4LRVA

Crystal structure of dnde from escherichia coli b7a involved in dna phosphorothioation modification
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
107
structure length
107
Chain Sequence
SMLPNRMALSRQTEDQLKKLKGYTGITPNIAARLAFFRSVESEFRYSPERDSKKLDGTLVLDKITWLGETLQATELVLKMLYPQLEQKALIKAWAAHVEDGIAALRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into DndE from Escherichia coli B7A involved in DNA phosphorothioation modification
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords DNA sulfur modification protein DndE
total genus 31
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
other databases KnotProt 2.0: K -31
ec nomenclature
pdb deposition date 2013-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4lrvA00
4LRVA
chains in the Genus database with same CATH superfamily
2Q2KA 1OHNA 1ARRA 1MYKA 3LJPA 2H3AA 2ADLA 1BAZA 1SIWA 2JXHA 3OD2A 4QPXA 1PARA 2WK4A 4NRUA 2BJ1A 3NO7A 2GPEA 1QTGA 2BJ3A 1SH3A 2H1OE 1OG7A 2BJ8A 2BJ9A 2UUWA 2CA9A 2JBVA 3IR7A 3NNEA 3VEBA 2BJ7A 2CAJA 3FT7A 3VEAA 1NLAA 2K1OA 3SFGA 2WVBA 2KELA 3VW4A 4ME7E 3NAHA 1SH2A 2JXGA 1P94A 2BNWA 2WVCA 2HZVA 1B01A 4LQ3A 3GXQA 3QIDA 3SFUA 2UUTA 2K9IA 1EA4A 3H87C 4LRVA 2HZAA 2CKWA 3H5YA 3BSNA 1U9PA 2WVDA 2AY0A 2WVFA 3NAIA 2RBFA 2CPGA 3BSOA 3UR0A 4D8JA 2KOEA 3QOQA 2WVEA 4FXEA 3UPFA 1X93A 1SH0A 1B28A 2K6LA 4MJWA 1MNTA 2KKEA 3LGHA 4AAIA 2BSQE 4NRTA 2B43A 2CADA 2CAXA 3FMTA 3UQSA 2JXIA 2K5JA 2AN7A 1BDVA 4HV0A 2BNZA 1MYLA 1ARQA 4O4RA 1Q16A 2K29A 3G5OA 1BDTA 1IRQA 2A2BA 2BA3A 1Q5VA 3H5XA 4LQ9A
chains in the Genus database with same CATH topology
2Q2KA 3H5YA 1OHNA 4AAIA 3BSNA 3SFGA 4NRTA 3LJPA 2H3AA 2ADLA 2B43A 1SIWA 4QPXA 3NAHA 1SH2A 2WK4A 3UQSA 4NRUA 3NAIA 4LQ3A 2AN7A 3NO7A 3BSOA 1SH3A 3UR0A 1OG7A 2KOEA 2UUWA 3QIDA 4O4RA 3UPFA 1Q16A 2JBVA 3SFUA 1SH0A 3G5OA 3IR7A 3NNEA 2UUTA 4MJWA 2A2BA 2KKEA 4LRVA 3H5XA 4LQ9A 2CKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRV A; 
#chains in the Genus database with same CATH topology
 2Q2K A;  1OHN A;  1ARR A;  1MYK A;  3LJP A;  2H3A A;  2ADL A;  1BAZ A;  1SIW A;  2JXH A;  3OD2 A;  4QPX A;  1PAR A;  2WK4 A;  4NRU A;  2BJ1 A;  3NO7 A;  2GPE A;  1QTG A;  2BJ3 A;  1SH3 A;  2H1O E;  1OG7 A;  2BJ8 A;  2BJ9 A;  2UUW A;  2CA9 A;  2JBV A;  3IR7 A;  3NNE A;  3VEB A;  2BJ7 A;  2CAJ A;  3FT7 A;  3VEA A;  1NLA A;  2K1O A;  3SFG A;  2WVB A;  2KEL A;  3VW4 A;  4ME7 E;  3NAH A;  1SH2 A;  2JXG A;  1P94 A;  2BNW A;  2WVC A;  2HZV A;  1B01 A;  4LQ3 A;  3GXQ A;  3QID A;  3SFU A;  2UUT A;  2K9I A;  1EA4 A;  3H87 C;  4LRV A;  2HZA A;  2CKW A;  3H5Y A;  3BSN A;  1U9P A;  2WVD A;  2AY0 A;  2WVF A;  3NAI A;  2RBF A;  2CPG A;  3BSO A;  3UR0 A;  4D8J A;  2KOE A;  3QOQ A;  2WVE A;  4FXE A;  3UPF A;  1X93 A;  1SH0 A;  1B28 A;  2K6L A;  4MJW A;  1MNT A;  2KKE A;  3LGH A;  4AAI A;  2BSQ E;  4NRT A;  2B43 A;  2CAD A;  2CAX A;  3FMT A;  3UQS A;  2JXI A;  2K5J A;  2AN7 A;  1BDV A;  4HV0 A;  2BNZ A;  1MYL A;  1ARQ A;  4O4R A;  1Q16 A;  2K29 A;  3G5O A;  1BDT A;  1IRQ A;  2A2B A;  2BA3 A;  1Q5V A;  3H5X A;  4LQ9 A; 
#chains in the Genus database with same CATH homology
 2Q2K A;  3H5Y A;  1OHN A;  4AAI A;  3BSN A;  3SFG A;  4NRT A;  3LJP A;  2H3A A;  2ADL A;  2B43 A;  1SIW A;  4QPX A;  3NAH A;  1SH2 A;  2WK4 A;  3UQS A;  4NRU A;  3NAI A;  4LQ3 A;  2AN7 A;  3NO7 A;  3BSO A;  1SH3 A;  3UR0 A;  1OG7 A;  2KOE A;  2UUW A;  3QID A;  4O4R A;  3UPF A;  1Q16 A;  2JBV A;  3SFU A;  1SH0 A;  3G5O A;  3IR7 A;  3NNE A;  2UUT A;  4MJW A;  2A2B A;  2KKE A;  4LRV A;  3H5X A;  4LQ9 A;  2CKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...