4OA3A

Crystal structure of the ba42 protein from bizionia argentinensis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
EEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution and crystal structure of BA42, a protein from the Antarctic bacterium Bizionia argentinensis comprised of a stand-alone TPM domain.
pubmed doi rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
molecule keywords PROTEIN BA42
total genus 45
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4oa3A00
4OA3A 2MPBA 2KPTA 3PTJA 3PVHA 2KW7A 3PW9A 2LT2A 5ANPA
chains in the Genus database with same CATH superfamily
2ZXRA 1W62A 2KW7A 2GKJA 2PVZA 4OA3A 3W5WA 2IW4A 1QY9A 1U1WA 4RPAA 4IK0A 2ZXOA 2EB0A 1TM0A 5HA4A 4J9WA 1IR6A 4LG3A 4GL6A 4Q60A 4JCIA 2HAWA 5IWEA 1SDJA 4LS9A 4DUNA 1W61A 3EJXA 4JD7A 1T6KA 4LB0A 3IGHX 2MPBA 4JBDA 4K8LA 3WQZA 4IJZA 3PTJA 2AZPA 2QB6A 3EDNA 1XUBA 1WPMA 1QYAA 4PY9A 3PVHA 2LT2A 2Q9HA 2ZXPA 3FVEA 4K7GB 1GQZA 5H2YA 2QB8A 3G7KA 4Q2HA 3G98A 3DEVA 2H9FA 2OTNA 4JUUA 1S7JA 1K23A 3ICJA 2Q9JA 1I74A 1YM5A 2YMAA 5ANPA 1U0KA 4J9XA 2ZVFA 2KPTA 1U1XA 1K20A 3PW9A 2ENXA 2PW0A 4K7XA 5H2GA 2GKEA 1U1VA 1WPPA 2QB7A 1BWZA 5M47A 1XUAA 3EKMA
chains in the Genus database with same CATH topology
2ZXRA 1W62A 2KW7A 2GKJA 2PVZA 4OA3A 3W5WA 2IW4A 1QY9A 1U1WA 4RPAA 4IK0A 2ZXOA 2EB0A 1TM0A 5HA4A 4J9WA 1IR6A 4LG3A 4GL6A 4Q60A 4JCIA 2HAWA 5IWEA 1SDJA 4LS9A 4DUNA 1W61A 3EJXA 4JD7A 1T6KA 4LB0A 3IGHX 2MPBA 4JBDA 4K8LA 3WQZA 4IJZA 3PTJA 2AZPA 2QB6A 3EDNA 1XUBA 1WPMA 1QYAA 4PY9A 3PVHA 2LT2A 2Q9HA 2ZXPA 3FVEA 4K7GB 1GQZA 5H2YA 2QB8A 3G7KA 4Q2HA 3G98A 3DEVA 2H9FA 2OTNA 4JUUA 1S7JA 1K23A 3ICJA 2Q9JA 1I74A 1YM5A 2YMAA 5ANPA 1U0KA 4J9XA 2ZVFA 2KPTA 1U1XA 1K20A 3PW9A 2ENXA 2PW0A 4K7XA 5H2GA 2GKEA 1U1VA 1WPPA 2QB7A 1BWZA 5M47A 1XUAA 3EKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OA3 A;  2MPB A;  2KPT A;  3PTJ A;  3PVH A;  2KW7 A;  3PW9 A;  2LT2 A;  5ANP A; 
#chains in the Genus database with same CATH topology
 2ZXR A;  1W62 A;  2KW7 A;  2GKJ A;  2PVZ A;  4OA3 A;  3W5W A;  2IW4 A;  1QY9 A;  1U1W A;  4RPA A;  4IK0 A;  2ZXO A;  2EB0 A;  1TM0 A;  5HA4 A;  4J9W A;  1IR6 A;  4LG3 A;  4GL6 A;  4Q60 A;  4JCI A;  2HAW A;  5IWE A;  1SDJ A;  4LS9 A;  4DUN A;  1W61 A;  3EJX A;  4JD7 A;  1T6K A;  4LB0 A;  3IGH X;  2MPB A;  4JBD A;  4K8L A;  3WQZ A;  4IJZ A;  3PTJ A;  2AZP A;  2QB6 A;  3EDN A;  1XUB A;  1WPM A;  1QYA A;  4PY9 A;  3PVH A;  2LT2 A;  2Q9H A;  2ZXP A;  3FVE A;  4K7G B;  1GQZ A;  5H2Y A;  2QB8 A;  3G7K A;  4Q2H A;  3G98 A;  3DEV A;  2H9F A;  2OTN A;  4JUU A;  1S7J A;  1K23 A;  3ICJ A;  2Q9J A;  1I74 A;  1YM5 A;  2YMA A;  5ANP A;  1U0K A;  4J9X A;  2ZVF A;  2KPT A;  1U1X A;  1K20 A;  3PW9 A;  2ENX A;  2PW0 A;  4K7X A;  5H2G A;  2GKE A;  1U1V A;  1WPP A;  2QB7 A;  1BWZ A;  5M47 A;  1XUA A;  3EKM A; 
#chains in the Genus database with same CATH homology
 2ZXR A;  1W62 A;  2KW7 A;  2GKJ A;  2PVZ A;  4OA3 A;  3W5W A;  2IW4 A;  1QY9 A;  1U1W A;  4RPA A;  4IK0 A;  2ZXO A;  2EB0 A;  1TM0 A;  5HA4 A;  4J9W A;  1IR6 A;  4LG3 A;  4GL6 A;  4Q60 A;  4JCI A;  2HAW A;  5IWE A;  1SDJ A;  4LS9 A;  4DUN A;  1W61 A;  3EJX A;  4JD7 A;  1T6K A;  4LB0 A;  3IGH X;  2MPB A;  4JBD A;  4K8L A;  3WQZ A;  4IJZ A;  3PTJ A;  2AZP A;  2QB6 A;  3EDN A;  1XUB A;  1WPM A;  1QYA A;  4PY9 A;  3PVH A;  2LT2 A;  2Q9H A;  2ZXP A;  3FVE A;  4K7G B;  1GQZ A;  5H2Y A;  2QB8 A;  3G7K A;  4Q2H A;  3G98 A;  3DEV A;  2H9F A;  2OTN A;  4JUU A;  1S7J A;  1K23 A;  3ICJ A;  2Q9J A;  1I74 A;  1YM5 A;  2YMA A;  5ANP A;  1U0K A;  4J9X A;  2ZVF A;  2KPT A;  1U1X A;  1K20 A;  3PW9 A;  2ENX A;  2PW0 A;  4K7X A;  5H2G A;  2GKE A;  1U1V A;  1WPP A;  2QB7 A;  1BWZ A;  5M47 A;  1XUA A;  3EKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...