4LRVA

Crystal structure of dnde from escherichia coli b7a involved in dna phosphorothioation modification
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
107
structure length
107
Chain Sequence
SMLPNRMALSRQTEDQLKKLKGYTGITPNIAARLAFFRSVESEFRYSPERDSKKLDGTLVLDKITWLGETLQATELVLKMLYPQLEQKALIKAWAAHVEDGIAALRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into DndE from Escherichia coli B7A involved in DNA phosphorothioation modification
pubmed doi rcsb
molecule keywords DNA sulfur modification protein DndE
molecule tags Dna binding protein
source organism Escherichia coli
total genus 31
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
other databases KnotProt 2.0: K -31
ec nomenclature
pdb deposition date 2013-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4lrvA00
4LRVA
chains in the Genus database with same CATH superfamily
1BAZA 2AN7A 4NRUA 2AY0A 2UUTA 3NAHA 2K1OA 3NO7A 3VW4A 1Q16A 3QOQA 3FT7A 1BDTA 2Q2KA 2CPGA 3UR0A 3LJPA 3FMTA 3VEAA 2BNZA 4LQ3A 2KOEA 4MJWA 4AAIA 4NRTA 1P94A 2K6LA 2BSQE 2K5JA 2BJ3A 2WK4A 1B28A 2JXIA 2CADA 3H87C 1SIWA 1OHNA 2HZVA 2ADLA 2BNWA 2WVBA 1SH2A 3OD2A 1Q5VA 2WVFA 3IR7A 4FXEA 2WVEA 1ARQA 2KELA 3NAIA 2K9IA 2KKEA 2JXGA 1B01A 2BJ1A 1EA4A 3LGHA 3G5OA 3QIDA 4LQ9A 4D8JA 1PARA 2GPEA 2UUWA 1OG7A 1NLAA 2H3AA 2CA9A 2BA3A 1MYKA 1X93A 2JBVA 1U9PA 4LRVA 4O4RA 2CKWA 2A2BA 3UQSA 1QTGA 1SH0A 2B43A 3BSOA 1SH3A 3GXQA 3NNEA 3VEBA 4QPXA 2WVDA 2CAXA 2H1OE 1ARRA 3SFUA 1IRQA 3UPFA 2CAJA 3H5YA 2WVCA 3BSNA 2K29A 2BJ7A 2BJ8A 1MNTA 2JXHA 2HZAA 1MYLA 1BDVA 3H5XA 2RBFA 4HV0A 4ME7E 3SFGA 2BJ9A
chains in the Genus database with same CATH topology
3NNEA 4QPXA 2AN7A 4NRUA 2KKEA 2UUTA 2WK4A 3NAHA 3NO7A 1Q16A 3SFUA 3G5OA 3QIDA 4LQ9A 3UPFA 1SIWA 2Q2KA 2UUWA 3H5YA 3UR0A 3LJPA 1OHNA 3BSNA 1OG7A 2H3AA 2ADLA 4LQ3A 1SH2A 2JBVA 2KOEA 4MJWA 4LRVA 4O4RA 4AAIA 3H5XA 2CKWA 2A2BA 3IR7A 4NRTA 3UQSA 1SH0A 2B43A 3SFGA 3BSOA 1SH3A 3NAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRV A; 
#chains in the Genus database with same CATH topology
 1BAZ A;  2AN7 A;  4NRU A;  2AY0 A;  2UUT A;  3NAH A;  2K1O A;  3NO7 A;  3VW4 A;  1Q16 A;  3QOQ A;  3FT7 A;  1BDT A;  2Q2K A;  2CPG A;  3UR0 A;  3LJP A;  3FMT A;  3VEA A;  2BNZ A;  4LQ3 A;  2KOE A;  4MJW A;  4AAI A;  4NRT A;  1P94 A;  2K6L A;  2BSQ E;  2K5J A;  2BJ3 A;  2WK4 A;  1B28 A;  2JXI A;  2CAD A;  3H87 C;  1SIW A;  1OHN A;  2HZV A;  2ADL A;  2BNW A;  2WVB A;  1SH2 A;  3OD2 A;  1Q5V A;  2WVF A;  3IR7 A;  4FXE A;  2WVE A;  1ARQ A;  2KEL A;  3NAI A;  2K9I A;  2KKE A;  2JXG A;  1B01 A;  2BJ1 A;  1EA4 A;  3LGH A;  3G5O A;  3QID A;  4LQ9 A;  4D8J A;  1PAR A;  2GPE A;  2UUW A;  1OG7 A;  1NLA A;  2H3A A;  2CA9 A;  2BA3 A;  1MYK A;  1X93 A;  2JBV A;  1U9P A;  4LRV A;  4O4R A;  2CKW A;  2A2B A;  3UQS A;  1QTG A;  1SH0 A;  2B43 A;  3BSO A;  1SH3 A;  3GXQ A;  3NNE A;  3VEB A;  4QPX A;  2WVD A;  2CAX A;  2H1O E;  1ARR A;  3SFU A;  1IRQ A;  3UPF A;  2CAJ A;  3H5Y A;  2WVC A;  3BSN A;  2K29 A;  2BJ7 A;  2BJ8 A;  1MNT A;  2JXH A;  2HZA A;  1MYL A;  1BDV A;  3H5X A;  2RBF A;  4HV0 A;  4ME7 E;  3SFG A;  2BJ9 A; 
#chains in the Genus database with same CATH homology
 3NNE A;  4QPX A;  2AN7 A;  4NRU A;  2KKE A;  2UUT A;  2WK4 A;  3NAH A;  3NO7 A;  1Q16 A;  3SFU A;  3G5O A;  3QID A;  4LQ9 A;  3UPF A;  1SIW A;  2Q2K A;  2UUW A;  3H5Y A;  3UR0 A;  3LJP A;  1OHN A;  3BSN A;  1OG7 A;  2H3A A;  2ADL A;  4LQ3 A;  1SH2 A;  2JBV A;  2KOE A;  4MJW A;  4LRV A;  4O4R A;  4AAI A;  3H5X A;  2CKW A;  2A2B A;  3IR7 A;  4NRT A;  3UQS A;  1SH0 A;  2B43 A;  3SFG A;  3BSO A;  1SH3 A;  3NAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...