9U C;  3CCM S;  4WTO B;  2Y1J A;  4Y28 C;  1U8S A;  1B7F A;  2ZH1 A;  3VGT A;  3N5B A;  2DEI A;  5J2M A;  1SH2 A;  4CH0 S;  1G1X A;  2BJD A;  1ZTT A;  2JNJ A;  2VA3 A;  4O44 A;  3NMA A;  3Q8R B;  1W26 A;  2W2Q P;  1HI0 P;  1Z2L A;  5A2Q U;  1EQM A;  2ERR A;  5JVH Q;  1LKZ A;  3PNI A;  2LXU A;  3PZP A;  3HFV A;  5CYM A;  4DX7 A;  4WFY A;  1I1G A;  4OHY A;  2D3O 1;  1REV A;  4CWB A;  2QSW A;  5ETS A;  1MNE A;  4RUB A;  3VGS A;  5A76 A;  2COL A;  3GR1 A;  3JTN A;  1KOO A;  4R0E A;  4F50 A;  2MLZ A;  1FJG J;  3C6T A;  3MR5 A;  2CNL B;  1HBU B;  5JVG Q;  2HVH A;  4LFC F;  1RU1 A;  2GVD B;  3ZTS A;  3NBP A;  2YKQ A;  3QIP B;  5L39 A;  1B28 A;  2FUG 9;  3RUB L;  3ZZZ A;  1ZH5 A;  3S01 A;  4RZR A;  3SEO A;  5D0R A;  1BHN A;  1GXT A;  1S9G A;  1GH8 A;  2E1P A;  3HO1 A;  2OGU A;  1TL7 A;  2HK3 A;  4M5D A;  2EXU A;  3VEB A;  2OPR B;  4AND A;  3P3D A;  3M6W A;  3P96 A;  3TYT A;  4LRA A;  1SCJ B;  1GMU A;  3EWG A;  3MI7 X;  3KLH B;  4OMF G;  5CAB A;  4DX8 H;  3GQC A;  3M9O B;  3H25 A;  3WC2 A;  2Y1R I;  2POK A;  2BYC A;  3C8Y A;  3BH6 B;  1BY9 A;  2OAU A;  1IN0 A;  2M0G B;  1NK5 A;  4BC7 A;  3DGP B;  2VDH A;  3C46 A;  1MU2 B;  4AQY F;  3HCX A;  4CQ1 A;  2BM0 A;  1SJF A;  3FFI A;  2DNL A;  3BSN A;  4ZJQ A;  1V6H A;  4M8L A;  4IH5 A;  1NHK L;  1M0S A;  4PZV A;  3W9I A;  2FHO B;  1VS3 A;  2LCW A;  1Z1Z A;  2BV3 A;  4UOF A;  1HMV B;  1EB0 A;  5I42 B;  2HHP A;  1XMB A;  5HRO A;  2FTR A;  3HHK A;  5T14 A;  4DPU A;  2M9K A;  4I2Q B;  2OSQ A;  3ZZY A;  5H1S V;  1OYD A;  4FS1 A;  3MM5 A;  2CQ3 A;  3TAR A;  4WFZ A;  2CJQ A;  1ARR A;  1KR4 A;  3D4J A;  2XY7 A;  1URN A;  3H2V E;  1WC6 A;  4PPZ A;  4UY8 T;  4I2P A;  4C97 A;  5THW A;  3J81 j;  1P94 A;  4OYW A;  5MAO A;  1HBM A;  5DZ7 A;  3MEG B;  4ZPT R;  2DRD A;  5DDR C;  2MHN A;  4KO0 A;  1E6Y A;  5JMN A;  4LRC A;  2QA4 G;  2Q43 A;  3HJF A;  3FZ2 A;  3MZI A;  4U95 A;  3DRR A;  3B4M A;  1S1U A;  1C1C A;  4NA2 A;  2HVZ A;  4E2F B;  3OD2 A;  1CJV A;  2XI2 A;  4DOZ A;  4IO9 Q;  4R5P A;  2ROE A;  5EUH A;  2R8H A;  2KJW A;  1RAB B;  4QQB A;  4Y0F A;  4OI3 A;  1NJI T;  4MMO A;  2OLW A;  1JKH A;  4OV1 A;  4F3M A;  1DBD A;  3K89 A;  3DLE A;  3VQS A;  4OHZ A;  4DN9 A;  1FI4 A;  