1S7JA

Crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
260
structure length
260
Chain Sequence
b'MSYPYYIVDAFAEEVFKGNPAAVYVLEKWLPEAVMQNIAIENNLSETAFTVKEGQSYALRWFTPEREIDLCGHATLATAFVLFNYYSVAEETLHFTSQSGPLAVTKKEEYYYLDFPYILPERIPILPEYEAALGTKIYEAYLGRDLFFVLKDEETVAKITPDFSALKALDLGVGVIVTASGDSVDFVSRTFFPKLRINEDPVCGSAHANLIPYWGKRLNQTTLSAYQVSPRGGFLTCEVKENRVIIGGTAKLFAKGEAYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phenazine biosynthesis protein PhzF family
publication title Crystal structure of phenazine biosynthesis protein from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Biosynthetic protein
total genus 64
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1s7jA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1s7jA01
4IK0A 4JCIA 4K8LA 1XUAA 4JD7A 3EKMA 5M47A 1W62A 4LB0A 4JUUA 2OTNA 5IWEA 2PVZA 4Q2HA 2H9FA 2GKEA 2Q9HA 3G7KA 5H2GA 1W61A 2AZPA 1QYAA 4Q60A 1GQZA 2Q9JA 1S7JA 4JBDA 4DUNA 1T6KA 1SDJA 2GKJA 1BWZA 2PW0A 3FVEA 4J9XA 4J9WA 1U1VA 4K7XA 1U1WA 1U1XA 3EDNA 1QY9A 1YM5A 5HA4A 1TM0A 1U0KA 4IJZA 1XUBA 3EJXA 4K7GB 5H2YA
chains in the Genus database with same CATH superfamily
2IW4A 1WPMA 1WPPA 1IR6A 2Q9JA 1T6KA 2GKJA 2KPTA 2ENXA 4J9WA 3PVHA 1U1WA 3EDNA 1QY9A 1YM5A 1U0KA 1XUBA 3EJXA 3WQZA 4IK0A 4JD7A 3ICJA 5M47A 4RPAA 4JUUA 2PVZA 4Q2HA 2H9FA 2Q9HA 4LS9A 2AZPA 2QB8A 3PTJA 1S7JA 3DEVA 2ZXPA 1K23A 2PW0A 3FVEA 4J9XA 4PY9A 1U1VA 2LT2A 4K7XA 1U1XA 5HA4A 5H2YA 4LG3A 2QB6A 4JCIA 4K8LA 3IGHX 1W62A 3W5WA 2YMAA 2ZXRA 5IWEA 4GL6A 3G7KA 5H2GA 1W61A 2KW7A 4Q60A 2ZVFA 4DUNA 1SDJA 1BWZA 2QB7A 4OA3A 2MPBA 1XUAA 3EKMA 5ANPA 2ZXOA 4LB0A 1I74A 2OTNA 1K20A 2GKEA 1QYAA 1GQZA 4JBDA 3PW9A 2EB0A 2HAWA 3G98A 1TM0A 4IJZA 4K7GB
chains in the Genus database with same CATH topology
2IW4A 1WPMA 1WPPA 1IR6A 2Q9JA 1T6KA 2GKJA 2KPTA 2ENXA 4J9WA 3PVHA 1U1WA 3EDNA 1QY9A 1YM5A 1U0KA 1XUBA 3EJXA 3WQZA 4IK0A 4JD7A 3ICJA 5M47A 4RPAA 4JUUA 2PVZA 4Q2HA 2H9FA 2Q9HA 4LS9A 2AZPA 2QB8A 3PTJA 1S7JA 3DEVA 2ZXPA 1K23A 2PW0A 3FVEA 4J9XA 4PY9A 1U1VA 2LT2A 4K7XA 1U1XA 5HA4A 5H2YA 4LG3A 2QB6A 4JCIA 4K8LA 3IGHX 1W62A 3W5WA 2YMAA 2ZXRA 5IWEA 4GL6A 3G7KA 5H2GA 1W61A 2KW7A 4Q60A 2ZVFA 4DUNA 1SDJA 1BWZA 2QB7A 4OA3A 2MPBA 1XUAA 3EKMA 5ANPA 2ZXOA 4LB0A 1I74A 2OTNA 1K20A 2GKEA 1QYAA 1GQZA 4JBDA 3PW9A 2EB0A 2HAWA 3G98A 1TM0A 4IJZA 