4DUNA

1.76a x-ray crystal structure of a putative phenazine biosynthesis phzc/phzf protein from clostridium difficile (strain 630)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
259
structure length
259
Chain Sequence
AMEYYIVDSFATKLFKGNPAGVCVLDRRIPLELMQKIAEENNLPETAFVVKGKGNYELRWFTPKAEIDLCGHATLAAAYVISNFIDVNVKKIDFFTQSGKLEVTRNGNLYEMIFPEIMPIEIELSPQQANLIGCVPSDVYSSRDLILLLNSEQEVINYKPNYAQLRKLTDWLGIIITAQGSNTDFVSRYFCPELDSEDPVTGSSHCNLIPYWSEKLGKHKMVAAQLSNRGGIIQCEVLKDNTVKISGEAVLFMQGTIKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.76A X-ray Crystal Structure of a Putative Phenazine Biosynthesis PhzC/PhzF Protein from Clostridium difficile (strain 630)
rcsb
source organism Clostridium difficile
molecule tags Biosynthetic protein
molecule keywords Putative phenazine biosynthesis PhzC/PhzF protein
total genus 75
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4dunA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4dunA01
1W62A 4DUNA 5M47A 1BWZA 2Q9JA 4JCIA 4Q2HA 2GKJA 2PVZA 2Q9HA 5H2YA 1U1WA 1YM5A 1QY9A 3EDNA 4J9WA 1S7JA 2H9FA 2GKEA 1QYAA 4IJZA 2PW0A 3EKMA 4J9XA 4IK0A 1T6KA 1W61A 4Q60A 5HA4A 1GQZA 1U0KA 3EJXA 4K7GB 2OTNA 4K8LA 4LB0A 3FVEA 2AZPA 5H2GA 3G7KA 1XUAA 1SDJA 4JUUA 1U1XA 4JD7A 1U1VA 5IWEA 1TM0A 4K7XA 1XUBA 4JBDA
chains in the Genus database with same CATH superfamily
5M47A 1BWZA 4GL6A 2GKJA 1WPPA 2QB6A 1WPMA 2QB7A 3ICJA 2IW4A 4IK0A 3PVHA 1T6KA 3W5WA 3EJXA 4K7GB 2AZPA 2LT2A 1U1XA 2MPBA 1U1VA 2YMAA 4JBDA 1W62A 2QB8A 2Q9JA 4J9WA 1S7JA 2H9FA 3DEVA 1QYAA 2HAWA 1U0KA 1I74A 2KPTA 2ZXPA 2KW7A 4DUNA 3WQZA 3IGHX 1K23A 4Q2HA 2PVZA 5H2YA 1QY9A 3PTJA 4IJZA 2PW0A 3EKMA 3G98A 1W61A 2ZVFA 1GQZA 4K8LA 4LB0A 3FVEA 5H2GA 3G7KA 1XUAA 1SDJA 4OA3A 1TM0A 4RPAA 4JCIA 3PW9A 2Q9HA 1U1WA 1YM5A 3EDNA 2ENXA 4LG3A 2GKEA 2ZXRA 4J9XA 4Q60A 4LS9A 5HA4A 2OTNA 2EB0A 5ANPA 2ZXOA 4PY9A 1IR6A 4JUUA 4JD7A 5IWEA 1K20A 4K7XA 1XUBA
chains in the Genus database with same CATH topology
5M47A 1BWZA 4GL6A 2GKJA 1WPPA 2QB6A 1WPMA 2QB7A 3ICJA 2IW4A 4IK0A 3PVHA 1T6KA 3W5WA 3EJXA 4K7GB 2AZPA 2LT2A 1U1XA 2MPBA 1U1VA 2YMAA 4JBDA 1W62A 2QB8A 2Q9JA 4J9WA 1S7JA 2H9FA 3DEVA 1QYAA 2HAWA 1U0KA 1I74A 2KPTA 2ZXPA 2KW7A 4DUNA 3WQZA 3IGHX 1K23A 4Q2HA 2PVZA 5H2YA 1QY9A 3PTJA 4IJZA 2PW0A 3EKMA 3G98A 1W61A 2ZVFA 1GQZA 4K8LA 4LB0A 3FVEA 5H2GA 3G7KA 1XUAA 1SDJA 4OA3A 1TM0A 4RPAA 4JCIA 3PW9A 2Q9HA 1U1WA 1YM5A 3EDNA 2ENXA 4LG3A 2GKEA 2ZXRA 4J9XA 4Q60A 4LS9A 