4CRJ A;  1DAR A;  3GIL A;  2XHC A;  1LEO A;  4QYZ K;  1JLG B;  3HDS A;  4D3G A;  1JLQ A;  3MHY A;  3LO3 A;  5A8W B;  2W25 A;  5GAE I;  3E01 A;  3QFW A;  4OZ2 A;  4C8L A;  4J9N A;  3GR0 A;  5KFC A;  2YBV A;  2ATL A;  3TOQ A;  1KWM A;  1RJJ A;  1U9P A;  4ES2 A;  3CE8 A;  5DLG A;  2D9P A;  3TNV A;  4ZK7 M;  2XYG B;  1CSJ A;  3TZX A;  5FLX U;  2ZHO A;  1G7C B;  3ZTQ A;  3WX4 A;  3J7A 1;  4F67 A;  1RHU B;  3Q83 A;  1RWW B;  3BF4 A;  4A47 A;  3GCX P;  1WDD A;  5F8J A;  4AAI A;  2BJ3 A;  3S7R A;  2QC3 A;  3I56 S;  1WHW A;  2QGF B;  1XMQ J;  1TMM A;  3Q8V A;  3ETM A;  1TP7 A;  1XN9 A;  1RHQ B;  2HLT A;  1CJT B;  3CUL A;  2F4F A;  1B0V A;  4UZB A;  2ZNZ A;  1LWE B;  1HWK A;  4NL5 A;  2FJV A;  3GG0 A;  1VR6 A;  2H9Z A;  5E5N A;  2J9C A;  4P2X A;  2YKN A;  5LMU J;  5E3Q A;  1UJ6 A;  2FC8 A;  1ZM3 A;  1FFS B;  2H3E B;  2L48 A;  2XLK A;  1RWX B;  1IKX A;  3C14 B;  1HBN B;  2J76 E;  4ZS6 A;  1WTB A;  1K1Q A;  1HQE A;  3N6L A;  1L5U A;  3D2W A;  1T9U A;  1JLC A;  5DRK A;  2GIF A;  1KEK A;  4V1A k;  1K8A T;  1WF0 A;  2GHP A;  3PY8 A;  5SUH A;  3NNE A;  2VB6 A;  3QT5 A;  2N82 B;  3RAM A;  3OFG A;  2LEB A;  1H0H B;  4CO5 A;  3GZ7 A;  3TJ8 A;  3EVW A;  3MM8 B;  1QTM A;  2JFD A;  2E7W A;  3MPY A;  4FF2 A;  2VJV A;  4EBC A;  4Y34 A;  1NPR A;  3CB4 A;  3PXG a;  3SFG A;  2OTL S;  4LIR A;  1FJC A;  3AOA A;  3FUY A;  4L74 A;  5E3P A;  4I6A A;  2BJ7 A;  2IBK A;  4ZN1 A;  4LSL A;  1GAO A;  4A8M P;  1M5S A;  1VLY A;  1FJG F;  4CLP A;  3W5Y A;  1Z2Z A;  2AX1 A;  1KVJ A;  4NXN J;  3V2U C;  2ZC3 A;  4H4M B;  2IAJ A;  5L9X A;  3MR6 A;  1RWN B;  1EHW A;  3QBC A;  2HVD A;  1T9W A;  1VDH A;  3LWL A;  5FDL B;  4OYP A;  3O2I A;  1D8Y A;  1SC6 A;  2VIC A;  4WBF A;  2ZHA A;  2UUW A;  1FDA A;  3IMQ J;  2QL5 B;  2KFY A;  1HNZ J;  1U02 A;  2XMJ A;  5C7P A;  2HMI B;  4BBY A;  2KRB A;  4LRB A;  2CPF A;  1KHW A;  1LW2 A;  2ZH6 A;  4DUT A;  1QAY A;  2GHV C;  3T6B A;  4N76 A;  2RB7 A;  1W2B R;  1F2H A;  2Z8Q A;  2L3M A;  4DR6 J;  3DOK A;  1L3S A;  2ZM6 J;  4NI2 B;  5F9L A;  2OMO A;  3DRY A;  2DGU A;  3UR0 A;  4FYY B;  4N77 A;  2ZBC A;  1IQT A;  4KSE B;  1K44 A;  4PUO A;  4U96 A;  4TY8 B;  4KTQ A;  5D6G A;  2CQC A;  1MML A;  1FD2 A;  3HHL A;  