The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
53
|
structure length |
53
|
Chain Sequence |
MVGRRPGGGLKDTKPVVVRLYPDEIEALKSRVPANTSMSAYIRRIILNHLEDE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
NMR Solution Structure of a putative uncharacterized protein from Methanobacterium thermoautotrophicum, Northeast Structural Genomics Consortium Target:TR5
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Methanothermobacter thermautotrophicus str. delta h
|
molecule keywords |
Uncharacterized protein
|
total genus |
9
|
structure length |
53
|
sequence length |
53
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2009-06-18 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant | Arc Repressor Mutant |
#chains in the Genus database with same CATH superfamily 2KKE A; #chains in the Genus database with same CATH topology 1SH0 A; 3FMT A; 3UQS A; 1BDT A; 3UR0 A; 2ADL A; 2K5J A; 3NAH A; 2KKE A; 2BJ8 A; 1BDV A; 4HV0 A; 2RBF A; 2B43 A; 1Q16 A; 1P94 A; 2WVF A; 2JBV A; 3LGH A; 2WVD A; 3SFU A; 2WVC A; 2BNW A; 1SIW A; 2H1O E; 1ARR A; 2BJ9 A; 2K29 A; 4D8J A; 2BNZ A; 4LRV A; 1OHN A; 1U9P A; 2HZV A; 3VEB A; 4ME7 E; 2BSQ E; 2BJ1 A; 2JXH A; 1B28 A; 4LQ9 A; 1OG7 A; 4QPX A; 2CKW A; 1SH2 A; 1MYL A; 1BAZ A; 2BJ7 A; 2K1O A; 2JXI A; 2CA9 A; 1MYK A; 3UPF A; 1IRQ A; 1QTG A; 2Q2K A; 1MNT A; 2CPG A; 1EA4 A; 4LQ3 A; 3H5X A; 2K6L A; 3QID A; 2WVB A; 4NRU A; 1PAR A; 3H5Y A; 2HZA A; 1Q5V A; 2A2B A; 1ARQ A; 2BJ3 A; 2WVE A; 2K9I A; 3IR7 A; 3VEA A; 2CAX A; 3BSO A; 3G5O A; 2AN7 A; 3QOQ A; 3BSN A; 3NAI A; 4O4R A; 1X93 A; 2KEL A; 3NO7 A; 3SFG A; 2JXG A; 3H87 C; 1NLA A; 2KOE A; 2CAJ A; 2CAD A; 2WK4 A; 3VW4 A; 3LJP A; 2UUW A; 2H3A A; 1B01 A; 2BA3 A; 4FXE A; 3NNE A; 4NRT A; 4MJW A; 1SH3 A; 2GPE A; 4AAI A; 3FT7 A; 2UUT A; 3GXQ A; 2AY0 A; 3OD2 A; #chains in the Genus database with same CATH homology 3UPF A; 1SH0 A; 3NAI A; 4O4R A; 2Q2K A; 3UQS A; 3NO7 A; 4LRV A; 3SFG A; 3UR0 A; 1OHN A; 2ADL A; 4LQ3 A; 3H5X A; 2KOE A; 2WK4 A; 3QID A; 4NRU A; 3LJP A; 3NAH A; 2UUW A; 2KKE A; 2H3A A; 3H5Y A; 4LQ9 A; 1OG7 A; 2A2B A; 4QPX A; 2CKW A; 1SH2 A; 2B43 A; 3NNE A; 1Q16 A; 4NRT A; 4MJW A; 1SH3 A; 2JBV A; 4AAI A; 3IR7 A; 2UUT A; 3G5O A; 3SFU A; 2AN7 A; 3BSO A; 3BSN A; 1SIW A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...