5HA4A 2OTNA 2EB0A 5ANPA 2ZXOA 4PY9A 1IR6A 4JUUA 4JD7A 5IWEA 1K20A 4K7XA 1XUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W62 A;  4DUN A;  5M47 A;  1BWZ A;  2Q9J A;  4JCI A;  4Q2H A;  2GKJ A;  2PVZ A;  2Q9H A;  5H2Y A;  1U1W A;  1YM5 A;  1QY9 A;  3EDN A;  4J9W A;  1S7J A;  2H9F A;  2GKE A;  1QYA A;  4IJZ A;  2PW0 A;  3EKM A;  4J9X A;  4IK0 A;  1T6K A;  1W61 A;  4Q60 A;  5HA4 A;  1GQZ A;  1U0K A;  3EJX A;  4K7G B;  2OTN A;  4K8L A;  4LB0 A;  3FVE A;  2AZP A;  5H2G A;  3G7K A;  1XUA A;  1SDJ A;  4JUU A;  1U1X A;  4JD7 A;  1U1V A;  5IWE A;  1TM0 A;  4K7X A;  1XUB A;  4JBD A; 
#chains in the Genus database with same CATH topology
 5M47 A;  1BWZ A;  4GL6 A;  2GKJ A;  1WPP A;  2QB6 A;  1WPM A;  2QB7 A;  3ICJ A;  2IW4 A;  4IK0 A;  3PVH A;  1T6K A;  3W5W A;  3EJX A;  4K7G B;  2AZP A;  2LT2 A;  1U1X A;  2MPB A;  1U1V A;  2YMA A;  4JBD A;  1W62 A;  2QB8 A;  2Q9J A;  4J9W A;  1S7J A;  2H9F A;  3DEV A;  1QYA A;  2HAW A;  1U0K A;  1I74 A;  2KPT A;  2ZXP A;  2KW7 A;  4DUN A;  3WQZ A;  3IGH X;  1K23 A;  4Q2H A;  2PVZ A;  5H2Y A;  1QY9 A;  3PTJ A;  4IJZ A;  2PW0 A;  3EKM A;  3G98 A;  1W61 A;  2ZVF A;  1GQZ A;  4K8L A;  4LB0 A;  3FVE A;  5H2G A;  3G7K A;  1XUA A;  1SDJ A;  4OA3 A;  1TM0 A;  4RPA A;  4JCI A;  3PW9 A;  2Q9H A;  1U1W A;  1YM5 A;  3EDN A;  2ENX A;  4LG3 A;  2GKE A;  2ZXR A;  4J9X A;  4Q60 A;  4LS9 A;  5HA4 A;  2OTN A;  2EB0 A;  5ANP A;  2ZXO A;  4PY9 A;  1IR6 A;  4JUU A;  4JD7 A;  5IWE A;  1K20 A;  4K7X A;  1XUB A; 
#chains in the Genus database with same CATH homology
 5M47 A;  1BWZ A;  4GL6 A;  2GKJ A;  1WPP A;  2QB6 A;  1WPM A;  2QB7 A;  3ICJ A;  2IW4 A;  4IK0 A;  3PVH A;  1T6K A;  3W5W A;  3EJX A;  4K7G B;  2AZP A;  2LT2 A;  1U1X A;  2MPB A;  1U1V A;  2YMA A;  4JBD A;  1W62 A;  2QB8 A;  2Q9J A;  4J9W A;  1S7J A;  2H9F A;  3DEV A;  1QYA A;  2HAW A;  1U0K A;  1I74 A;  2KPT A;  2ZXP A;  2KW7 A;  4DUN A;  3WQZ A;  3IGH X;  1K23 A;  4Q2H A;  2PVZ A;  5H2Y A;  1QY9 A;  3PTJ A;  4IJZ A;  2PW0 A;  3EKM A;  3G98 A;  1W61 A;  2ZVF A;  1GQZ A;  4K8L A;  4LB0 A;  3FVE A;  5H2G A;  3G7K A;  1XUA A;  1SDJ A;  4OA3 A;  1TM0 A;  4RPA A;  4JCI A;  3PW9 A;  2Q9H A;  1U1W A;  1YM5 A;  3EDN A;  2ENX A;  4LG3 A;  2GKE A;  2ZXR A;  4J9X A;  4Q60 A;  4LS9 A;  5HA4 A;  2OTN A;  2EB0 A;  5ANP A;  2ZXO A;  4PY9 A;  1IR6 A;  4JUU A;  4JD7 A;  5IWE A;  1K20 A;  4K7X A;  1XUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...