1S7JA

Crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
260
structure length
260
Chain Sequence
MSYPYYIVDAFAEEVFKGNPAAVYVLEKWLPEAVMQNIAIENNLSETAFTVKEGQSYALRWFTPEREIDLCGHATLATAFVLFNYYSVAEETLHFTSQSGPLAVTKKEEYYYLDFPYILPERIPILPEYEAALGTKIYEAYLGRDLFFVLKDEETVAKITPDFSALKALDLGVGVIVTASGDSVDFVSRTFFPKLRINEDPVCGSAHANLIPYWGKRLNQTTLSAYQVSPRGGFLTCEVKENRVIIGGTAKLFAKGEAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phenazine biosynthesis protein from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Biosynthetic protein
molecule keywords phenazine biosynthesis protein PhzF family
total genus 64
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1s7jA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1s7jA01
5H2YA 4K8LA 3FVEA 1XUAA 1QYAA 2PVZA 5M47A 1YM5A 2Q9JA 4IK0A 4JD7A 5IWEA 2Q9HA 1QY9A 4JCIA 1XUBA 1U1XA 4Q2HA 5HA4A 4J9XA 1BWZA 2H9FA 2GKEA 1T6KA 2AZPA 2GKJA 1S7JA 3EDNA 2OTNA 1SDJA 4Q60A 2PW0A 1W61A 1U1WA 3EJXA 3EKMA 1U0KA 4J9WA 5H2GA 4JUUA 1U1VA 4K7GB 1W62A 4IJZA 4K7XA 1TM0A 4DUNA 4LB0A 1GQZA 4JBDA 3G7KA
chains in the Genus database with same CATH superfamily
2ZXRA 4K8LA 4GL6A 2Q9JA 3DEVA 4IK0A 4JD7A 2Q9HA 5HA4A 1U1XA 2GKJA 2OTNA 4RPAA 3PTJA 1U1WA 2ENXA 2ZXOA 4K7GB 4IJZA 2QB6A 3WQZA 1IR6A 2QB7A 2IW4A 3IGHX 3PW9A 3W5WA 2QB8A 4LS9A 4J9XA 2GKEA 4OA3A 3EDNA 1SDJA 4Q60A 1W61A 1WPMA 2MPBA 3EJXA 3EKMA 1WPPA 4JUUA 1U1VA 1W62A 4LG3A 1GQZA 2HAWA 3FVEA 1XUAA 2YMAA 3ICJA 2ZVFA 5IWEA 1QY9A 4JCIA 1XUBA 1BWZA 2H9FA 3PVHA 1T6KA 1S7JA 4PY9A 1U0KA 5H2GA 1K20A 3G98A 4K7XA 4LB0A 1K23A 1I74A 2KW7A 4JBDA 4DUNA 5H2YA 1QYAA 2EB0A 2PVZA 5M47A 1YM5A 2LT2A 4Q2HA 2KPTA 2ZXPA 2AZPA 2PW0A 4J9WA 5ANPA 1TM0A 3G7KA
chains in the Genus database with same CATH topology
2ZXRA 4K8LA 4GL6A 2Q9JA 3DEVA 4IK0A 4JD7A 2Q9HA 5HA4A 1U1XA 2GKJA 2OTNA 4RPAA 3PTJA 1U1WA 2ENXA 2ZXOA 4K7GB 4IJZA 2QB6A 3WQZA 1IR6A 2QB7A 2IW4A 3IGHX 3PW9A 3W5WA 2QB8A 4LS9A 4J9XA 2GKEA 4OA3A 3EDNA 1SDJA 4Q60A 1W61A 1WPMA 2MPBA 3EJXA 3EKMA 1WPPA 4JUUA 1U1VA 1W62A 4LG3A 1GQZA 2HAWA 3FVEA 1XUAA 2YMAA 3ICJA 2ZVFA 5IWEA 1QY9A 4JCIA 1XUBA 1BWZA 2H9FA 3PVHA 1T6KA 1S7JA 4PY9A 1U0KA 5H2GA 1K20A 3G98A 4K7XA 4LB0A 1K23A 1I74A 2KW7A 4JBDA 4DUNA 5H2YA 1QYAA 2EB0A 2PVZA 5M47A 1YM5A 2LT2A 4Q2HA 2KPTA 2ZXPA 2AZPA 2PW0A 4J9WA 5ANPA 1TM0A 3G7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2Y