3PTJA

Structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
153
Chain Sequence
SASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKMRLNFITVRKLTSKADAFEYADQVLEKWYPSMEEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional assays of AtTLP18.3 identify its novel acid phosphatase activity in thylakoid lumen
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords UPF0603 protein At1g54780, chloroplastic
total genus 53
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2010-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3ptjA00
4OA3A 2MPBA 5ANPA 3PW9A 2KPTA 2LT2A 3PVHA 2KW7A 3PTJA
chains in the Genus database with same CATH superfamily
2H9FA 3PVHA 4JBDA 4JCIA 1XUBA 2QB6A 5H2GA 2KPTA 4LG3A 4Q2HA 1U1VA 1WPMA 2EB0A 2ZXRA 3W5WA 2Q9JA 4LS9A 3G98A 4OA3A 4GL6A 3EJXA 4Q60A 4RPAA 3PTJA 2YMAA 3DEVA 3EDNA 2HAWA 1XUAA 1S7JA 3EKMA 3FVEA 2GKJA 2ZVFA 4IJZA 1IR6A 1K23A 2QB8A 1QY9A 1W62A 1WPPA 4K8LA 1GQZA 4IK0A 1K20A 1YM5A 1W61A 2AZPA 2MPBA 1BWZA 1T6KA 1SDJA 2PW0A 5HA4A 1U1WA 4PY9A 1I74A 5M47A 2QB7A 5ANPA 2LT2A 1TM0A 1U1XA 4DUNA 4J9WA 4LB0A 4K7GB 2PVZA 3IGHX 2KW7A 5H2YA 3WQZA 4J9XA 4JUUA 2OTNA 2ZXOA 2ZXPA 2IW4A 5IWEA 4JD7A 3ICJA 3PW9A 4K7XA 2ENXA 1U0KA 1QYAA 2Q9HA 3G7KA 2GKEA
chains in the Genus database with same CATH topology
2H9FA 3PVHA 4JBDA 4JCIA 1XUBA 2QB6A 5H2GA 2KPTA 4LG3A 4Q2HA 1U1VA 1WPMA 2EB0A 2ZXRA 3W5WA 2Q9JA 4LS9A 3G98A 4OA3A 4GL6A 3EJXA 4Q60A 4RPAA 3PTJA 2YMAA 3DEVA 3EDNA 2HAWA 1XUAA 1S7JA 3EKMA 3FVEA 2GKJA 2ZVFA 4IJZA 1IR6A 1K23A 2QB8A 1QY9A 1W62A 1WPPA 4K8LA 1GQZA 4IK0A 1K20A 1YM5A 1W61A 2AZPA 2MPBA 1BWZA 1T6KA 1SDJA 2PW0A 5HA4A 1U1WA 4PY9A 1I74A 5M47A 2QB7A 5ANPA 2LT2A 1TM0A 1U1XA 4DUNA 4J9WA 4LB0A 4K7GB 2PVZA 3IGHX 2KW7A 5H2YA 3WQZA 4J9XA 4JUUA 2OTNA 2ZXOA 2ZXPA 2IW4A 5IWEA 4JD7A 3ICJA 3PW9A 4K7XA 2ENXA 1U0KA 1QYAA 2Q9HA 3G7KA 2GKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OA3 A;  2MPB A;  5ANP A;  3PW9 A;  2KPT A;  2LT2 A;  3PVH A;  2KW7 A;  3PTJ A; 
#chains in the Genus database with same CATH topology
 2H9F A;  3PVH A;  4JBD A;  4JCI A;  1XUB A;  2QB6 A;  5H2G A;  2KPT A;  4LG3 A;  4Q2H A;  1U1V A;  1WPM A;  2EB0 A;  2ZXR A;  3W5W A;  2Q9J A;  4LS9 A;  3G98 A;  4OA3 A;  4GL6 A;  3EJX A;  4Q60 A;  4RPA A;  3PTJ A;  2YMA A;  3DEV A;  3EDN A;  2HAW A;  1XUA A;  1S7J A;  3EKM A;  3FVE A;  2GKJ A;  2ZVF A;  4IJZ A;  1IR6 A;  1K23 A;  2QB8 A;  1QY9 A;  1W62 A;  1WPP A;  4K8L A;  1GQZ A;  4IK0 A;  1K20 A;  1YM5 A;  1W61 A;  2AZP A;  2MPB A;  1BWZ A;  1T6K A;  1SDJ A;  2PW0 A;  5HA4 A;  1U1W A;  4PY9 A;  1I74 A;  5M47 A;  2QB7 A;  5ANP A;  2LT2 A;  1TM0 A;  1U1X A;  4DUN A;  4J9W A;  4LB0 A;  4K7G B;  2PVZ A;  3IGH X;  2KW7 A;  5H2Y A;  3WQZ A;  4J9X A;  4JUU A;  2OTN A;  2ZXO A;  2ZXP A;  2IW4 A;  5IWE A;  4JD7 A;  3ICJ A;  3PW9 A;  4K7X A;  2ENX A;  1U0K A;  1QYA A;  2Q9H A;  3G7K A;  2GKE A; 
#chains in the Genus database with same CATH homology
 2H9F A;  3PVH A;  4JBD A;  4JCI A;  1XUB A;  2QB6 A;  5H2G A;  2KPT A;  4LG3 A;  4Q2H A;  1U1V A;  1WPM A;  2EB0 A;  2ZXR A;  3W5W A;  2Q9J A;  4LS9 A;  3G98 A;  4OA3 A;  4GL6 A;  3EJX A;  4Q60 A;  4RPA A;  3PTJ A;  2YMA A;  3DEV A;  3EDN A;  2HAW A;  1XUA A;  1S7J A;  3EKM A;  3FVE A;  2GKJ A;  2ZVF A;  4IJZ A;  1IR6 A;  1K23 A;  2QB8 A;  1QY9 A;  1W62 A;  1WPP A;  4K8L A;  1GQZ A;  4IK0 A;  1K20 A;  1YM5 A;  1W61 A;  2AZP A;  2MPB A;  1BWZ A;  1T6K A;  1SDJ A;  2PW0 A;  5HA4 A;  1U1W A;  4PY9 A;  1I74 A;  5M47 A;  2QB7 A;  5ANP A;  2LT2 A;  1TM0 A;  1U1X A;  4DUN A;  4J9W A;  4LB0 A;  4K7G B;  2PVZ A;  3IGH X;  2KW7 A;  5H2Y A;  3WQZ A;  4J9X A;  4JUU A;  2OTN A;  2ZXO A;  2ZXP A;  2IW4 A;  5IWE A;  4JD7 A;  3ICJ A;  3PW9 A;  4K7X A;  2ENX A;  1U0K A;  1QYA A;  2Q9H A;  3G7K A;  2GKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...