2K6LA

The solution structure of xacb0070 from xanthonomas axonopodis pv citri reveals this new protein is a member of the rhh family of transcriptional repressors
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
b'MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYLFERAVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title The solution structure reveals that XACb0070 from the plant pathogen Xanthomonas citri belongs to the RHH superfamily of bacterial DNA-binding proteins
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Unknown function
total genus 13
structure length 51
sequence length 51
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2k6lA00
2HZAA 2CAXA 2BJ9A 2WVCA 1BDTA 1QTGA 2JXIA 2RBFA 1NLAA 3VEBA 4ME7E 2BJ1A 1MYKA 1EA4A 3FMTA 1B01A 3VW4A 2K1OA 2CPGA 1B28A 1MNTA 1MYLA 3GXQA 2K6LA 2BJ7A 1ARRA 2BA3A 2BSQE 2WVEA 4D8JA 2K5JA 2BNZA 4HV0A 1BDVA 2CA9A 2AY0A 2HZVA 2BJ8A 2WVFA 3VEAA 1IRQA 1P94A 2BJ3A 1Q5VA 2WVDA 3H87C 2JXGA 2H1OE 3QOQA 1ARQA 2KELA 2BNWA 1X93A 2WVBA 3LGHA 1PARA 1BAZA 2CADA 2K29A 2GPEA 1U9PA 2K9IA 3OD2A 2JXHA 2CAJA 3FT7A 4FXEA
chains in the Genus database with same CATH superfamily
1QTGA 4NRTA 3VEBA 4ME7E 3FMTA 1B01A 2CPGA 3H5YA 2UUWA 2BA3A 3BSOA 2CA9A 2WVFA 2BJ3A 2WVDA 3NAHA 2KKEA 3LJPA 2BNWA 2WVBA 2B43A 2Q2KA 3UPFA 4FXEA 2BJ9A 4MJWA 2JXIA 2RBFA 1SH2A 2H3AA 1OG7A 3NNEA 1MYKA 1EA4A 2K1OA 2ADLA 1SIWA 1ARRA 3SFGA 2K5JA 2A2BA 2CAJA 4NRUA 2BJ8A 3VEAA 1IRQA 1Q5VA 2H1OE 2JXGA 3QOQA 1ARQA 1X93A 4QPXA 1BAZA 2K29A 2WK4A 2K9IA 3NAIA 2JXHA 2HZAA 2WVCA 1BDTA 4LQ9A 4LQ3A 1SH3A 1NLAA 2BJ1A 1MNTA 3GXQA 2KOEA 3QIDA 2WVEA 1Q16A 2HZVA 1SH0A 3UQSA 2KELA 2CADA 1OHNA 3H5XA 2CKWA 3FT7A 3UR0A 2CAXA 4AAIA 3IR7A 2AN7A 3VW4A 3G5OA 1B28A 1MYLA 4O4RA 3BSNA 2K6LA 2BJ7A 2BSQE 4D8JA 2BNZA 4HV0A 1BDVA 2UUTA 2AY0A 3NO7A 1P94A 3H87C 4LRVA 3SFUA 1PARA 3LGHA 2GPEA 1U9PA 3OD2A 2JBVA
chains in the Genus database with same CATH topology
2HZAA 2CAXA 2BJ9A 2WVCA 1BDTA 1QTGA 2JXIA 2RBFA 1NLAA 3VEBA 4ME7E 2BJ1A 1MYKA 1EA4A 3FMTA 1B01A 3VW4A 2K1OA 2CPGA 1B28A 1MNTA 1MYLA 3GXQA 2K6LA 2BJ7A 1ARRA 2BA3A 2BSQE 2WVEA 4D8JA 2K5JA 2BNZA 4HV0A 1BDVA 2CA9A 2AY0A 2HZVA 2BJ8A 2WVFA 3VEAA 1IRQA 1P94A 2BJ3A 1Q5VA 2WVDA 3H87C 2JXGA 2H1OE 3QOQA 1ARQA 2KELA 2BNWA 1X93A 2WVBA 3LGHA 1PARA 1BAZA 2CADA 2K29A 2GPEA 1U9PA 2K9IA 3OD2A 2JXHA 2CAJA 3FT7A 4FXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZA A;  2CAX A;  2BJ9 A;  2WVC