3PTJA

Structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
153
Chain Sequence
SASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKMRLNFITVRKLTSKADAFEYADQVLEKWYPSMEEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional assays of AtTLP18.3 identify its novel acid phosphatase activity in thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords UPF0603 protein At1g54780, chloroplastic
total genus 53
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3ptjA00
3PVHA 3PTJA 3PW9A 5ANPA 2MPBA 2KPTA 4OA3A 2KW7A 2LT2A
chains in the Genus database with same CATH superfamily
4PY9A 4IJZA 3W5WA 5ANPA 3WQZA 1U1VA 3PW9A 2H9FA 4Q60A 2Q9HA 2LT2A 2YMAA 2QB8A 1YM5A 5HA4A 3ICJA 4LG3A 2IW4A 2KPTA 1T6KA 4GL6A 2EB0A 1WPMA 4J9XA 2QB7A 3PTJA 2ZXOA 4RPAA 5IWEA 1S7JA 3EDNA 1U1XA 2GKEA 2GKJA 4K7XA 2ZVFA 1GQZA 2MPBA 2PVZA 3FVEA 2ZXRA 2HAWA 2ZXPA 4JBDA 4OA3A 4IK0A 2OTNA 1QYAA 1W62A 4K7GB 1XUAA 2AZPA 1U0KA 1K23A 1IR6A 5M47A 3EJXA 1U1WA 4JUUA 3PVHA 3DEVA 4J9WA 2QB6A 4LB0A 4JCIA 2Q9JA 4JD7A 1SDJA 4LS9A 1QY9A 4K8LA 3G7KA 1BWZA 2KW7A 1TM0A 5H2YA 3EKMA 2ENXA 3G98A 5H2GA 1WPPA 1K20A 1W61A 4DUNA 4Q2HA 3IGHX 1I74A 1XUBA 2PW0A
chains in the Genus database with same CATH topology
4PY9A 4IJZA 3W5WA 5ANPA 3WQZA 1U1VA 3PW9A 2H9FA 4Q60A 2Q9HA 2LT2A 2YMAA 2QB8A 1YM5A 5HA4A 3ICJA 4LG3A 2IW4A 2KPTA 1T6KA 4GL6A 2EB0A 1WPMA 4J9XA 2QB7A 3PTJA 2ZXOA 4RPAA 5IWEA 1S7JA 3EDNA 1U1XA 2GKEA 2GKJA 4K7XA 2ZVFA 1GQZA 2MPBA 2PVZA 3FVEA 2ZXRA 2HAWA 2ZXPA 4JBDA 4OA3A 4IK0A 2OTNA 1QYAA 1W62A 4K7GB 1XUAA 2AZPA 1U0KA 1K23A 1IR6A 5M47A 3EJXA 1U1WA 4JUUA 3PVHA 3DEVA 4J9WA 2QB6A 4LB0A 4JCIA 2Q9JA 4JD7A 1SDJA 4LS9A 1QY9A 4K8LA 3G7KA 1BWZA 2KW7A 1TM0A 5H2YA 3EKMA 2ENXA 3G98A 5H2GA 1WPPA 1K20A 1W61A 4DUNA 4Q2HA 3IGHX 1I74A 1XUBA 2PW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVH A;  3PTJ A;  3PW9 A;  5ANP A;  2MPB A;  2KPT A;  4OA3 A;  2KW7 A;  2LT2 A; 
#chains in the Genus database with same CATH topology
 4PY9 A;  4IJZ A;  3W5W A;  5ANP A;  3WQZ A;  1U1V A;  3PW9 A;  2H9F A;  4Q60 A;  2Q9H A;  2LT2 A;  2YMA A;  2QB8 A;  1YM5 A;  5HA4 A;  3ICJ A;  4LG3 A;  2IW4 A;  2KPT A;  1T6K A;  4GL6 A;  2EB0 A;  1WPM A;  4J9X A;  2QB7 A;  3PTJ A;  2ZXO A;  4RPA A;  5IWE A;  1S7J A;  3EDN A;  1U1X A;  2GKE A;  2GKJ A;  4K7X A;  2ZVF A;  1GQZ A;  2MPB A;  2PVZ A;  3FVE A;  2ZXR A;  2HAW A;  2ZXP A;  4JBD A;  4OA3 A;  4IK0 A;  2OTN A;  1QYA A;  1W62 A;  4K7G B;  1XUA A;  2AZP A;  1U0K A;  1K23 A;  1IR6 A;  5M47 A;  3EJX A;  1U1W A;  4JUU A;  3PVH A;  3DEV A;  4J9W A;  2QB6 A;  4LB0 A;  4JCI A;  2Q9J A;  4JD7 A;  1SDJ A;  4LS9 A;  1QY9 A;  4K8L A;  3G7K A;  1BWZ A;  2KW7 A;  1TM0 A;  5H2Y A;  3EKM A;  2ENX A;  3G98 A;  5H2G A;  1WPP A;  1K20 A;  1W61 A;  4DUN A;  4Q2H A;  3IGH X;  1I74 A;  1XUB A;  2PW0 A; 
#chains in the Genus database with same CATH homology
 4PY9 A;  4IJZ A;  3W5W A;  5ANP A;  3WQZ A;  1U1V A;  3PW9 A;  2H9F A;  4Q60 A;  2Q9H A;  2LT2 A;  2YMA A;  2QB8 A;  1YM5 A;  5HA4 A;  3ICJ A;  4LG3 A;  2IW4 A;  2KPT A;  1T6K A;  4GL6 A;  2EB0 A;  1WPM A;  4J9X A;  2QB7 A;  3PTJ A;  2ZXO A;  4RPA A;  5IWE A;  1S7J A;  3EDN A;  1U1X A;  2GKE A;  2GKJ A;  4K7X A;  2ZVF A;  1GQZ A;  2MPB A;  2PVZ A;  3FVE A;  2ZXR A;  2HAW A;  2ZXP A;  4JBD A;  4OA3 A;  4IK0 A;  2OTN A;  1QYA A;  1W62 A;  4K7G B;  1XUA A;  2AZP A;  1U0K A;  1K23 A;  1IR6 A;  5M47 A;  3EJX A;  1U1W A;  4JUU A;  3PVH A;  3DEV A;  4J9W A;  2QB6 A;  4LB0 A;  4JCI A;  2Q9J A;  4JD7 A;  1SDJ A;  4LS9 A;  1QY9 A;  4K8L A;  3G7K A;  1BWZ A;  2KW7 A;  1TM0 A;  5H2Y A;  3EKM A;  2ENX A;  3G98 A;  5H2G A;  1WPP A;  1K20 A;  1W61 A;  4DUN A;  4Q2H A;  3IGH X;  1I74 A;  1XUB A;  2PW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...