The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
11
|
sequence length |
46
|
structure length |
46
|
Chain Sequence |
KQKAVFGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRNG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure, function, and targets of the transcriptional regulator SvtR from the hyperthermophilic archaeal virus SIRV1.
pubmed doi rcsb |
| molecule tags |
Transcription repressor
|
| source organism |
Sulfolobus islandicus rod-shaped virus 1
|
| molecule keywords |
Uncharacterized protein 56B
|
| total genus |
11
|
| structure length |
46
|
| sequence length |
46
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2009-01-30 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant | Met repressor-like |
#chains in the Genus database with same CATH superfamily 2BJ7 A; 1ARQ A; 4D8J A; 3VW4 A; 1IRQ A; 2BA3 A; 2WVE A; 2RBF A; 2BSQ E; 2JXI A; 2CPG A; 2JXH A; 1B01 A; 2BJ9 A; 1Q5V A; 3H87 C; 2K9I A; 2BJ1 A; 1BAZ A; 2HZV A; 2K6L A; 1B28 A; 2CAD A; 1NLA A; 2K5J A; 2CAX A; 3QOQ A; 1MYK A; 2WVC A; 3GXQ A; 2BJ8 A; 3FT7 A; 1ARR A; 2KEL A; 3VEB A; 3LGH A; 1MYL A; 4FXE A; 4HV0 A; 3OD2 A; 2K29 A; 1BDT A; 2BNZ A; 3FMT A; 1QTG A; 1P94 A; 1X93 A; 2CA9 A; 2GPE A; 2HZA A; 2CAJ A; 1U9P A; 2WVF A; 1EA4 A; 2BNW A; 2H1O E; 2WVD A; 4ME7 E; 1PAR A; 1BDV A; 2K1O A; 1MNT A; 2JXG A; 2BJ3 A; 2AY0 A; 2WVB A; 3VEA A; #chains in the Genus database with same CATH topology 2BJ7 A; 3QID A; 1IRQ A; 2BA3 A; 4LQ9 A; 4NRT A; 2JXH A; 1B01 A; 3H87 C; 1BAZ A; 2KKE A; 2K5J A; 2WVC A; 3G5O A; 2ADL A; 3VEB A; 3NAI A; 3FMT A; 1QTG A; 3LJP A; 1X93 A; 2GPE A; 3SFG A; 2BNW A; 2CAJ A; 1PAR A; 1BDV A; 1OG7 A; 4AAI A; 1ARQ A; 2A2B A; 1SH3 A; 4LRV A; 1SIW A; 4NRU A; 3SFU A; 3BSN A; 3UQS A; 2BJ1 A; 3NAH A; 2CAD A; 2WK4 A; 3QOQ A; 1MYK A; 3UPF A; 3FT7 A; 1ARR A; 2KEL A; 3H5Y A; 4MJW A; 3LGH A; 4HV0 A; 3OD2 A; 2K29 A; 2CA9 A; 2HZA A; 1EA4 A; 1U9P A; 2WVF A; 2UUT A; 2KOE A; 3H5X A; 2WVB A; 3IR7 A; 2UUW A; 4D8J A; 2JXI A; 3NNE A; 2BJ9 A; 1Q5V A; 3UR0 A; 2K9I A; 1B28 A; 2K6L A; 3NO7 A; 2BJ8 A; 2B43 A; 4FXE A; 2BNZ A; 4LQ3 A; 4QPX A; 2Q2K A; 1P94 A; 1OHN A; 2H1O E; 3BSO A; 4ME7 E; 2JXG A; 2CKW A; 2BJ3 A; 2AY0 A; 3VEA A; 3VW4 A; 2BSQ E; 2WVE A; 2RBF A; 2CPG A; 2HZV A; 2AN7 A; 1NLA A; 2CAX A; 3GXQ A; 1SH0 A; 1Q16 A; 2H3A A; 1MYL A; 1SH2 A; 2JBV A; 1BDT A; 2WVD A; 4O4R A; 2K1O A; 1MNT A; #chains in the Genus database with same CATH homology 2BJ7 A; 1ARQ A; 4D8J A; 3VW4 A; 1IRQ A; 2BA3 A; 2WVE A; 2RBF A; 2BSQ E; 2JXI A; 2CPG A; 2JXH A; 1B01 A; 2BJ9 A; 1Q5V A; 3H87 C; 2K9I A; 2BJ1 A; 1BAZ A; 2HZV A; 2K6L A; 1B28 A; 2CAD A; 1NLA A; 2K5J A; 2CAX A; 3QOQ A; 1MYK A; 2WVC A; 3GXQ A; 2BJ8 A; 3FT7 A; 1ARR A; 2KEL A; 3VEB A; 3LGH A; 1MYL A; 4FXE A; 4HV0 A; 3OD2 A; 2K29 A; 1BDT A; 2BNZ A; 3FMT A; 1QTG A; 1P94 A; 1X93 A; 2CA9 A; 2GPE A; 2HZA A; 2CAJ A; 1U9P A; 2WVF A; 1EA4 A; 2BNW A; 2H1O E; 2WVD A; 4ME7 E; 1PAR A; 1BDV A; 2K1O A; 1MNT A; 2JXG A; 2BJ3 A; 2AY0 A; 2WVB A; 3VEA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
