2K6LA

The solution structure of xacb0070 from xanthonomas axonopodis pv citri reveals this new protein is a member of the rhh family of transcriptional repressors
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYLFERAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure reveals that XACb0070 from the plant pathogen Xanthomonas citri belongs to the RHH superfamily of bacterial DNA-binding proteins
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 13
structure length 51
sequence length 51
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2k6lA00
2HZAA 2CA9A 2K5JA 2BJ1A 1B28A 3GXQA 2BJ9A 2WVDA 2WVEA 4ME7E 3VEBA 2CPGA 1MYKA 2CAJA 2BSQE 2WVCA 2WVFA 3OD2A 1PARA 2BNWA 3FT7A 2KELA 1B01A 2H1OE 2K6LA 1IRQA 1NLAA 1X93A 2CADA 2WVBA 3VEAA 1EA4A 2CAXA 3H87C 4HV0A 2HZVA 2BNZA 1MNTA 2JXHA 2JXIA 1BDVA 2RBFA 2K9IA 1U9PA 2AY0A 1Q5VA 2BA3A 2BJ7A 3FMTA 2GPEA 1QTGA 2JXGA 1BAZA 1ARQA 1MYLA 1P94A 2K1OA 2K29A 3VW4A 2BJ3A 2BJ8A 3LGHA 4FXEA 1ARRA 1BDTA 4D8JA 3QOQA
chains in the Genus database with same CATH superfamily
4LQ3A 2A2BA 2K5JA 2KOEA 2BJ9A 2WVEA 4ME7E 2BSQE 1OHNA 3QIDA 1Q16A 3FT7A 4QPXA 2JXHA 3NAIA 3SFGA 4AAIA 2RBFA 2B43A 1ARQA 3NAHA 3VW4A 2BJ8A 3SFUA 2Q2KA 4LQ9A 4LRVA 1ARRA 1BDTA 4D8JA 3LJPA 3VEBA 2WVDA 4NRUA 2WVFA 1B01A 2UUTA 2H1OE 2K6LA 1IRQA 2CADA 3H87C 4HV0A 2JXIA 1SH2A 1Q5VA 2BA3A 3BSNA 1QTGA 2K1OA 1P94A 2BJ3A 3LGHA 3UPFA 2H3AA 2HZAA 2JBVA 1B28A 4O4RA 3UQSA 1MYKA 2CAJA 2WVCA 4MJWA 2KKEA 1PARA 3H5XA 2BNWA 1X93A 1NLAA 2CAXA 2WVBA 2HZVA 1MNTA 1BDVA 2K9IA 1U9PA 2AY0A 2ADLA 3NO7A 2BJ7A 3FMTA 2JXGA 2UUWA 3H5YA 1SH0A 2AN7A 3QOQA 3UR0A 2WK4A 2CA9A 2BJ1A 3GXQA 2CPGA 3G5OA 3BSOA 3OD2A 2KELA 3VEAA 1EA4A 1SH3A 2BNZA 2CKWA 2GPEA 1SIWA 1BAZA 1MYLA 2K29A 4NRTA 1OG7A 4FXEA 3IR7A 3NNEA
chains in the Genus database with same CATH topology
2HZAA 2CA9A 2K5JA 2BJ1A 1B28A 3GXQA 2BJ9A 2WVDA 2WVEA 4ME7E 3VEBA 2CPGA 1MYKA 2CAJA 2BSQE 2WVCA 2WVFA 3OD2A 1PARA 2BNWA 3FT7A 2KELA 1B01A 2H1OE 2K6LA 1IRQA 1NLAA 1X93A 2CADA 2WVBA 3VEAA 1EA4A 2CAXA 3H87C 4HV0A 2HZVA 2BNZA 1MNTA 2JXHA 2JXIA 1BDVA 2RBFA 2K9IA 1U9PA 2AY0A 1Q5VA 2BA3A 2BJ7A 3FMTA 2GPEA 1QTGA 2JXGA 1BAZA 1ARQA 1MYLA 1P94A 2K1OA 2K29A 3VW4A 2BJ3A 2BJ8A 3LGHA 4FXEA 1ARRA 1BDTA 4D8JA 3QOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZA A;  2CA9 A;  2K5J A;  2BJ1 A;  1B28 A;  3GXQ A;  2BJ9 A;  2WVD A;  2WVE A;  4ME7 E;  