2Z0G A;  5K14 A;  1HR0 J;  1RAC B;  2WSC C;  4ES3 A;  1YTY A;  2AU0 A;  1B0P A;  5KFS A;  1X4B A;  2NUU G;  2HVE A;  1YHQ S;  4ECZ A;  4GRS A;  2WVF A;  4QWD A;  3DOM A;  1TL4 A;  4X4P A;  2MJU A;  3MCO A;  5BYQ A;  3RW6 A;  2E5H A;  2VD3 A;  5AXL A;  4UUW A;  1E6V A;  1P1T A;  1RT1 B;  3IRX B;  6AT1 B;  1BDT A;  3VZI A;  1NZ8 A;  2V8D A;  4IO1 A;  3M7V A;  6FD1 A;  4ECU A;  1SPB P;  4PRF A;  2ROP A;  2AJ0 A;  2IHR 1;  3GFY A;  2L41 A;  2VBZ A;  4IFY B;  2J6S A;  1NH8 A;  1TKD A;  1VQ7 S;  3FCV A;  3WZ0 A;  2LXF A;  3IM9 A;  1WEX A;  3DLK B;  2PEB A;  1RBL A;  2DGW A;  2KH9 A;  2W8K A;  2C3U A;  1QVG R;  1L3U A;  4EMD A;  2UVR A;  4P73 A;  3I32 A;  2BJ1 A;  1RAD B;  4B3S J;  1RAA B;  2KZZ A;  3CD7 A;  4RU2 A;  2B0G A;  1ZET A;  1GXU A;  1R0B G;  3M1V A;  2FJA B;  1SKW A;  5U47 A;  2MZQ A;  2AJ4 A;  2VHG A;  1VQN S;  2M8D B;  5HQL A;  4DQS A;  1BMQ B;  4RW6 B;  1GEH A;  3D9B A;  2YPY A;  4ZVR B;  2CDQ A;  2RSQ A;  1OJ4 A;  2DGQ A;  4MTP A;  2KXF A;  2HHH J;  4DI6 A;  2E44 A;  3I9Z A;  2PA8 D;  3H5S A;  3KDN A;  4M94 A;  1QM9 A;  2BA3 A;  3IBC B;  3H8Y A;  3W9J A;  2CG8 A;  2PA3 A;  4CLZ A;  2FVR A;  1EQ0 A;  4O4R A;  4ED2 A;  3DYA B;  3ILL A;  1B99 A;  3NS7 B;  5J2N B;  3CC2 S;  2J9D E;  4HHU A;  2K1R A;  4A8F A;  4P74 A;  1XMQ F;  1R8A A;  4KH0 B;  1K47 A;  4ID5 A;  1UVM A;  2PD1 A;  4GC6 A;  3ZNJ 1; 
#chains in the Genus database with same CATH homology
 1U9P A;  2JXG A;  2KEL A;  2NZC A;  2BJ9 A;  2CAX A;  2WVF A;  2CA9 A;  2RBF A;  2Y3Y A;  3PHT A;  1QTG A;  1MYL A;  1X93 A;  4FXE A;  2CAD A;  1ARQ A;  3OD2 A;  1PAR A;  2PC6 A;  2WVE A;  1MNT A;  3QSI A;  3H87 C;  3GXQ A;  2BJ3 A;  2K9I A;  2BJ8 A;  3QOQ A;  1B01 A;  3LGH A;  1BDT A;  1BAZ A;  1Q5Y A;  2CPG A;  1Q5V A;  2H1O E;  2BA3 A;  3FT7 A;  1NLA A;  4HV0 A;  1IRQ A;  3FMT A;  2K5J A;  2K6L A;  3VEA A;  1BDV A;  2WVD A;  1B28 A;  2HZA A;  2K1O A;  2HZV A;  2F1F A;  1EA4 A;  2BNW A;  2WVB A;  3VW4 A;  2BNZ A;  2BJ7 A;  4D8J A;  2CAJ A;  3VEB A;  1ARR A;  2K29 A;  1MYK A;  2BSQ E;  2JXI A;  3BKU A;  1P94 A;  2BJ1 A;  2AY0 A;  4ME7 E;  3BKT A;  2JXH A;  3BKF A;  2GPE A;  2WVC A;  2FGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...