A;  4K8L A;  3FVE A;  1XUA A;  1QYA A;  2PVZ A;  5M47 A;  1YM5 A;  2Q9J A;  4IK0 A;  4JD7 A;  5IWE A;  2Q9H A;  1QY9 A;  4JCI A;  1XUB A;  1U1X A;  4Q2H A;  5HA4 A;  4J9X A;  1BWZ A;  2H9F A;  2GKE A;  1T6K A;  2AZP A;  2GKJ A;  1S7J A;  3EDN A;  2OTN A;  1SDJ A;  4Q60 A;  2PW0 A;  1W61 A;  1U1W A;  3EJX A;  3EKM A;  1U0K A;  4J9W A;  5H2G A;  4JUU A;  1U1V A;  4K7G B;  1W62 A;  4IJZ A;  4K7X A;  1TM0 A;  4DUN A;  4LB0 A;  1GQZ A;  4JBD A;  3G7K A; 
#chains in the Genus database with same CATH topology
 2ZXR A;  4K8L A;  4GL6 A;  2Q9J A;  3DEV A;  4IK0 A;  4JD7 A;  2Q9H A;  5HA4 A;  1U1X A;  2GKJ A;  2OTN A;  4RPA A;  3PTJ A;  1U1W A;  2ENX A;  2ZXO A;  4K7G B;  4IJZ A;  2QB6 A;  3WQZ A;  1IR6 A;  2QB7 A;  2IW4 A;  3IGH X;  3PW9 A;  3W5W A;  2QB8 A;  4LS9 A;  4J9X A;  2GKE A;  4OA3 A;  3EDN A;  1SDJ A;  4Q60 A;  1W61 A;  1WPM A;  2MPB A;  3EJX A;  3EKM A;  1WPP A;  4JUU A;  1U1V A;  1W62 A;  4LG3 A;  1GQZ A;  2HAW A;  3FVE A;  1XUA A;  2YMA A;  3ICJ A;  2ZVF A;  5IWE A;  1QY9 A;  4JCI A;  1XUB A;  1BWZ A;  2H9F A;  3PVH A;  1T6K A;  1S7J A;  4PY9 A;  1U0K A;  5H2G A;  1K20 A;  3G98 A;  4K7X A;  4LB0 A;  1K23 A;  1I74 A;  2KW7 A;  4JBD A;  4DUN A;  5H2Y A;  1QYA A;  2EB0 A;  2PVZ A;  5M47 A;  1YM5 A;  2LT2 A;  4Q2H A;  2KPT A;  2ZXP A;  2AZP A;  2PW0 A;  4J9W A;  5ANP A;  1TM0 A;  3G7K A; 
#chains in the Genus database with same CATH homology
 2ZXR A;  4K8L A;  4GL6 A;  2Q9J A;  3DEV A;  4IK0 A;  4JD7 A;  2Q9H A;  5HA4 A;  1U1X A;  2GKJ A;  2OTN A;  4RPA A;  3PTJ A;  1U1W A;  2ENX A;  2ZXO A;  4K7G B;  4IJZ A;  2QB6 A;  3WQZ A;  1IR6 A;  2QB7 A;  2IW4 A;  3IGH X;  3PW9 A;  3W5W A;  2QB8 A;  4LS9 A;  4J9X A;  2GKE A;  4OA3 A;  3EDN A;  1SDJ A;  4Q60 A;  1W61 A;  1WPM A;  2MPB A;  3EJX A;  3EKM A;  1WPP A;  4JUU A;  1U1V A;  1W62 A;  4LG3 A;  1GQZ A;  2HAW A;  3FVE A;  1XUA A;  2YMA A;  3ICJ A;  2ZVF A;  5IWE A;  1QY9 A;  4JCI A;  1XUB A;  1BWZ A;  2H9F A;  3PVH A;  1T6K A;  1S7J A;  4PY9 A;  1U0K A;  5H2G A;  1K20 A;  3G98 A;  4K7X A;  4LB0 A;  1K23 A;  1I74 A;  2KW7 A;  4JBD A;  4DUN A;  5H2Y A;  1QYA A;  2EB0 A;  2PVZ A;  5M47 A;  1YM5 A;  2LT2 A;  4Q2H A;  2KPT A;  2ZXP A;  2AZP A;  2PW0 A;  4J9W A;  5ANP A;  1TM0 A;  3G7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...