4OA3A

Crystal structure of the ba42 protein from bizionia argentinensis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
EEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution and crystal structure of BA42, a protein from the Antarctic bacterium Bizionia argentinensis comprised of a stand-alone TPM domain.
pubmed doi rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
molecule keywords PROTEIN BA42
total genus 45
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4oa3A00
5ANPA 2MPBA 2LT2A 4OA3A 3PW9A 2KPTA 2KW7A 3PTJA 3PVHA
chains in the Genus database with same CATH superfamily
5ANPA 4JD7A 4J9WA 1U1XA 4LS9A 3PVHA 1U0KA 2H9FA 1GQZA 3W5WA 3IGHX 1U1WA 1TM0A 1W62A 1U1VA 1K23A 3G7KA 3ICJA 3PW9A 2PVZA 2ZXOA 4LG3A 2QB8A 3EDNA 1XUBA 2MPBA 4Q2HA 4RPAA 5IWEA 4IK0A 2IW4A 4IJZA 4PY9A 2ENXA 4DUNA 2Q9JA 1I74A 4JCIA 1SDJA 1XUAA 2LT2A 2ZXPA 1WPMA 3FVEA 4J9XA 2AZPA 1QY9A 3DEVA 1K20A 2YMAA 3WQZA 2PW0A 4OA3A 2GKEA 1WPPA 3EJXA 4K7GB 1W61A 3PTJA 3G98A 2Q9HA 1QYAA 1BWZA 1S7JA 4LB0A 2ZVFA 2EB0A 2QB6A 4JBDA 1T6KA 4Q60A 2KW7A 2HAWA 4JUUA 4K7XA 4GL6A 4K8LA 1IR6A 5H2GA 5HA4A 2ZXRA 2KPTA 2QB7A 1YM5A 2OTNA 2GKJA 5H2YA 3EKMA 5M47A
chains in the Genus database with same CATH topology
5ANPA 4JD7A 4J9WA 1U1XA 4LS9A 3PVHA 1U0KA 2H9FA 1GQZA 3W5WA 3IGHX 1U1WA 1TM0A 1W62A 1U1VA 1K23A 3G7KA 3ICJA 3PW9A 2PVZA 2ZXOA 4LG3A 2QB8A 3EDNA 1XUBA 2MPBA 4Q2HA 4RPAA 5IWEA 4IK0A 2IW4A 4IJZA 4PY9A 2ENXA 4DUNA 2Q9JA 1I74A 4JCIA 1SDJA 1XUAA 2LT2A 2ZXPA 1WPMA 3FVEA 4J9XA 2AZPA 1QY9A 3DEVA 1K20A 2YMAA 3WQZA 2PW0A 4OA3A 2GKEA 1WPPA 3EJXA 4K7GB 1W61A 3PTJA 3G98A 2Q9HA 1QYAA 1BWZA 1S7JA 4LB0A 2ZVFA 2EB0A 2QB6A 4JBDA 1T6KA 4Q60A 2KW7A 2HAWA 4JUUA 4K7XA 4GL6A 4K8LA 1IR6A 5H2GA 5HA4A 2ZXRA 2KPTA 2QB7A 1YM5A 2OTNA 2GKJA 5H2YA 3EKMA 5M47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ANP A;  2MPB A;  2LT2 A;  4OA3 A;  3PW9 A;  2KPT A;  2KW7 A;  3PTJ A;  3PVH A; 
#chains in the Genus database with same CATH topology
 5ANP A;  4JD7 A;  4J9W A;  1U1X A;  4LS9 A;  3PVH A;  1U0K A;  2H9F A;  1GQZ A;  3W5W A;  3IGH X;  1U1W A;  1TM0 A;  1W62 A;  1U1V A;  1K23 A;  3G7K A;  3ICJ A;  3PW9 A;  2PVZ A;  2ZXO A;  4LG3 A;  2QB8 A;  3EDN A;  1XUB A;  2MPB A;  4Q2H A;  4RPA A;  5IWE A;  4IK0 A;  2IW4 A;  4IJZ A;  4PY9 A;  2ENX A;  4DUN A;  2Q9J A;  1I74 A;  4JCI A;  1SDJ A;  1XUA A;  2LT2 A;  2ZXP A;  1WPM A;  3FVE A;  4J9X A;  2AZP A;  1QY9 A;  3DEV A;  1K20 A;  2YMA A;  3WQZ A;  2PW0 A;  4OA3 A;  2GKE A;  1WPP A;  3EJX A;  4K7G B;  1W61 A;  3PTJ A;  3G98 A;  2Q9H A;  1QYA A;  1BWZ A;  1S7J A;  4LB0 A;  2ZVF A;  2EB0 A;  2QB6 A;  4JBD A;  1T6K A;  4Q60 A;  2KW7 A;  2HAW A;  4JUU A;  4K7X A;  4GL6 A;  4K8L A;  1IR6 A;  5H2G A;  5HA4 A;  2ZXR A;  2KPT A;  2QB7 A;  1YM5 A;  2OTN A;  2GKJ A;  5H2Y A;  3EKM A;  5M47 A; 
#chains in the Genus database with same CATH homology
 5ANP A;  4JD7 A;  4J9W A;  1U1X A;  4LS9 A;  3PVH A;  1U0K A;  2H9F A;  1GQZ A;  3W5W A;  3IGH X;  1U1W A;  1TM0 A;  1W62 A;  1U1V A;  1K23 A;  3G7K A;  3ICJ A;  3PW9 A;  2PVZ A;  2ZXO A;  4LG3 A;  2QB8 A;  3EDN A;  1XUB A;  2MPB A;  4Q2H A;  4RPA A;  5IWE A;  4IK0 A;  2IW4 A;  4IJZ A;  4PY9 A;  2ENX A;  4DUN A;  2Q9J A;  1I74 A;  4JCI A;  1SDJ A;  1XUA A;  2LT2 A;  2ZXP A;  1WPM A;  3FVE A;  4J9X A;  2AZP A;  1QY9 A;  3DEV A;  1K20 A;  2YMA A;  3WQZ A;  2PW0 A;  4OA3 A;  2GKE A;  1WPP A;  3EJX A;  4K7G B;  1W61 A;  3PTJ A;  3G98 A;  2Q9H A;  1QYA A;  1BWZ A;  1S7J A;  4LB0 A;  2ZVF A;  2EB0 A;  2QB6 A;  4JBD A;  1T6K A;  4Q60 A;  2KW7 A;  2HAW A;  4JUU A;  4K7X A;  4GL6 A;  4K8L A;  1IR6 A;  5H2G A;  5HA4 A;  2ZXR A;  2KPT A;  2QB7 A;  1YM5 A;  2OTN A;  2GKJ A;  5H2Y A;  3EKM A;  5M47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...