4JUUA

Crystal structure of a putative hydroxyproline epimerase from xanthomonas campestris (target efi-506516) with bound phosphate and unknown ligand
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
315
structure length
315
Chain Sequence
FQSMHTIDVIDSHTAGEPTRVVLAGFPDLGDGDLAQCRERFRSDFDHWRSAIACEPRGSDTMVGALLLPPRDPSACTGVIFFNNVGYLGMCGHGTIGVVRTLAELGRIAPGQHRIETPVGTVGVALADDGTVSIDNVESYRHAAGVEVDVPGHGRVRGDVAWGGNWFFITEQAPCALGLAQQRELTAYTEAIRLALEAAGITGEAGGEIDHIEISGVAPDGSGAARNFVLCPGLAYDRSPCGTGTSAKLACLAADGKLAEGERWLQQGILGSAFEGSYRHSGRGIAPRISGHAFITARSQLLIDPADPFAWGIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative hydroxyproline epimerase from xanthomonas campestris (TARGET EFI-506516) with bound phosphate and unknown ligand
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Isomerase
molecule keywords Epimerase
total genus 76
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4juuA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4juuA01
5IWEA 1QYAA 3FVEA 1XUAA 4IK0A 4JBDA 1S7JA 4J9XA 5H2YA 3EKMA 3G7KA 1QY9A 2OTNA 1YM5A 1XUBA 4IJZA 4JCIA 4JUUA 1T6KA 5HA4A 4K8LA 1W61A 4DUNA 1SDJA 4J9WA 1U1WA 1U1XA 1BWZA 1U0KA 1W62A 4Q2HA 2GKJA 2AZPA 2Q9JA 4LB0A 4Q60A 5H2GA 4K7XA 1TM0A 2PW0A 2GKEA 2H9FA 1U1VA 3EDNA 5M47A 4K7GB 4JD7A 2Q9HA 3EJXA 2PVZA 1GQZA
chains in the Genus database with same CATH superfamily
3G98A 3FVEA 1XUAA 4OA3A 2ZXRA 3PVHA 4IK0A 3G7KA 2ZXOA 2OTNA 1YM5A 2QB6A 5ANPA 1W61A 1SDJA 1I74A 1U0KA 1WPPA 2LT2A 4LG3A 4LB0A 5H2GA 1WPMA 4JD7A 2Q9HA 3EJXA 2YMAA 4JBDA 2ZXPA 4J9XA 2KPTA 5H2YA 3PW9A 3PTJA 1BWZA 2KW7A 2Q9JA 2QB8A 1TM0A 2GKEA 1U1VA 3ICJA 2HAWA 1K20A 3WQZA 1GQZA 1QYAA 1S7JA 1QY9A 4PY9A 1IR6A 1XUBA 3DEVA 4JCIA 4JUUA 4K8LA 4RPAA 2EB0A 4J9WA 4GL6A 2AZPA 2ENXA 2PW0A 2H9FA 3EDNA 5M47A 2MPBA 5IWEA 3EKMA 2ZVFA 4IJZA 5HA4A 1T6KA 4DUNA 1K23A 1U1WA 1U1XA 1W62A 2IW4A 4Q2HA 2GKJA 4Q60A 3IGHX 4K7XA 3W5WA 4LS9A 4K7GB 2QB7A 2PVZA
chains in the Genus database with same CATH topology
3G98A 3FVEA 1XUAA 4OA3A 2ZXRA 3PVHA 4IK0A 3G7KA 2ZXOA 2OTNA 1YM5A 2QB6A 5ANPA 1W61A 1SDJA 1I74A 1U0KA 1WPPA 2LT2A 4LG3A 4LB0A 5H2GA 1WPMA 4JD7A 2Q9HA 3EJXA 2YMAA 4JBDA 2ZXPA 4J9XA 2KPTA 5H2YA 3PW9A 3PTJA 1BWZA 2KW7A 2Q9JA 2QB8A 1TM0A 2GKEA 1U1VA 3ICJA 2HAWA 1K20A 3WQZA 1GQZA 1QYAA 1S7JA 1QY9A 4PY9A 1IR6A 1XUBA 3DEVA 4JCIA 4JUUA 4K8LA 4RPAA 2EB0A 4J9WA 4GL6A 2AZPA 2ENXA 2PW0A 2H9FA 3EDNA 5M47A 2MPBA 5IWEA 3EKMA 2ZVFA 4IJZA 5HA4A 1T6KA 4DUNA 1K23A 