4OA3A

Crystal structure of the ba42 protein from bizionia argentinensis
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
EEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN BA42
publication title Solution and crystal structure of BA42, a protein from the Antarctic bacterium Bizionia argentinensis comprised of a stand-alone TPM domain.
pubmed doi rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
total genus 45
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4oa3A00
2LT2A 3PVHA 2KPTA 5ANPA 3PW9A 3PTJA 2MPBA 2KW7A 4OA3A
chains in the Genus database with same CATH superfamily
2Q9JA 4K7GB 3G7KA 3EKMA 3IGHX 3EDNA 4IJZA 1W61A 1XUAA 1U1XA 4J9WA 4K7XA 5H2YA 2ZXOA 2HAWA 3PTJA 3WQZA 2OTNA 1U0KA 1WPMA 1T6KA 5ANPA 4DUNA 2YMAA 4JCIA 2EB0A 2GKEA 1XUBA 1TM0A 2ZVFA 1QYAA 5IWEA 5HA4A 2AZPA 4JBDA 3PW9A 1GQZA 1I74A 3PVHA 4RPAA 1BWZA 4J9XA 3DEVA 1W62A 2MPBA 3G98A 2LT2A 2ENXA 2ZXPA 4Q2HA 1U1WA 4LB0A 5H2GA 2KPTA 4K8LA 1U1VA 2Q9HA 4IK0A 2QB6A 1IR6A 4LS9A 2GKJA 2H9FA 1K20A 2QB7A 5M47A 1K23A 2PW0A 4Q60A 3FVEA 1S7JA 2IW4A 4PY9A 1WPPA 2QB8A 4JUUA 4OA3A 2ZXRA 1YM5A 4JD7A 1QY9A 1SDJA 2KW7A 2PVZA 3ICJA 4LG3A 3W5WA 3EJXA 4GL6A
chains in the Genus database with same CATH topology
2Q9JA 4K7GB 3G7KA 3EKMA 3IGHX 3EDNA 4IJZA 1W61A 1XUAA 1U1XA 4J9WA 4K7XA 5H2YA 2ZXOA 2HAWA 3PTJA 3WQZA 2OTNA 1U0KA 1WPMA 1T6KA 5ANPA 4DUNA 2YMAA 4JCIA 2EB0A 2GKEA 1XUBA 1TM0A 2ZVFA 1QYAA 5IWEA 5HA4A 2AZPA 4JBDA 3PW9A 1GQZA 1I74A 3PVHA 4RPAA 1BWZA 4J9XA 3DEVA 1W62A 2MPBA 3G98A 2LT2A 2ENXA 2ZXPA 4Q2HA 1U1WA 4LB0A 5H2GA 2KPTA 4K8LA 1U1VA 2Q9HA 4IK0A 2QB6A 1IR6A 4LS9A 2GKJA 2H9FA 1K20A 2QB7A 5M47A 1K23A 2PW0A 4Q60A 3FVEA 1S7JA 2IW4A 4PY9A 1WPPA 2QB8A 4JUUA 4OA3A 2ZXRA 1YM5A 4JD7A 1QY9A 1SDJA 2KW7A 2PVZA 3ICJA 4LG3A 3W5WA 3EJXA 4GL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT2 A;  3PVH A;  2KPT A;  5ANP A;  3PW9 A;  3PTJ A;  2MPB A;  2KW7 A;  4OA3 A; 
#chains in the Genus database with same CATH topology
 2Q9J A;  4K7G B;  3G7K A;  3EKM A;  3IGH X;  3EDN A;  4IJZ A;  1W61 A;  1XUA A;  1U1X A;  4J9W A;  4K7X A;  5H2Y A;  2ZXO A;  2HAW A;  3PTJ A;  3WQZ A;  2OTN A;  1U0K A;  1WPM A;  1T6K A;  5ANP A;  4DUN A;  2YMA A;  4JCI A;  2EB0 A;  2GKE A;  1XUB A;  1TM0 A;  2ZVF A;  1QYA A;  5IWE A;  5HA4 A;  2AZP A;  4JBD A;  3PW9 A;  1GQZ A;  1I74 A;  3PVH A;  4RPA A;  1BWZ A;  4J9X A;  3DEV A;  1W62 A;  2MPB A;  3G98 A;  2LT2 A;  2ENX A;  2ZXP A;  4Q2H A;  1U1W A;  4LB0 A;  5H2G A;  2KPT A;  4K8L A;  1U1V A;  2Q9H A;  4IK0 A;  2QB6 A;  1IR6 A;  4LS9 A;  2GKJ A;  2H9F A;  1K20 A;  2QB7 A;  5M47 A;  1K23 A;  2PW0 A;  4Q60 A;  3FVE A;  1S7J A;  2IW4 A;  4PY9 A;  1WPP A;  2QB8 A;  4JUU A;  4OA3 A;  2ZXR A;  1YM5 A;  4JD7 A;  1QY9 A;  1SDJ A;  2KW7 A;  2PVZ A;  3ICJ A;  4LG3 A;  3W5W A;  3EJX A;  4GL6 A; 
#chains in the Genus database with same CATH homology
 2Q9J A;  4K7G B;  3G7K A;  3EKM A;  3IGH X;  3EDN A;  4IJZ A;  1W61 A;  1XUA A;  1U1X A;  4J9W A;  4K7X A;  5H2Y A;  2ZXO A;  2HAW A;  3PTJ A;  3WQZ A;  2OTN A;  1U0K A;  1WPM A;  1T6K A;  5ANP A;  4DUN A;  2YMA A;  4JCI A;  2EB0 A;  2GKE A;  1XUB A;  1TM0 A;  2ZVF A;  1QYA A;  5IWE A;  5HA4 A;  2AZP A;  4JBD A;  3PW9 A;  1GQZ A;  1I74 A;  3PVH A;  4RPA A;  1BWZ A;  4J9X A;  3DEV A;  1W62 A;  2MPB A;  3G98 A;  2LT2 A;  2ENX A;  2ZXP A;  4Q2H A;  1U1W A;  4LB0 A;  5H2G A;  2KPT A;  4K8L A;  1U1V A;  2Q9H A;  4IK0 A;  2QB6 A;  1IR6 A;  4LS9 A;  2GKJ A;  2H9F A;  1K20 A;  2QB7 A;  5M47 A;  1K23 A;  2PW0 A;  4Q60 A;  3FVE A;  1S7J A;  2IW4 A;  4PY9 A;  1WPP A;  2QB8 A;  4JUU A;  4OA3 A;  2ZXR A;  1YM5 A;  4JD7 A;  1QY9 A;  1SDJ A;  2KW7 A;  2PVZ A;  3ICJ A;  4LG3 A;  3W5W A;  3EJX A;  4GL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...