4K7GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IK0 A;  4JCI A;  4K8L A;  1XUA A;  4JD7 A;  3EKM A;  5M47 A;  1W62 A;  4LB0 A;  4JUU A;  2OTN A;  5IWE A;  2PVZ A;  4Q2H A;  2H9F A;  2GKE A;  2Q9H A;  3G7K A;  5H2G A;  1W61 A;  2AZP A;  1QYA A;  4Q60 A;  1GQZ A;  2Q9J A;  1S7J A;  4JBD A;  4DUN A;  1T6K A;  1SDJ A;  2GKJ A;  1BWZ A;  2PW0 A;  3FVE A;  4J9X A;  4J9W A;  1U1V A;  4K7X A;  1U1W A;  1U1X A;  3EDN A;  1QY9 A;  1YM5 A;  5HA4 A;  1TM0 A;  1U0K A;  4IJZ A;  1XUB A;  3EJX A;  4K7G B;  5H2Y A; 
#chains in the Genus database with same CATH topology
 2IW4 A;  1WPM A;  1WPP A;  1IR6 A;  2Q9J A;  1T6K A;  2GKJ A;  2KPT A;  2ENX A;  4J9W A;  3PVH A;  1U1W A;  3EDN A;  1QY9 A;  1YM5 A;  1U0K A;  1XUB A;  3EJX A;  3WQZ A;  4IK0 A;  4JD7 A;  3ICJ A;  5M47 A;  4RPA A;  4JUU A;  2PVZ A;  4Q2H A;  2H9F A;  2Q9H A;  4LS9 A;  2AZP A;  2QB8 A;  3PTJ A;  1S7J A;  3DEV A;  2ZXP A;  1K23 A;  2PW0 A;  3FVE A;  4J9X A;  4PY9 A;  1U1V A;  2LT2 A;  4K7X A;  1U1X A;  5HA4 A;  5H2Y A;  4LG3 A;  2QB6 A;  4JCI A;  4K8L A;  3IGH X;  1W62 A;  3W5W A;  2YMA A;  2ZXR A;  5IWE A;  4GL6 A;  3G7K A;  5H2G A;  1W61 A;  2KW7 A;  4Q60 A;  2ZVF A;  4DUN A;  1SDJ A;  1BWZ A;  2QB7 A;  4OA3 A;  2MPB A;  1XUA A;  3EKM A;  5ANP A;  2ZXO A;  4LB0 A;  1I74 A;  2OTN A;  1K20 A;  2GKE A;  1QYA A;  1GQZ A;  4JBD A;  3PW9 A;  2EB0 A;  2HAW A;  3G98 A;  1TM0 A;  4IJZ A;  4K7G B; 
#chains in the Genus database with same CATH homology
 2IW4 A;  1WPM A;  1WPP A;  1IR6 A;  2Q9J A;  1T6K A;  2GKJ A;  2KPT A;  2ENX A;  4J9W A;  3PVH A;  1U1W A;  3EDN A;  1QY9 A;  1YM5 A;  1U0K A;  1XUB A;  3EJX A;  3WQZ A;  4IK0 A;  4JD7 A;  3ICJ A;  5M47 A;  4RPA A;  4JUU A;  2PVZ A;  4Q2H A;  2H9F A;  2Q9H A;  4LS9 A;  2AZP A;  2QB8 A;  3PTJ A;  1S7J A;  3DEV A;  2ZXP A;  1K23 A;  2PW0 A;  3FVE A;  4J9X A;  4PY9 A;  1U1V A;  2LT2 A;  4K7X A;  1U1X A;  5HA4 A;  5H2Y A;  4LG3 A;  2QB6 A;  4JCI A;  4K8L A;  3IGH X;  1W62 A;  3W5W A;  2YMA A;  2ZXR A;  5IWE A;  4GL6 A;  3G7K A;  5H2G A;  1W61 A;  2KW7 A;  4Q60 A;  2ZVF A;  4DUN A;  1SDJ A;  1BWZ A;  2QB7 A;  4OA3 A;  2MPB A;  1XUA A;  3EKM A;  5ANP A;  2ZXO A;  4LB0 A;  1I74 A;  2OTN A;  1K20 A;  2GKE A;  1QYA A;  1GQZ A;  4JBD A;  3PW9 A;  2EB0 A;  2HAW A;  3G98 A;  1TM0 A;  4IJZ A;  4K7G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...