1U0KA

The structure of a predicted epimerase pa4716 from pseudomonas aeruginosa
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
284
structure length
284
Chain Sequence
MSRRYWQLDVFAERPLTGNGLAVFDDASALDDAAMQAWTRELRQFESIFLLPGDDPRAFRARIFTLEEELPFAGHPLLGAAALLHHLRGGDNEQHWTLHLASKSVALRSVRAGSGFYAEMDQGRAEFGATPDAGTCRWFAEAFSLSANDLSGHPPRVVSTGLPYLLLPVTAEALGRARQVNDLQEALDKLGAAFVYLLDVDGREGRTWDNLGLVEDVATGSAAGPVAAYLVEYGLAARGEPFVLHQGRFLERPSRLDVQVATDGSVRVGGHVQLLARAELLTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of hypothetical protein PA4716 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords gene product PA4716
total genus 80
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1u0kA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 1u0kA01
2OTNA 5M47A 1S7JA 1SDJA 4Q2HA 5IWEA 1XUBA 1BWZA 1XUAA 4J9XA 4K8LA 1W61A 4LB0A 5H2YA 2Q9HA 1U0KA 1U1VA 2PW0A 1T6KA 4JBDA 1GQZA 2GKEA 4K7XA 1W62A 5H2GA 4IJZA 2AZPA 4JUUA 2Q9JA 2PVZA 1QY9A 4DUNA 5HA4A 3EKMA 4Q60A 4K7GB 1QYAA 3EDNA 2GKJA 4IK0A 1U1WA 1U1XA 3FVEA 1TM0A 4JD7A 4J9WA 3G7KA 2H9FA 4JCIA 1YM5A 3EJXA
chains in the Genus database with same CATH superfamily
1XUBA 4J9XA 1U0KA 2ZVFA 2AZPA 4JUUA 3EKMA 4Q60A 4LG3A 1QYAA 1U1WA 3G7KA 2ZXPA 4JCIA 3IGHX 2HAWA 5ANPA 2MPBA 2KW7A 2OTNA 5M47A 5IWEA 1BWZA 1XUAA 2KPTA 1W61A 5H2YA 4JBDA 2GKEA 3DEVA 4K7XA 4IJZA 2PVZA 2LT2A 3ICJA 4IK0A 1U1XA 3FVEA 4JD7A 4J9WA 2QB6A 2H9FA 2ZXRA 1IR6A 1SDJA 4GL6A 4K8LA 4LB0A 4OA3A 2Q9HA 1U1VA 2PW0A 1T6KA 1I74A 2ENXA 3PTJA 2Q9JA 1QY9A 2IW4A 5HA4A 2EB0A 1WPPA 2YMAA 3W5WA 2GKJA 2QB7A 4LS9A 1S7JA 4Q2HA 2QB8A 3PVHA 4PY9A 3WQZA 1GQZA 3G98A 5H2GA 1W62A 2ZXOA 4DUNA 4K7GB 3EDNA 4RPAA 1K20A 1K23A 1WPMA 1TM0A 3PW9A 1YM5A 3EJXA
chains in the Genus database with same CATH topology
1XUBA 4J9XA 1U0KA 2ZVFA 2AZPA 4JUUA 3EKMA 4Q60A 4LG3A 1QYAA 1U1WA 3G7KA 2ZXPA 4JCIA 3IGHX 2HAWA 5ANPA 2MPBA 2KW7A 2OTNA 5M47A 5IWEA 1BWZA 1XUAA 2KPTA 1W61A 5H2YA 4JBDA 2GKEA 3DEVA 4K7XA 4IJZA 2PVZA 2LT2A 3ICJA 4IK0A 1U1XA 3FVEA 4JD7A 4J9WA 2QB6A 2H9FA 2ZXRA 1IR6A 1SDJA 4GL6A 4K8LA 4LB0A 4OA3A 2Q9HA 1U1VA 2PW0A 1T6KA 1I74A 2ENXA 3PTJA 2Q9JA 1QY9A 2IW4A 5HA4A 2EB0A 1WPPA 2YMAA 3W5WA 2GKJA 2QB7A 4LS9A 1S7JA 4Q2HA 2QB8A 3PVHA 4PY9A 3WQZA 1GQZA 3G98A 5H2GA 1W62A 2ZXOA 4DUNA 4K7GB 3EDNA 4RPAA 1K20A 1K23A 1WPMA 1TM0A 3PW9A 1YM5A 3EJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTN A;  5M47 A;  1S7J A;  1SDJ A;  4Q2H A;  5IWE A;  1XUB A;  1BWZ A;  1XUA A;  4J9X A;  4K8L A;  1W61 A;  4LB0 A;  5H2Y A;  2Q9H A;  1U0K A;  1U1V A;  2PW0 A;  1T6K A;  4JBD A;  1GQZ A;  2GKE A;  4K7X A;  1W62 A;  5H2G A;  4IJZ A;  2AZP A;  4JUU A;  2Q9J A;  2PVZ A;  1QY9 A;  4DUN A;  5HA4 A;  3EKM A;  4Q60 A;  4K7G B;  1QYA A;  3EDN A;  2GKJ A;  4IK0 A;  1U1W A;  1U1X A;  3FVE A;  1TM0 A;  4JD7 A;  4J9W A;  3G7K A;  2H9F A;  4JCI A;  1YM5 A;  3EJX A; 
#chains in the Genus database with same CATH topology
 1XUB A;  4J9X A;  1U0K A;  2ZVF A;  2AZP A;  4JUU A;  3EKM A;  4Q60 A;  4LG3 A;  1QYA A;  1U1W A;  3G7K A;  2ZXP A;  4JCI A;  3IGH X;  2HAW A;  5ANP A;  2MPB A;  2KW7 A;  2OTN A;  5M47 A;  5IWE A;  1BWZ A;  1XUA A;  2KPT A;  1W61 A;  5H2Y A;  4JBD A;  2GKE A;  3DEV A;  4K7X A;  4IJZ A;  2PVZ A;  2LT2 A;  3ICJ A;  4IK0 A;  1U1X A;  3FVE A;  4JD7 A;  4J9W A;  2QB6 A;  2H9F A;  2ZXR A;  1IR6 A;  1SDJ A;  4GL6 A;  4K8L A;  4LB0 A;  4OA3 A;  2Q9H A;  1U1V A;  2PW0 A;  1T6K A;  1I74 A;  2ENX A;  3PTJ A;  2Q9J A;  1QY9 A;  2IW4 A;  5HA4 A;  2EB0 A;  1WPP A;  2YMA A;  3W5W A;  2GKJ A;  2QB7 A;  4LS9 A;  1S7J A;  4Q2H A;  2QB8 A;  3PVH A;  4PY9 A;  3WQZ A;  1GQZ A;  3G98 A;  5H2G A;  1W62 A;  2ZXO A;  4DUN A;  4K7G B;  3EDN A;  4RPA A;  1K20 A;  1K23 A;  1WPM A;  1TM0 A;  3PW9 A;  1YM5 A;  3EJX A; 
#chains in the Genus database with same CATH homology
 1XUB A;  4J9X A;  1U0K A;  2ZVF A;  2AZP A;  4JUU A;  3EKM A;  4Q60 A;  4LG3 A;  1QYA A;  1U1W A;  3G7K A;  2ZXP A;  4JCI A;  3IGH X;  2HAW A;  5ANP A;  2MPB A;  2KW7 A;  2OTN A;  5M47 A;  5IWE A;  1BWZ A;  1XUA A;  2KPT A;  1W61 A;  5H2Y A;  4JBD A;  2GKE A;  3DEV A;  4K7X A;  4IJZ A;  2PVZ A;  2LT2 A;  3ICJ A;  4IK0 A;  1U1X A;  3FVE A;  4JD7 A;  4J9W A;  2QB6 A;  2H9F A;  2ZXR A;  1IR6 A;  1SDJ A;  4GL6 A;  4K8L A;  4LB0 A;  4OA3 A;  2Q9H A;  1U1V A;  2PW0 A;  1T6K A;  1I74 A;  2ENX A;  3PTJ A;  2Q9J A;  1QY9 A;  2IW4 A;  5HA4 A;  2EB0 A;  1WPP A;  2YMA A;  3W5W A;  2GKJ A;  2QB7 A;  4LS9 A;  1S7J A;  4Q2H A;  2QB8 A;  3PVH A;  4PY9 A;  3WQZ A;  1GQZ A;  3G98 A;  5H2G A;  1W62 A;  2ZXO A;  4DUN A;  4K7G B;  3EDN A;  4RPA A;  1K20 A;  1K23 A;  1WPM A;  1TM0 A;  3PW9 A;  1YM5 A;  3EJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...