4DUNA

1.76a x-ray crystal structure of a putative phenazine biosynthesis phzc/phzf protein from clostridium difficile (strain 630)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
259
structure length
259
Chain Sequence
b'AMEYYIVDSFATKLFKGNPAGVCVLDRRIPLELMQKIAEENNLPETAFVVKGKGNYELRWFTPKAEIDLCGHATLAAAYVISNFIDVNVKKIDFFTQSGKLEVTRNGNLYEMIFPEIMPIEIELSPQQANLIGCVPSDVYSSRDLILLLNSEQEVINYKPNYAQLRKLTDWLGIIITAQGSNTDFVSRYFCPELDSEDPVTGSSHCNLIPYWSEKLGKHKMVAAQLSNRGGIIQCEVLKDNTVKISGEAVLFMQGTIKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phenazine biosynthesis PhzC/PhzF protein
publication title 1.76A X-ray Crystal Structure of a Putative Phenazine Biosynthesis PhzC/PhzF Protein from Clostridium difficile (strain 630)
rcsb
source organism Clostridium difficile
molecule tags Biosynthetic protein
total genus 75
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4dunA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4dunA01
2AZPA 3G7KA 5M47A 5IWEA 4LB0A 5H2YA 4JBDA 4Q2HA 1S7JA 1QY9A 2PW0A 4J9XA 2Q9HA 2Q9JA 2PVZA 5H2GA 1U1XA 1U1VA 2GKEA 4JUUA 1W62A 4DUNA 4IJZA 4K7GB 4JD7A 1XUBA 3EDNA 1QYAA 4IK0A 2H9FA 4J9WA 1W61A 4K8LA 1SDJA 5HA4A 3EJXA 4K7XA 1YM5A 1GQZA 1U1WA 2OTNA 4JCIA 4Q60A 1T6KA 1XUAA 1U0KA 3FVEA 3EKMA 1TM0A 1BWZA 2GKJA
chains in the Genus database with same CATH superfamily
2AZPA 5M47A 2QB6A 4JBDA 1S7JA 2PW0A 4J9XA 1U1XA 4IJZA 4K7GB 3EDNA 2IW4A 4IK0A 4J9WA 1K23A 1WPPA 1K20A 4PY9A 4JCIA 1T6KA 1XUAA 3IGHX 3ICJA 2MPBA 3G7KA 5IWEA 4Q2HA 2Q9HA 2ENXA 2Q9JA 3PW9A 1U1VA 2ZVFA 1QYAA 3W5WA 2ZXOA 4GL6A 2QB7A 3FVEA 1BWZA 2GKJA 3DEVA 2HAWA 4LB0A 5H2YA 2ZXPA 1IR6A 5H2GA 1I74A 2GKEA 1W62A 3PVHA 3PTJA 4JD7A 1XUBA 4LG3A 1W61A 3WQZA 4K8LA 3EJXA 1GQZA 2ZXRA 1U1WA 1U0KA 3EKMA 4LS9A 2EB0A 1QY9A 2KW7A 2PVZA 2QB8A 4JUUA 4DUNA 2LT2A 4OA3A 5ANPA 3G98A 2H9FA 2YMAA 1SDJA 5HA4A 4K7XA 1YM5A 2OTNA 4Q60A 2KPTA 1TM0A 1WPMA 4RPAA
chains in the Genus database with same CATH topology
2AZPA 5M47A 2QB6A 4JBDA 1S7JA 2PW0A 4J9XA 1U1XA 4IJZA 4K7GB 3EDNA 2IW4A 4IK0A 4J9WA 1K23A 1WPPA 1K20A 4PY9A 4JCIA 1T6KA 1XUAA 3IGHX 3ICJA 2MPBA 3G7KA 5IWEA 4Q2HA 2Q9HA 2ENXA 2Q9JA 3PW9A 1U1VA 2ZVFA 1QYAA 3W5WA 2ZXOA 4GL6A 2QB7A 3FVEA 1BWZA 2GKJA 3DEVA 2HAWA 4LB0A 5H2YA 2ZXPA 1IR6A 5H2GA 1I74A 2GKEA 1W62A 3PVHA 3PTJA 4JD7A 1XUBA 4LG3A 1W61A 3WQZA 4K8LA 3EJXA 1GQZA 2ZXRA 1U1WA 1U0KA 3EKMA 4LS9A 2EB0A 1QY9A 2KW7A 2PVZA 2QB8A 4JUUA 4DUNA 2LT2A 4OA3A 5ANPA 3G98A 