The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
51
|
structure length |
51
|
Chain Sequence |
MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYLFERAVE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The solution structure reveals that XACb0070 from the plant pathogen Xanthomonas citri belongs to the RHH superfamily of bacterial DNA-binding proteins
rcsb |
| molecule keywords |
Putative uncharacterized protein
|
| molecule tags |
Unknown function
|
| source organism |
Xanthomonas axonopodis pv. citri
|
| total genus |
13
|
| structure length |
51
|
| sequence length |
51
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2008-07-11 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant | Met repressor-like |
#chains in the Genus database with same CATH superfamily 2CAJ A; 4D8J A; 3VEB A; 1X93 A; 2K1O A; 2BNZ A; 2BJ8 A; 2CAX A; 1B28 A; 1MNT A; 4HV0 A; 2HZV A; 1BAZ A; 3FMT A; 3QOQ A; 2HZA A; 3OD2 A; 2K6L A; 2WVC A; 1NLA A; 2RBF A; 2K29 A; 3VW4 A; 2WVD A; 1P94 A; 1BDT A; 2BNW A; 1QTG A; 4FXE A; 1PAR A; 2WVF A; 4ME7 E; 2BJ9 A; 2BA3 A; 1ARR A; 1MYK A; 2JXG A; 3VEA A; 1B01 A; 2H1O E; 2BSQ E; 2K5J A; 2JXH A; 1MYL A; 2K9I A; 2WVB A; 3GXQ A; 2AY0 A; 2JXI A; 2CAD A; 2KEL A; 2BJ1 A; 3H87 C; 2CPG A; 1BDV A; 1U9P A; 2CA9 A; 2GPE A; 2BJ7 A; 1ARQ A; 2BJ3 A; 1EA4 A; 3LGH A; 3FT7 A; 1IRQ A; 2WVE A; 1Q5V A; #chains in the Genus database with same CATH topology 4D8J A; 4MJW A; 2CAX A; 1OG7 A; 3NAI A; 3OD2 A; 2K6L A; 3SFU A; 1NLA A; 2KOE A; 2K29 A; 3VW4 A; 1P94 A; 1BDT A; 1QTG A; 4FXE A; 1ARR A; 2BA3 A; 1MYK A; 1B01 A; 2BSQ E; 2Q2K A; 2K9I A; 2JXH A; 1MYL A; 2AY0 A; 2JXI A; 2CAD A; 3H87 C; 2CA9 A; 1ARQ A; 1EA4 A; 3LGH A; 1Q16 A; 3LJP A; 1Q5V A; 2CAJ A; 3VEB A; 2BNZ A; 1B28 A; 2HZV A; 2WVC A; 3BSN A; 3UR0 A; 3H5X A; 2CKW A; 2WK4 A; 4LRV A; 2KEL A; 2BJ1 A; 3SFG A; 1U9P A; 3UQS A; 3NNE A; 3UPF A; 2BJ7 A; 2KKE A; 2BJ3 A; 2UUW A; 2H3A A; 3QID A; 1IRQ A; 2K1O A; 3NAH A; 4NRU A; 1MNT A; 4HV0 A; 3QOQ A; 3FMT A; 2JBV A; 2WVD A; 2AN7 A; 2WVF A; 2BJ9 A; 2H1O E; 2K5J A; 2WVB A; 3GXQ A; 3H5Y A; 1BDV A; 4LQ3 A; 1SH2 A; 2B43 A; 2GPE A; 3IR7 A; 1SH0 A; 2ADL A; 2A2B A; 2WVE A; 1X93 A; 2BJ8 A; 3G5O A; 1BAZ A; 2HZA A; 2RBF A; 4LQ9 A; 2BNW A; 1PAR A; 4ME7 E; 2JXG A; 3VEA A; 4O4R A; 1OHN A; 1SIW A; 4AAI A; 2CPG A; 3BSO A; 4QPX A; 3FT7 A; 2UUT A; 1SH3 A; 3NO7 A; 4NRT A; #chains in the Genus database with same CATH homology 2CAJ A; 4D8J A; 3VEB A; 1X93 A; 2K1O A; 2BNZ A; 2BJ8 A; 2CAX A; 1B28 A; 1MNT A; 4HV0 A; 2HZV A; 1BAZ A; 3FMT A; 3QOQ A; 2HZA A; 3OD2 A; 2K6L A; 2WVC A; 1NLA A; 2RBF A; 2K29 A; 3VW4 A; 2WVD A; 1P94 A; 1BDT A; 2BNW A; 1QTG A; 4FXE A; 1PAR A; 2WVF A; 4ME7 E; 2BJ9 A; 2BA3 A; 1ARR A; 1MYK A; 2JXG A; 3VEA A; 1B01 A; 2H1O E; 2BSQ E; 2K5J A; 2JXH A; 1MYL A; 2K9I A; 2WVB A; 3GXQ A; 2AY0 A; 2JXI A; 2CAD A; 2KEL A; 2BJ1 A; 3H87 C; 2CPG A; 1BDV A; 1U9P A; 2CA9 A; 2GPE A; 2BJ7 A; 1ARQ A; 2BJ3 A; 1EA4 A; 3LGH A; 3FT7 A; 1IRQ A; 2WVE A; 1Q5V A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...