1U1WA 1U1XA 1W62A 2IW4A 4Q2HA 2GKJA 4Q60A 3IGHX 4K7XA 3W5WA 4LS9A 4K7GB 2QB7A 2PVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWE A;  1QYA A;  3FVE A;  1XUA A;  4IK0 A;  4JBD A;  1S7J A;  4J9X A;  5H2Y A;  3EKM A;  3G7K A;  1QY9 A;  2OTN A;  1YM5 A;  1XUB A;  4IJZ A;  4JCI A;  4JUU A;  1T6K A;  5HA4 A;  4K8L A;  1W61 A;  4DUN A;  1SDJ A;  4J9W A;  1U1W A;  1U1X A;  1BWZ A;  1U0K A;  1W62 A;  4Q2H A;  2GKJ A;  2AZP A;  2Q9J A;  4LB0 A;  4Q60 A;  5H2G A;  4K7X A;  1TM0 A;  2PW0 A;  2GKE A;  2H9F A;  1U1V A;  3EDN A;  5M47 A;  4K7G B;  4JD7 A;  2Q9H A;  3EJX A;  2PVZ A;  1GQZ A; 
#chains in the Genus database with same CATH topology
 3G98 A;  3FVE A;  1XUA A;  4OA3 A;  2ZXR A;  3PVH A;  4IK0 A;  3G7K A;  2ZXO A;  2OTN A;  1YM5 A;  2QB6 A;  5ANP A;  1W61 A;  1SDJ A;  1I74 A;  1U0K A;  1WPP A;  2LT2 A;  4LG3 A;  4LB0 A;  5H2G A;  1WPM A;  4JD7 A;  2Q9H A;  3EJX A;  2YMA A;  4JBD A;  2ZXP A;  4J9X A;  2KPT A;  5H2Y A;  3PW9 A;  3PTJ A;  1BWZ A;  2KW7 A;  2Q9J A;  2QB8 A;  1TM0 A;  2GKE A;  1U1V A;  3ICJ A;  2HAW A;  1K20 A;  3WQZ A;  1GQZ A;  1QYA A;  1S7J A;  1QY9 A;  4PY9 A;  1IR6 A;  1XUB A;  3DEV A;  4JCI A;  4JUU A;  4K8L A;  4RPA A;  2EB0 A;  4J9W A;  4GL6 A;  2AZP A;  2ENX A;  2PW0 A;  2H9F A;  3EDN A;  5M47 A;  2MPB A;  5IWE A;  3EKM A;  2ZVF A;  4IJZ A;  5HA4 A;  1T6K A;  4DUN A;  1K23 A;  1U1W A;  1U1X A;  1W62 A;  2IW4 A;  4Q2H A;  2GKJ A;  4Q60 A;  3IGH X;  4K7X A;  3W5W A;  4LS9 A;  4K7G B;  2QB7 A;  2PVZ A; 
#chains in the Genus database with same CATH homology
 3G98 A;  3FVE A;  1XUA A;  4OA3 A;  2ZXR A;  3PVH A;  4IK0 A;  3G7K A;  2ZXO A;  2OTN A;  1YM5 A;  2QB6 A;  5ANP A;  1W61 A;  1SDJ A;  1I74 A;  1U0K A;  1WPP A;  2LT2 A;  4LG3 A;  4LB0 A;  5H2G A;  1WPM A;  4JD7 A;  2Q9H A;  3EJX A;  2YMA A;  4JBD A;  2ZXP A;  4J9X A;  2KPT A;  5H2Y A;  3PW9 A;  3PTJ A;  1BWZ A;  2KW7 A;  2Q9J A;  2QB8 A;  1TM0 A;  2GKE A;  1U1V A;  3ICJ A;  2HAW A;  1K20 A;  3WQZ A;  1GQZ A;  1QYA A;  1S7J A;  1QY9 A;  4PY9 A;  1IR6 A;  1XUB A;  3DEV A;  4JCI A;  4JUU A;  4K8L A;  4RPA A;  2EB0 A;  4J9W A;  4GL6 A;  2AZP A;  2ENX A;  2PW0 A;  2H9F A;  3EDN A;  5M47 A;  2MPB A;  5IWE A;  3EKM A;  2ZVF A;  4IJZ A;  5HA4 A;  1T6K A;  4DUN A;  1K23 A;  1U1W A;  1U1X A;  1W62 A;  2IW4 A;  4Q2H A;  2GKJ A;  4Q60 A;  3IGH X;  4K7X A;  3W5W A;  4LS9 A;  4K7G B;  2QB7 A;  2PVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...