2H9FA 2YMAA 1SDJA 5HA4A 4K7XA 1YM5A 2OTNA 4Q60A 2KPTA 1TM0A 1WPMA 4RPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZP A;  3G7K A;  5M47 A;  5IWE A;  4LB0 A;  5H2Y A;  4JBD A;  4Q2H A;  1S7J A;  1QY9 A;  2PW0 A;  4J9X A;  2Q9H A;  2Q9J A;  2PVZ A;  5H2G A;  1U1X A;  1U1V A;  2GKE A;  4JUU A;  1W62 A;  4DUN A;  4IJZ A;  4K7G B;  4JD7 A;  1XUB A;  3EDN A;  1QYA A;  4IK0 A;  2H9F A;  4J9W A;  1W61 A;  4K8L A;  1SDJ A;  5HA4 A;  3EJX A;  4K7X A;  1YM5 A;  1GQZ A;  1U1W A;  2OTN A;  4JCI A;  4Q60 A;  1T6K A;  1XUA A;  1U0K A;  3FVE A;  3EKM A;  1TM0 A;  1BWZ A;  2GKJ A; 
#chains in the Genus database with same CATH topology
 2AZP A;  5M47 A;  2QB6 A;  4JBD A;  1S7J A;  2PW0 A;  4J9X A;  1U1X A;  4IJZ A;  4K7G B;  3EDN A;  2IW4 A;  4IK0 A;  4J9W A;  1K23 A;  1WPP A;  1K20 A;  4PY9 A;  4JCI A;  1T6K A;  1XUA A;  3IGH X;  3ICJ A;  2MPB A;  3G7K A;  5IWE A;  4Q2H A;  2Q9H A;  2ENX A;  2Q9J A;  3PW9 A;  1U1V A;  2ZVF A;  1QYA A;  3W5W A;  2ZXO A;  4GL6 A;  2QB7 A;  3FVE A;  1BWZ A;  2GKJ A;  3DEV A;  2HAW A;  4LB0 A;  5H2Y A;  2ZXP A;  1IR6 A;  5H2G A;  1I74 A;  2GKE A;  1W62 A;  3PVH A;  3PTJ A;  4JD7 A;  1XUB A;  4LG3 A;  1W61 A;  3WQZ A;  4K8L A;  3EJX A;  1GQZ A;  2ZXR A;  1U1W A;  1U0K A;  3EKM A;  4LS9 A;  2EB0 A;  1QY9 A;  2KW7 A;  2PVZ A;  2QB8 A;  4JUU A;  4DUN A;  2LT2 A;  4OA3 A;  5ANP A;  3G98 A;  2H9F A;  2YMA A;  1SDJ A;  5HA4 A;  4K7X A;  1YM5 A;  2OTN A;  4Q60 A;  2KPT A;  1TM0 A;  1WPM A;  4RPA A; 
#chains in the Genus database with same CATH homology
 2AZP A;  5M47 A;  2QB6 A;  4JBD A;  1S7J A;  2PW0 A;  4J9X A;  1U1X A;  4IJZ A;  4K7G B;  3EDN A;  2IW4 A;  4IK0 A;  4J9W A;  1K23 A;  1WPP A;  1K20 A;  4PY9 A;  4JCI A;  1T6K A;  1XUA A;  3IGH X;  3ICJ A;  2MPB A;  3G7K A;  5IWE A;  4Q2H A;  2Q9H A;  2ENX A;  2Q9J A;  3PW9 A;  1U1V A;  2ZVF A;  1QYA A;  3W5W A;  2ZXO A;  4GL6 A;  2QB7 A;  3FVE A;  1BWZ A;  2GKJ A;  3DEV A;  2HAW A;  4LB0 A;  5H2Y A;  2ZXP A;  1IR6 A;  5H2G A;  1I74 A;  2GKE A;  1W62 A;  3PVH A;  3PTJ A;  4JD7 A;  1XUB A;  4LG3 A;  1W61 A;  3WQZ A;  4K8L A;  3EJX A;  1GQZ A;  2ZXR A;  1U1W A;  1U0K A;  3EKM A;  4LS9 A;  2EB0 A;  1QY9 A;  2KW7 A;  2PVZ A;  2QB8 A;  4JUU A;  4DUN A;  2LT2 A;  4OA3 A;  5ANP A;  3G98 A;  2H9F A;  2YMA A;  1SDJ A;  5HA4 A;  4K7X A;  1YM5 A;  2OTN A;  4Q60 A;  2KPT A;  1TM0 A;  1WPM A;  4RPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...