1U0KA

The structure of a predicted epimerase pa4716 from pseudomonas aeruginosa
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
284
structure length
284
Chain Sequence
b'MSRRYWQLDVFAERPLTGNGLAVFDDASALDDAAMQAWTRELRQFESIFLLPGDDPRAFRARIFTLEEELPFAGHPLLGAAALLHHLRGGDNEQHWTLHLASKSVALRSVRAGSGFYAEMDQGRAEFGATPDAGTCRWFAEAFSLSANDLSGHPPRVVSTGLPYLLLPVTAEALGRARQVNDLQEALDKLGAAFVYLLDVDGREGRTWDNLGLVEDVATGSAAGPVAAYLVEYGLAARGEPFVLHQGRFLERPSRLDVQVATDGSVRVGGHVQLLARAELLTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gene product PA4716
publication title The structure of hypothetical protein PA4716 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 80
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1u0kA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1u0kA01
2Q9JA 4DUNA 4K7XA 4JBDA 1T6KA 4IJZA 1GQZA 3FVEA 1U1VA 2GKEA 1BWZA 1YM5A 5HA4A 1XUBA 4LB0A 1U1XA 1U0KA 3EDNA 1QYAA 5IWEA 3EJXA 1W62A 2H9FA 2PVZA 4JCIA 3EKMA 2GKJA 4JD7A 1SDJA 1U1WA 1XUAA 4IK0A 4J9XA 5M47A 1TM0A 2AZPA 4Q2HA 1W61A 4J9WA 5H2GA 1S7JA 5H2YA 1QY9A 3G7KA 2PW0A 4K8LA 4Q60A 4K7GB 2Q9HA 4JUUA 2OTNA
chains in the Genus database with same CATH superfamily
2Q9JA 4IJZA 2YMAA 2GKEA 4LB0A 5IWEA 2H9FA 4LG3A 4JD7A 1U1WA 4J9XA 5ANPA 1TM0A 5M47A 2ENXA 1W61A 2KPTA 4Q60A 3ICJA 4JUUA 2ZXRA 2QB6A 2EB0A 4K7XA 4JBDA 1GQZA 1U1VA 5HA4A 3PVHA 2KW7A 4JCIA 2QB7A 1XUAA 4IK0A 2ZXPA 5H2GA 2ZXOA 2QB8A 4RPAA 3W5WA 2PW0A 4K7GB 2Q9HA 2ZVFA 3WQZA 1K23A 3PW9A 4PY9A 1XUBA 2HAWA 1U0KA 3EDNA 1QYAA 2PVZA 2GKJA 1SDJA 1WPPA 3PTJA 3DEVA 2AZPA 4Q2HA 1S7JA 5H2YA 1QY9A 1IR6A 3G7KA 1K20A 2IW4A 1WPMA 4OA3A 4DUNA 3G98A 1T6KA 1I74A 2MPBA 3FVEA 1BWZA 1YM5A 1U1XA 3EJXA 1W62A 3EKMA 2LT2A 3IGHX 4LS9A 4GL6A 4J9WA 4K8LA 2OTNA
chains in the Genus database with same CATH topology
2Q9JA 4IJZA 2YMAA 2GKEA 4LB0A 5IWEA 2H9FA 4LG3A 4JD7A 1U1WA 4J9XA 5ANPA 1TM0A 5M47A 2ENXA 1W61A 2KPTA 4Q60A 3ICJA 4JUUA 2ZXRA 2QB6A 2EB0A 4K7XA 4JBDA 1GQZA 1U1VA 5HA4A 3PVHA 2KW7A 4JCIA 2QB7A 1XUAA 4IK0A 2ZXPA 5H2GA 2ZXOA 2QB8A 4RPAA 3W5WA 2PW0A 4K7GB 2Q9HA 2ZVFA 3WQZA 1K23A 3PW9A 4PY9A 1XUBA 2HAWA 1U0KA 3EDNA 1QYAA 2PVZA 2GKJA 1SDJA 1WPPA 3PTJA 3DEVA 2AZPA 4Q2HA 1S7JA 5H2YA 1QY9A 1IR6A 3G7KA 1K20A 2IW4A 1WPMA 4OA3A 4DUNA 3G98A 1T6KA 1I74A 2MPBA 3FVEA 1BWZA 1YM5A 1U1XA 3EJXA 1W62A 3EKMA 2LT2A 3IGHX 4LS9A 4GL6A 4J9WA 4K8LA 2OTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9J A;  4DUN A;  4K7X A;  4JBD A;  1T6K A;  4IJZ A;  1GQZ A;  3FVE A;  1U1V A;  2GKE A;  1BWZ A;  1YM5 A;  5HA4 A;  1XUB A;  4LB0 A;  1U1X A;  1U0K A;  3EDN A;  1QYA A;  5IWE A;  3EJX A;  1W62 A;  2H9F A;  2PVZ A;  4JCI A;  3EKM A;  2GKJ A;  4JD7 A;  1SDJ A;  1U1W A;  1XUA A;  4IK0 A;  4J9X A;  5M47 A;  1TM0 A;  2AZP A;  4Q2H A;  1W61 A;  4J9W A;  5H2G A;  1S7J A;  5H2Y A;  1QY9 A;  3G7K A;  2PW0 A;  4K8L A;  4Q60 A;  4K7G B;  2Q9H A;  4JUU A;  2OTN A; 
#chains in the Genus database with same CATH topology
 2Q9J A;  4IJZ A;  2YMA A;  2GKE A;  4LB0 A;  5IWE A;  2H9F A;  4LG3 A;  4JD7 A;  1U1W A;  4J9X A;  5ANP A;  1TM0 A;  5M47 A;  2ENX A;  1W61 A;  2KPT A;  4Q60 A;  3ICJ A;  4JUU A;  2ZXR A;  2QB6 A;  2EB0 A;  4K7X A;  4JBD A;  1GQZ A;  1U1V A;  5HA4 A;  3PVH A;  2KW7 A;  4JCI A;  2QB7 A;  1XUA A;  4IK0 A;  2ZXP A;  5H2G A;  2ZXO A;  2QB8 A;  4RPA A;  3W5W A;  2PW0 A;  4K7G B;  2Q9H A;  2ZVF A;  3WQZ A;  1K23 A;  3PW9 A;  4PY9 A;  1XUB A;  2HAW A;  1U0K A;  3EDN A;  1QYA A;  2PVZ A;  2GKJ A;  1SDJ A;  1WPP A;  3PTJ A;  3DEV A;  2AZP A;  4Q2H A;  1S7J A;  5H2Y A;  1QY9 A;  1IR6 A;  3G7K A;  1K20 A;  2IW4 A;  1WPM A;  4OA3 A;  4DUN A;  3G98 A;  1T6K A;  1I74 A;  2MPB A;  3FVE A;  1BWZ A;  1YM5 A;  1U1X A;  3EJX A;  1W62 A;  3EKM A;  2LT2 A;  3IGH X;  4LS9 A;  4GL6 A;  4J9W A;  4K8L A;  2OTN A; 
#chains in the Genus database with same CATH homology
 2Q9J A;  4IJZ A;  2YMA A;  2GKE A;  4LB0 A;  5IWE A;  2H9F A;  4LG3 A;  4JD7 A;  1U1W A;  4J9X A;  5ANP A;  1TM0 A;  5M47 A;  2ENX A;  1W61 A;  2KPT A;  4Q60 A;  3ICJ A;  4JUU A;  2ZXR A;  2QB6 A;  2EB0 A;  4K7X A;  4JBD A;  1GQZ A;  1U1V A;  5HA4 A;  3PVH A;  2KW7 A;  4JCI A;  2QB7 A;  1XUA A;  4IK0 A;  2ZXP A;  5H2G A;  2ZXO A;  2QB8 A;  4RPA A;  3W5W A;  2PW0 A;  4K7G B;  2Q9H A;  2ZVF A;  3WQZ A;  1K23 A;  3PW9 A;  4PY9 A;  1XUB A;  2HAW A;  1U0K A;  3EDN A;  1QYA A;  2PVZ A;  2GKJ A;  1SDJ A;  1WPP A;  3PTJ A;  3DEV A;  2AZP A;  4Q2H A;  1S7J A;  5H2Y A;  1QY9 A;  1IR6 A;  3G7K A;  1K20 A;  2IW4 A;  1WPM A;  4OA3 A;  4DUN A;  3G98 A;  1T6K A;  1I74 A;  2MPB A;  3FVE A;  1BWZ A;  1YM5 A;  1U1X A;  3EJX A;  1W62 A;  3EKM A;  2LT2 A;  3IGH X;  4LS9 A;  4GL6 A;  4J9W A;  4K8L A;  2OTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...