4DUNA

1.76a x-ray crystal structure of a putative phenazine biosynthesis phzc/phzf protein from clostridium difficile (strain 630)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
259
structure length
259
Chain Sequence
AMEYYIVDSFATKLFKGNPAGVCVLDRRIPLELMQKIAEENNLPETAFVVKGKGNYELRWFTPKAEIDLCGHATLAAAYVISNFIDVNVKKIDFFTQSGKLEVTRNGNLYEMIFPEIMPIEIELSPQQANLIGCVPSDVYSSRDLILLLNSEQEVINYKPNYAQLRKLTDWLGIIITAQGSNTDFVSRYFCPELDSEDPVTGSSHCNLIPYWSEKLGKHKMVAAQLSNRGGIIQCEVLKDNTVKISGEAVLFMQGTIKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.76A X-ray Crystal Structure of a Putative Phenazine Biosynthesis PhzC/PhzF Protein from Clostridium difficile (strain 630)
rcsb
source organism Clostridium difficile
molecule tags Biosynthetic protein
molecule keywords Putative phenazine biosynthesis PhzC/PhzF protein
total genus 75
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4dunA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4dunA01
5H2YA 1U1WA 1GQZA 4DUNA 4IK0A 1U1VA 2Q9HA 5IWEA 4JD7A 1S7JA 1U1XA 3FVEA 4J9XA 5M47A 1W62A 2OTNA 5H2GA 4Q2HA 2PW0A 3EKMA 4IJZA 4JCIA 1YM5A 4K8LA 4Q60A 1T6KA 1U0KA 4JBDA 1TM0A 2GKJA 2H9FA 3EDNA 1BWZA 1QY9A 5HA4A 4K7XA 4J9WA 1XUAA 4K7GB 3EJXA 1W61A 1XUBA 4LB0A 4JUUA 2GKEA 3G7KA 1QYAA 1SDJA 2PVZA 2AZPA 2Q9JA
chains in the Genus database with same CATH superfamily
2YMAA 5H2YA 1U1VA 1S7JA 4LS9A 2OTNA 2ENXA 1I74A 4LG3A 2GKJA 5HA4A 2IW4A 4K7XA 1W61A 2PVZA 5ANPA 1U1WA 1GQZA 4DUNA 4IK0A 2Q9HA 5IWEA 2ZXPA 1U1XA 3PW9A 3FVEA 2ZXOA 2PW0A 3EKMA 4IJZA 3G98A 3PVHA 1T6KA 1U0KA 3W5WA 3DEVA 2KW7A 1K20A 1BWZA 4K7GB 1XUBA 4GL6A 2GKEA 3G7KA 3PTJA 2AZPA 4JD7A 1WPPA 1WPMA 2ZVFA 1W62A 2LT2A 4Q2HA 4JCIA 4K8LA 1TM0A 3EDNA 4J9WA 3IGHX 3EJXA 4LB0A 2HAWA 2QB6A 1QYAA 1SDJA 5M47A 2Q9JA 4OA3A 2QB7A 3ICJA 2QB8A 1K23A 2ZXRA 2MPBA 4J9XA 2KPTA 4PY9A 4RPAA 5H2GA 1YM5A 4JBDA 2EB0A 2H9FA 1QY9A 1XUAA 3WQZA 1IR6A 4JUUA 4Q60A
chains in the Genus database with same CATH topology
2YMAA 5H2YA 1U1VA 1S7JA 4LS9A 2OTNA 2ENXA 1I74A 4LG3A 2GKJA 5HA4A 2IW4A 4K7XA 1W61A 2PVZA 5ANPA 1U1WA 1GQZA 4DUNA 4IK0A 2Q9HA 5IWEA 2ZXPA 1U1XA 3PW9A 3FVEA 2ZXOA 2PW0A 3EKMA 4IJZA 3G98A 3PVHA 1T6KA 1U0KA 3W5WA 3DEVA 2KW7A 1K20A 1BWZA 4K7GB 1XUBA 4GL6A 2GKEA 3G7KA 3PTJA 2AZPA 4JD7A 1WPPA 1WPMA 2ZVFA 1W62A 2LT2A 4Q2HA 4JCIA 4K8LA 1TM0A 3EDNA 4J9WA 3IGHX 3EJXA 4LB0A 2HAWA 2QB6A 1QYAA 1SDJA 5M47A 2Q9JA 4OA3A 2QB7A 3ICJA 2QB8A 1K23A 2ZXRA 2MPBA 4J9XA 2KPTA 