The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
11
|
sequence length |
43
|
structure length |
43
|
Chain Sequence |
TTTMGVMLDDATRERIKSAATRIDRTPHWLIKQAIFSYLEQLE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structures of the DNA-binding domain of Escherichia coli proline utilization A flavoprotein and analysis of the role of Lys9 in DNA recognition.
pubmed doi rcsb |
| molecule keywords |
Bifunctional putA protein
|
| molecule tags |
Dna binding protein
|
| source organism |
Escherichia coli
|
| total genus |
11
|
| structure length |
43
|
| sequence length |
43
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature |
ec
1.2.1.88: L-glutamate gamma-semialdehyde dehydrogenase. |
| pdb deposition date | 2005-09-06 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant | Met repressor-like |
#chains in the Genus database with same CATH superfamily 2CAD A; 1EA4 A; 2WVB A; 1X93 A; 2WVD A; 3LGH A; 3FT7 A; 3QOQ A; 2CAX A; 1BDV A; 2HZV A; 2CAJ A; 4FXE A; 2KEL A; 2K6L A; 2K5J A; 2AY0 A; 2CPG A; 2JXH A; 3VEA A; 2BJ9 A; 2CA9 A; 2WVF A; 3OD2 A; 2BNW A; 1U9P A; 1IRQ A; 1MYL A; 2K9I A; 4D8J A; 1B28 A; 1ARQ A; 1B01 A; 4ME7 E; 2JXG A; 3VW4 A; 2RBF A; 2GPE A; 1BDT A; 2K1O A; 3GXQ A; 1ARR A; 2JXI A; 1QTG A; 4HV0 A; 2K29 A; 3H87 C; 2BA3 A; 2BJ8 A; 1MYK A; 3FMT A; 1PAR A; 2BJ3 A; 2BJ7 A; 1BAZ A; 2BSQ E; 1P94 A; 1NLA A; 2WVE A; 2BNZ A; 2WVC A; 3VEB A; 2BJ1 A; 2H1O E; 1MNT A; 1Q5V A; 2HZA A; #chains in the Genus database with same CATH topology 2WVB A; 2HZV A; 2UUW A; 1BDV A; 3UPF A; 2CAJ A; 4FXE A; 3BSN A; 2K6L A; 2A2B A; 3H5Y A; 3VEA A; 2BJ9 A; 3OD2 A; 2K9I A; 3BSO A; 3VW4 A; 4QPX A; 2K1O A; 1ARR A; 4O4R A; 1QTG A; 1PAR A; 2BSQ E; 3VEB A; 3NNE A; 2H1O E; 2JXH A; 2KKE A; 2CAX A; 1SH2 A; 3LGH A; 3FT7 A; 4NRU A; 2CA9 A; 3SFG A; 2BNW A; 1B28 A; 4NRT A; 1ARQ A; 1B01 A; 3G5O A; 3UQS A; 2GPE A; 2AN7 A; 4LQ3 A; 3LJP A; 2JXI A; 3NAI A; 3H87 C; 1MYK A; 2BA3 A; 2BJ8 A; 1P94 A; 2BNZ A; 2WVE A; 2BJ1 A; 3IR7 A; 2CAD A; 2JBV A; 1X93 A; 2K5J A; 2Q2K A; 2WVF A; 1MYL A; 3NAH A; 4ME7 E; 2ADL A; 1Q16 A; 1BDT A; 3H5X A; 3GXQ A; 1SIW A; 4HV0 A; 2K29 A; 2WK4 A; 3FMT A; 2BJ3 A; 2KOE A; 1BAZ A; 4LRV A; 3UR0 A; 1Q5V A; 2HZA A; 1SH3 A; 1EA4 A; 3QOQ A; 2WVD A; 1SH0 A; 4MJW A; 2KEL A; 3NO7 A; 3QID A; 4AAI A; 2AY0 A; 1OG7 A; 2CPG A; 2H3A A; 4LQ9 A; 1U9P A; 1IRQ A; 4D8J A; 2JXG A; 2RBF A; 1OHN A; 2UUT A; 2CKW A; 3SFU A; 2BJ7 A; 1NLA A; 2WVC A; 2B43 A; 1MNT A; #chains in the Genus database with same CATH homology 2CAD A; 1EA4 A; 2WVB A; 1X93 A; 2WVD A; 3LGH A; 3FT7 A; 3QOQ A; 2CAX A; 1BDV A; 2HZV A; 2CAJ A; 4FXE A; 2KEL A; 2K6L A; 2K5J A; 2AY0 A; 2CPG A; 2JXH A; 3VEA A; 2BJ9 A; 2CA9 A; 2WVF A; 3OD2 A; 2BNW A; 1U9P A; 1IRQ A; 1MYL A; 2K9I A; 4D8J A; 1B28 A; 1ARQ A; 1B01 A; 4ME7 E; 2JXG A; 3VW4 A; 2RBF A; 2GPE A; 1BDT A; 2K1O A; 3GXQ A; 1ARR A; 2JXI A; 1QTG A; 4HV0 A; 2K29 A; 3H87 C; 2BA3 A; 2BJ8 A; 1MYK A; 3FMT A; 1PAR A; 2BJ3 A; 2BJ7 A; 1BAZ A; 2BSQ E; 1P94 A; 1NLA A; 2WVE A; 2BNZ A; 2WVC A; 3VEB A; 2BJ1 A; 2H1O E; 1MNT A; 1Q5V A; 2HZA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...