3VEB A;  2CPG A;  1MYK A;  2CAJ A;  2BSQ E;  2WVC A;  2WVF A;  3OD2 A;  1PAR A;  2BNW A;  3FT7 A;  2KEL A;  1B01 A;  2H1O E;  2K6L A;  1IRQ A;  1NLA A;  1X93 A;  2CAD A;  2WVB A;  3VEA A;  1EA4 A;  2CAX A;  3H87 C;  4HV0 A;  2HZV A;  2BNZ A;  1MNT A;  2JXH A;  2JXI A;  1BDV A;  2RBF A;  2K9I A;  1U9P A;  2AY0 A;  1Q5V A;  2BA3 A;  2BJ7 A;  3FMT A;  2GPE A;  1QTG A;  2JXG A;  1BAZ A;  1ARQ A;  1MYL A;  1P94 A;  2K1O A;  2K29 A;  3VW4 A;  2BJ3 A;  2BJ8 A;  3LGH A;  4FXE A;  1ARR A;  1BDT A;  4D8J A;  3QOQ A; 
#chains in the Genus database with same CATH topology
 4LQ3 A;  2A2B A;  2K5J A;  2KOE A;  2BJ9 A;  2WVE A;  4ME7 E;  2BSQ E;  1OHN A;  3QID A;  1Q16 A;  3FT7 A;  4QPX A;  2JXH A;  3NAI A;  3SFG A;  4AAI A;  2RBF A;  2B43 A;  1ARQ A;  3NAH A;  3VW4 A;  2BJ8 A;  3SFU A;  2Q2K A;  4LQ9 A;  4LRV A;  1ARR A;  1BDT A;  4D8J A;  3LJP A;  3VEB A;  2WVD A;  4NRU A;  2WVF A;  1B01 A;  2UUT A;  2H1O E;  2K6L A;  1IRQ A;  2CAD A;  3H87 C;  4HV0 A;  2JXI A;  1SH2 A;  1Q5V A;  2BA3 A;  3BSN A;  1QTG A;  2K1O A;  1P94 A;  2BJ3 A;  3LGH A;  3UPF A;  2H3A A;  2HZA A;  2JBV A;  1B28 A;  4O4R A;  3UQS A;  1MYK A;  2CAJ A;  2WVC A;  4MJW A;  2KKE A;  1PAR A;  3H5X A;  2BNW A;  1X93 A;  1NLA A;  2CAX A;  2WVB A;  2HZV A;  1MNT A;  1BDV A;  2K9I A;  1U9P A;  2AY0 A;  2ADL A;  3NO7 A;  2BJ7 A;  3FMT A;  2JXG A;  2UUW A;  3H5Y A;  1SH0 A;  2AN7 A;  3QOQ A;  3UR0 A;  2WK4 A;  2CA9 A;  2BJ1 A;  3GXQ A;  2CPG A;  3G5O A;  3BSO A;  3OD2 A;  2KEL A;  3VEA A;  1EA4 A;  1SH3 A;  2BNZ A;  2CKW A;  2GPE A;  1SIW A;  1BAZ A;  1MYL A;  2K29 A;  4NRT A;  1OG7 A;  4FXE A;  3IR7 A;  3NNE A; 
#chains in the Genus database with same CATH homology
 2HZA A;  2CA9 A;  2K5J A;  2BJ1 A;  1B28 A;  3GXQ A;  2BJ9 A;  2WVD A;  2WVE A;  4ME7 E;  3VEB A;  2CPG A;  1MYK A;  2CAJ A;  2BSQ E;  2WVC A;  2WVF A;  3OD2 A;  1PAR A;  2BNW A;  3FT7 A;  2KEL A;  1B01 A;  2H1O E;  2K6L A;  1IRQ A;  1NLA A;  1X93 A;  2CAD A;  2WVB A;  3VEA A;  1EA4 A;  2CAX A;  3H87 C;  4HV0 A;  2HZV A;  2BNZ A;  1MNT A;  2JXH A;  2JXI A;  1BDV A;  2RBF A;  2K9I A;  1U9P A;  2AY0 A;  1Q5V A;  2BA3 A;  2BJ7 A;  3FMT A;  2GPE A;  1QTG A;  2JXG A;  1BAZ A;  1ARQ A;  1MYL A;  1P94 A;  2K1O A;  2K29 A;  3VW4 A;  2BJ3 A;  2BJ8 A;  3LGH A;  4FXE A;  1ARR A;  1BDT A;  4D8J A;  3QOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...