4PY9A 4RPAA 5H2GA 1YM5A 4JBDA 2EB0A 2H9FA 1QY9A 1XUAA 3WQZA 1IR6A 4JUUA 4Q60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2Y A;  1U1W A;  1GQZ A;  4DUN A;  4IK0 A;  1U1V A;  2Q9H A;  5IWE A;  4JD7 A;  1S7J A;  1U1X A;  3FVE A;  4J9X A;  5M47 A;  1W62 A;  2OTN A;  5H2G A;  4Q2H A;  2PW0 A;  3EKM A;  4IJZ A;  4JCI A;  1YM5 A;  4K8L A;  4Q60 A;  1T6K A;  1U0K A;  4JBD A;  1TM0 A;  2GKJ A;  2H9F A;  3EDN A;  1BWZ A;  1QY9 A;  5HA4 A;  4K7X A;  4J9W A;  1XUA A;  4K7G B;  3EJX A;  1W61 A;  1XUB A;  4LB0 A;  4JUU A;  2GKE A;  3G7K A;  1QYA A;  1SDJ A;  2PVZ A;  2AZP A;  2Q9J A; 
#chains in the Genus database with same CATH topology
 2YMA A;  5H2Y A;  1U1V A;  1S7J A;  4LS9 A;  2OTN A;  2ENX A;  1I74 A;  4LG3 A;  2GKJ A;  5HA4 A;  2IW4 A;  4K7X A;  1W61 A;  2PVZ A;  5ANP A;  1U1W A;  1GQZ A;  4DUN A;  4IK0 A;  2Q9H A;  5IWE A;  2ZXP A;  1U1X A;  3PW9 A;  3FVE A;  2ZXO A;  2PW0 A;  3EKM A;  4IJZ A;  3G98 A;  3PVH A;  1T6K A;  1U0K A;  3W5W A;  3DEV A;  2KW7 A;  1K20 A;  1BWZ A;  4K7G B;  1XUB A;  4GL6 A;  2GKE A;  3G7K A;  3PTJ A;  2AZP A;  4JD7 A;  1WPP A;  1WPM A;  2ZVF A;  1W62 A;  2LT2 A;  4Q2H A;  4JCI A;  4K8L A;  1TM0 A;  3EDN A;  4J9W A;  3IGH X;  3EJX A;  4LB0 A;  2HAW A;  2QB6 A;  1QYA A;  1SDJ A;  5M47 A;  2Q9J A;  4OA3 A;  2QB7 A;  3ICJ A;  2QB8 A;  1K23 A;  2ZXR A;  2MPB A;  4J9X A;  2KPT A;  4PY9 A;  4RPA A;  5H2G A;  1YM5 A;  4JBD A;  2EB0 A;  2H9F A;  1QY9 A;  1XUA A;  3WQZ A;  1IR6 A;  4JUU A;  4Q60 A; 
#chains in the Genus database with same CATH homology
 2YMA A;  5H2Y A;  1U1V A;  1S7J A;  4LS9 A;  2OTN A;  2ENX A;  1I74 A;  4LG3 A;  2GKJ A;  5HA4 A;  2IW4 A;  4K7X A;  1W61 A;  2PVZ A;  5ANP A;  1U1W A;  1GQZ A;  4DUN A;  4IK0 A;  2Q9H A;  5IWE A;  2ZXP A;  1U1X A;  3PW9 A;  3FVE A;  2ZXO A;  2PW0 A;  3EKM A;  4IJZ A;  3G98 A;  3PVH A;  1T6K A;  1U0K A;  3W5W A;  3DEV A;  2KW7 A;  1K20 A;  1BWZ A;  4K7G B;  1XUB A;  4GL6 A;  2GKE A;  3G7K A;  3PTJ A;  2AZP A;  4JD7 A;  1WPP A;  1WPM A;  2ZVF A;  1W62 A;  2LT2 A;  4Q2H A;  4JCI A;  4K8L A;  1TM0 A;  3EDN A;  4J9W A;  3IGH X;  3EJX A;  4LB0 A;  2HAW A;  2QB6 A;  1QYA A;  1SDJ A;  5M47 A;  2Q9J A;  4OA3 A;  2QB7 A;  3ICJ A;  2QB8 A;  1K23 A;  2ZXR A;  2MPB A;  4J9X A;  2KPT A;  4PY9 A;  4RPA A;  5H2G A;  1YM5 A;  4JBD A;  2EB0 A;  2H9F A;  1QY9 A;  1XUA A;  3WQZ A;  1IR6 A;  4JUU A;  4Q60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...