A;  1BDT A;  1QTG A;  2JXI A;  2RBF A;  1NLA A;  3VEB A;  4ME7 E;  2BJ1 A;  1MYK A;  1EA4 A;  3FMT A;  1B01 A;  3VW4 A;  2K1O A;  2CPG A;  1B28 A;  1MNT A;  1MYL A;  3GXQ A;  2K6L A;  2BJ7 A;  1ARR A;  2BA3 A;  2BSQ E;  2WVE A;  4D8J A;  2K5J A;  2BNZ A;  4HV0 A;  1BDV A;  2CA9 A;  2AY0 A;  2HZV A;  2BJ8 A;  2WVF A;  3VEA A;  1IRQ A;  1P94 A;  2BJ3 A;  1Q5V A;  2WVD A;  3H87 C;  2JXG A;  2H1O E;  3QOQ A;  1ARQ A;  2KEL A;  2BNW A;  1X93 A;  2WVB A;  3LGH A;  1PAR A;  1BAZ A;  2CAD A;  2K29 A;  2GPE A;  1U9P A;  2K9I A;  3OD2 A;  2JXH A;  2CAJ A;  3FT7 A;  4FXE A; 
#chains in the Genus database with same CATH topology
 1QTG A;  4NRT A;  3VEB A;  4ME7 E;  3FMT A;  1B01 A;  2CPG A;  3H5Y A;  2UUW A;  2BA3 A;  3BSO A;  2CA9 A;  2WVF A;  2BJ3 A;  2WVD A;  3NAH A;  2KKE A;  3LJP A;  2BNW A;  2WVB A;  2B43 A;  2Q2K A;  3UPF A;  4FXE A;  2BJ9 A;  4MJW A;  2JXI A;  2RBF A;  1SH2 A;  2H3A A;  1OG7 A;  3NNE A;  1MYK A;  1EA4 A;  2K1O A;  2ADL A;  1SIW A;  1ARR A;  3SFG A;  2K5J A;  2A2B A;  2CAJ A;  4NRU A;  2BJ8 A;  3VEA A;  1IRQ A;  1Q5V A;  2H1O E;  2JXG A;  3QOQ A;  1ARQ A;  1X93 A;  4QPX A;  1BAZ A;  2K29 A;  2WK4 A;  2K9I A;  3NAI A;  2JXH A;  2HZA A;  2WVC A;  1BDT A;  4LQ9 A;  4LQ3 A;  1SH3 A;  1NLA A;  2BJ1 A;  1MNT A;  3GXQ A;  2KOE A;  3QID A;  2WVE A;  1Q16 A;  2HZV A;  1SH0 A;  3UQS A;  2KEL A;  2CAD A;  1OHN A;  3H5X A;  2CKW A;  3FT7 A;  3UR0 A;  2CAX A;  4AAI A;  3IR7 A;  2AN7 A;  3VW4 A;  3G5O A;  1B28 A;  1MYL A;  4O4R A;  3BSN A;  2K6L A;  2BJ7 A;  2BSQ E;  4D8J A;  2BNZ A;  4HV0 A;  1BDV A;  2UUT A;  2AY0 A;  3NO7 A;  1P94 A;  3H87 C;  4LRV A;  3SFU A;  1PAR A;  3LGH A;  2GPE A;  1U9P A;  3OD2 A;  2JBV A; 
#chains in the Genus database with same CATH homology
 2HZA A;  2CAX A;  2BJ9 A;  2WVC A;  1BDT A;  1QTG A;  2JXI A;  2RBF A;  1NLA A;  3VEB A;  4ME7 E;  2BJ1 A;  1MYK A;  1EA4 A;  3FMT A;  1B01 A;  3VW4 A;  2K1O A;  2CPG A;  1B28 A;  1MNT A;  1MYL A;  3GXQ A;  2K6L A;  2BJ7 A;  1ARR A;  2BA3 A;  2BSQ E;  2WVE A;  4D8J A;  2K5J A;  2BNZ A;  4HV0 A;  1BDV A;  2CA9 A;  2AY0 A;  2HZV A;  2BJ8 A;  2WVF A;  3VEA A;  1IRQ A;  1P94 A;  2BJ3 A;  1Q5V A;  2WVD A;  3H87 C;  2JXG A;  2H1O E;  3QOQ A;  1ARQ A;  2KEL A;  2BNW A;  1X93 A;  2WVB A;  3LGH A;  1PAR A;  1BAZ A;  2CAD A;  2K29 A;  2GPE A;  1U9P A;  2K9I A;  3OD2 A;  2JXH A;  2CAJ A;  3FT7 A;  4FXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...