1S7JA

Crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
260
structure length
260
Chain Sequence
MSYPYYIVDAFAEEVFKGNPAAVYVLEKWLPEAVMQNIAIENNLSETAFTVKEGQSYALRWFTPEREIDLCGHATLATAFVLFNYYSVAEETLHFTSQSGPLAVTKKEEYYYLDFPYILPERIPILPEYEAALGTKIYEAYLGRDLFFVLKDEETVAKITPDFSALKALDLGVGVIVTASGDSVDFVSRTFFPKLRINEDPVCGSAHANLIPYWGKRLNQTTLSAYQVSPRGGFLTCEVKENRVIIGGTAKLFAKGEAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phenazine biosynthesis protein from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Biosynthetic protein
molecule keywords phenazine biosynthesis protein PhzF family
total genus 64
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1s7jA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1s7jA01
1S7JA 2GKEA 1QYAA 3FVEA 1BWZA 1XUAA 2Q9HA 5HA4A 3G7KA 5H2GA 4DUNA 1QY9A 4LB0A 2GKJA 3EKMA 4J9WA 1W62A 1W61A 1YM5A 4JD7A 1U0KA 1U1WA 4IJZA 1U1VA 5M47A 2PVZA 2AZPA 4K7XA 4K8LA 4K7GB 2Q9JA 5IWEA 4JUUA 1T6KA 4JCIA 5H2YA 1XUBA 1SDJA 3EDNA 4IK0A 4Q60A 4J9XA 3EJXA 2H9FA 2OTNA 2PW0A 4Q2HA 1GQZA 1U1XA 4JBDA 1TM0A
chains in the Genus database with same CATH superfamily
4RPAA 4GL6A 3PW9A 5HA4A 5H2GA 3WQZA 1QY9A 4LB0A 2GKJA 1W61A 2ZXPA 1U1VA 5M47A 3DEVA 2EB0A 2Q9JA 1WPPA 3PTJA 4J9XA 2ZVFA 2H9FA 2IW4A 2QB7A 1BWZA 3G98A 4OA3A 5ANPA 4J9WA 4JD7A 2PVZA 2YMAA 4K7GB 2ZXOA 5IWEA 2QB8A 4JUUA 4JCIA 2LT2A 1SDJA 3EDNA 4Q60A 1I74A 1S7JA 1QYAA 1XUAA 2Q9HA 4DUNA 3EKMA 2MPBA 1W62A 2KPTA 1YM5A 1U0KA 1IR6A 4IJZA 3W5WA 2AZPA 2HAWA 1T6KA 5H2YA 1XUBA 2KW7A 4IK0A 3EJXA 4LG3A 2PW0A 4Q2HA 1GQZA 1U1XA 4JBDA 1K20A 2GKEA 3FVEA 3G7KA 2ZXRA 4PY9A 1WPMA 1U1WA 4K8LA 4K7XA 3IGHX 2ENXA 2QB6A 4LS9A 2OTNA 3PVHA 3ICJA 1K23A 1TM0A
chains in the Genus database with same CATH topology
4RPAA 4GL6A 3PW9A 5HA4A 5H2GA 3WQZA 1QY9A 4LB0A 2GKJA 1W61A 2ZXPA 1U1VA 5M47A 3DEVA 2EB0A 2Q9JA 1WPPA 3PTJA 4J9XA 2ZVFA 2H9FA 2IW4A 2QB7A 1BWZA 3G98A 4OA3A 5ANPA 4J9WA 4JD7A 2PVZA 2YMAA 4K7GB 2ZXOA 5IWEA 2QB8A 4JUUA 4JCIA 2LT2A 1SDJA 3EDNA 4Q60A 1I74A 1S7JA 1QYAA 1XUAA 2Q9HA 4DUNA 3EKMA 2MPBA 1W62A 2KPTA 1YM5A 1U0KA 1IR6A 4IJZA 3W5WA 2AZPA 2HAWA 1T6KA 5H2YA 1XUBA 2KW7A 4IK0A 3EJXA 4LG3A 2PW0A 4Q2HA 1GQZA 1U1XA 4JBDA 1K20A 2GKEA 3FVEA 3G7KA 2ZXRA 4PY9A 1WPMA 1U1WA 4K8LA 4K7XA 3IGHX 2ENXA 2QB6A 4LS9A 2OTNA 3PVHA 3ICJA 1K23A 1TM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7J