The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
55
|
structure length |
55
|
Chain Sequence |
GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure-Based Stability Analysis of an Extremely Stable Dimeric DNA Binding Protein from Sulfolobus islandicus
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
source organism |
Sulfolobus islandicus
|
molecule keywords |
Uncharacterized protein ORF56
|
total genus |
15
|
structure length |
55
|
sequence length |
55
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2008-10-15 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant | Met repressor-like |
#chains in the Genus database with same CATH superfamily 2BA3 A; 2HZV A; 1Q5V A; 2K29 A; 2BSQ E; 3VEB A; 1ARQ A; 4HV0 A; 1MYL A; 4ME7 E; 4D8J A; 2KEL A; 2K9I A; 2CAX A; 1U9P A; 2K5J A; 2HZA A; 3VW4 A; 1EA4 A; 2BJ3 A; 2WVD A; 1P94 A; 1X93 A; 2RBF A; 2BNW A; 1QTG A; 1BAZ A; 2BJ8 A; 2WVE A; 2CAD A; 1MYK A; 2BJ1 A; 1NLA A; 3QOQ A; 3OD2 A; 2BNZ A; 3FMT A; 3H87 C; 2K6L A; 2JXI A; 2CAJ A; 1B01 A; 3VEA A; 1BDV A; 4FXE A; 1PAR A; 1BDT A; 1B28 A; 2BJ9 A; 3LGH A; 2CA9 A; 3GXQ A; 2BJ7 A; 1ARR A; 1MNT A; 2CPG A; 2JXH A; 2K1O A; 2AY0 A; 3FT7 A; 2GPE A; 2WVB A; 2H1O E; 2JXG A; 2WVC A; 2WVF A; 1IRQ A; #chains in the Genus database with same CATH topology 2K29 A; 2UUW A; 3UPF A; 1OG7 A; 1ARQ A; 1MYL A; 4D8J A; 2K9I A; 2BJ3 A; 2RBF A; 1P94 A; 1QTG A; 2B43 A; 1SH3 A; 2BJ1 A; 4MJW A; 1NLA A; 3QOQ A; 3OD2 A; 2JXI A; 1B01 A; 2CKW A; 1BDV A; 2BJ7 A; 1ARR A; 1MNT A; 4LQ3 A; 2AY0 A; 2K5J A; 1IRQ A; 2BSQ E; 4HV0 A; 4ME7 E; 2ADL A; 4AAI A; 3H5Y A; 2HZA A; 3VW4 A; 1EA4 A; 3SFU A; 2BNW A; 3SFG A; 3LJP A; 2WK4 A; 3UR0 A; 2K6L A; 2CAJ A; 1OHN A; 3VEA A; 1B28 A; 2BJ9 A; 2KOE A; 3H5X A; 2K1O A; 2GPE A; 2WVB A; 3UQS A; 2H1O E; 3LGH A; 2WVF A; 2BA3 A; 3G5O A; 2HZV A; 2KEL A; 2CAX A; 1U9P A; 1X93 A; 1BAZ A; 1SIW A; 3NO7 A; 2WVE A; 2CAD A; 4NRT A; 4LQ9 A; 4NRU A; 1Q16 A; 1BDT A; 3IR7 A; 3BSN A; 3NAH A; 1SH0 A; 3GXQ A; 3NNE A; 3BSO A; 2JXH A; 2CPG A; 3NAI A; 2JXG A; 1SH2 A; 1Q5V A; 2KKE A; 4O4R A; 3VEB A; 2WVD A; 4QPX A; 2BJ8 A; 4LRV A; 3QID A; 2A2B A; 1MYK A; 2Q2K A; 2BNZ A; 3FMT A; 3H87 C; 2AN7 A; 4FXE A; 1PAR A; 2UUT A; 2H3A A; 2CA9 A; 2JBV A; 3FT7 A; 2WVC A; #chains in the Genus database with same CATH homology 2BA3 A; 2HZV A; 1Q5V A; 2K29 A; 2BSQ E; 3VEB A; 1ARQ A; 4HV0 A; 1MYL A; 4ME7 E; 4D8J A; 2KEL A; 2K9I A; 2CAX A; 1U9P A; 2K5J A; 2HZA A; 3VW4 A; 1EA4 A; 2BJ3 A; 2WVD A; 1P94 A; 1X93 A; 2RBF A; 2BNW A; 1QTG A; 1BAZ A; 2BJ8 A; 2WVE A; 2CAD A; 1MYK A; 2BJ1 A; 1NLA A; 3QOQ A; 3OD2 A; 2BNZ A; 3FMT A; 3H87 C; 2K6L A; 2JXI A; 2CAJ A; 1B01 A; 3VEA A; 1BDV A; 4FXE A; 1PAR A; 1BDT A; 1B28 A; 2BJ9 A; 3LGH A; 2CA9 A; 3GXQ A; 2BJ7 A; 1ARR A; 1MNT A; 2CPG A; 2JXH A; 2K1O A; 2AY0 A; 3FT7 A; 2GPE A; 2WVB A; 2H1O E; 2JXG A; 2WVC A; 2WVF A; 1IRQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...