The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
40
|
structure length |
40
|
Chain Sequence |
TVFAFASMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSAE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
NMR solution structure of human cannabinoid receptor-1 helix 7/8 peptide: candidate electrostatic interactions and microdomain formation.
pubmed doi rcsb |
molecule tags |
Membrane protein, signaling protein
|
molecule keywords |
human cannabinoid receptor 1 - helix 7/8 peptide
|
total genus |
9
|
structure length |
40
|
sequence length |
40
|
ec nomenclature | |
pdb deposition date | 2009-09-18 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant | Arc Repressor Mutant |
#chains in the Genus database with same CATH superfamily 2KOE A; #chains in the Genus database with same CATH topology 2BJ1 A; 2A2B A; 2WK4 A; 2K1O A; 2ADL A; 2JXG A; 2WVD A; 3NAH A; 2CPG A; 3NAI A; 1Q16 A; 4FXE A; 2K9I A; 1BAZ A; 4O4R A; 1BDT A; 1MNT A; 4NRT A; 2CAD A; 2UUW A; 3LJP A; 2K29 A; 2H1O E; 2H3A A; 3QID A; 1OG7 A; 2AY0 A; 1ARR A; 2B43 A; 1MYL A; 1PAR A; 2WVE A; 3QOQ A; 2AN7 A; 1NLA A; 1Q5V A; 2JXH A; 1U9P A; 2CAX A; 1ARQ A; 2CA9 A; 2BJ7 A; 3UPF A; 2CKW A; 1BDV A; 3VW4 A; 3LGH A; 3H87 C; 2UUT A; 4HV0 A; 1IRQ A; 3UR0 A; 2BJ3 A; 1QTG A; 3H5Y A; 2K6L A; 4LQ9 A; 3SFU A; 3H5X A; 4LQ3 A; 1X93 A; 4QPX A; 3VEB A; 3G5O A; 4LRV A; 2BNZ A; 2JBV A; 3UQS A; 2BJ9 A; 3NO7 A; 1MYK A; 2K5J A; 1B28 A; 2WVF A; 2WVB A; 3FT7 A; 4NRU A; 1B01 A; 2KKE A; 4AAI A; 3IR7 A; 4ME7 E; 2JXI A; 2GPE A; 1P94 A; 1SH0 A; 2WVC A; 1SH2 A; 1OHN A; 3GXQ A; 2BNW A; 2KEL A; 3SFG A; 1EA4 A; 2CAJ A; 4MJW A; 3BSO A; 3OD2 A; 2RBF A; 2KOE A; 2HZV A; 1SH3 A; 1SIW A; 2HZA A; 3BSN A; 3FMT A; 2Q2K A; 2BSQ E; 2BA3 A; 2BJ8 A; 3VEA A; 3NNE A; 4D8J A; #chains in the Genus database with same CATH homology 3H5Y A; 2A2B A; 4LQ9 A; 3SFU A; 3H5X A; 4LQ3 A; 1SH2 A; 2WK4 A; 1OHN A; 2ADL A; 2H3A A; 3SFG A; 3QID A; 4QPX A; 3G5O A; 4LRV A; 4MJW A; 3UR0 A; 1OG7 A; 2JBV A; 3BSO A; 3UQS A; 3NO7 A; 3NAH A; 2KOE A; 2B43 A; 1SH3 A; 1SIW A; 4NRU A; 2AN7 A; 2KKE A; 1Q16 A; 3NAI A; 4O4R A; 4AAI A; 3BSN A; 3IR7 A; 3UPF A; 2CKW A; 2Q2K A; 4NRT A; 2UUW A; 2UUT A; 3LJP A; 3NNE A; 1SH0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...