A;  2GKE A;  1QYA A;  3FVE A;  1BWZ A;  1XUA A;  2Q9H A;  5HA4 A;  3G7K A;  5H2G A;  4DUN A;  1QY9 A;  4LB0 A;  2GKJ A;  3EKM A;  4J9W A;  1W62 A;  1W61 A;  1YM5 A;  4JD7 A;  1U0K A;  1U1W A;  4IJZ A;  1U1V A;  5M47 A;  2PVZ A;  2AZP A;  4K7X A;  4K8L A;  4K7G B;  2Q9J A;  5IWE A;  4JUU A;  1T6K A;  4JCI A;  5H2Y A;  1XUB A;  1SDJ A;  3EDN A;  4IK0 A;  4Q60 A;  4J9X A;  3EJX A;  2H9F A;  2OTN A;  2PW0 A;  4Q2H A;  1GQZ A;  1U1X A;  4JBD A;  1TM0 A; 
#chains in the Genus database with same CATH topology
 4RPA A;  4GL6 A;  3PW9 A;  5HA4 A;  5H2G A;  3WQZ A;  1QY9 A;  4LB0 A;  2GKJ A;  1W61 A;  2ZXP A;  1U1V A;  5M47 A;  3DEV A;  2EB0 A;  2Q9J A;  1WPP A;  3PTJ A;  4J9X A;  2ZVF A;  2H9F A;  2IW4 A;  2QB7 A;  1BWZ A;  3G98 A;  4OA3 A;  5ANP A;  4J9W A;  4JD7 A;  2PVZ A;  2YMA A;  4K7G B;  2ZXO A;  5IWE A;  2QB8 A;  4JUU A;  4JCI A;  2LT2 A;  1SDJ A;  3EDN A;  4Q60 A;  1I74 A;  1S7J A;  1QYA A;  1XUA A;  2Q9H A;  4DUN A;  3EKM A;  2MPB A;  1W62 A;  2KPT A;  1YM5 A;  1U0K A;  1IR6 A;  4IJZ A;  3W5W A;  2AZP A;  2HAW A;  1T6K A;  5H2Y A;  1XUB A;  2KW7 A;  4IK0 A;  3EJX A;  4LG3 A;  2PW0 A;  4Q2H A;  1GQZ A;  1U1X A;  4JBD A;  1K20 A;  2GKE A;  3FVE A;  3G7K A;  2ZXR A;  4PY9 A;  1WPM A;  1U1W A;  4K8L A;  4K7X A;  3IGH X;  2ENX A;  2QB6 A;  4LS9 A;  2OTN A;  3PVH A;  3ICJ A;  1K23 A;  1TM0 A; 
#chains in the Genus database with same CATH homology
 4RPA A;  4GL6 A;  3PW9 A;  5HA4 A;  5H2G A;  3WQZ A;  1QY9 A;  4LB0 A;  2GKJ A;  1W61 A;  2ZXP A;  1U1V A;  5M47 A;  3DEV A;  2EB0 A;  2Q9J A;  1WPP A;  3PTJ A;  4J9X A;  2ZVF A;  2H9F A;  2IW4 A;  2QB7 A;  1BWZ A;  3G98 A;  4OA3 A;  5ANP A;  4J9W A;  4JD7 A;  2PVZ A;  2YMA A;  4K7G B;  2ZXO A;  5IWE A;  2QB8 A;  4JUU A;  4JCI A;  2LT2 A;  1SDJ A;  3EDN A;  4Q60 A;  1I74 A;  1S7J A;  1QYA A;  1XUA A;  2Q9H A;  4DUN A;  3EKM A;  2MPB A;  1W62 A;  2KPT A;  1YM5 A;  1U0K A;  1IR6 A;  4IJZ A;  3W5W A;  2AZP A;  2HAW A;  1T6K A;  5H2Y A;  1XUB A;  2KW7 A;  4IK0 A;  3EJX A;  4LG3 A;  2PW0 A;  4Q2H A;  1GQZ A;  1U1X A;  4JBD A;  1K20 A;  2GKE A;  3FVE A;  3G7K A;  2ZXR A;  4PY9 A;  1WPM A;  1U1W A;  4K8L A;  4K7X A;  3IGH X;  2ENX A;  2QB6 A;  4LS9 A;  2OTN A;  3PVH A;  3ICJ A;  1K23 A;  1TM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...