4JUUA

Crystal structure of a putative hydroxyproline epimerase from xanthomonas campestris (target efi-506516) with bound phosphate and unknown ligand
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
315
structure length
315
Chain Sequence
b'FQSMHTIDVIDSHTAGEPTRVVLAGFPDLGDGDLAQCRERFRSDFDHWRSAIACEPRGSDTMVGALLLPPRDPSACTGVIFFNNVGYLGMCGHGTIGVVRTLAELGRIAPGQHRIETPVGTVGVALADDGTVSIDNVESYRHAAGVEVDVPGHGRVRGDVAWGGNWFFITEQAPCALGLAQQRELTAYTEAIRLALEAAGITGEAGGEIDHIEISGVAPDGSGAARNFVLCPGLAYDRSPCGTGTSAKLACLAADGKLAEGERWLQQGILGSAFEGSYRHSGRGIAPRISGHAFITARSQLLIDPADPFAWGIVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epimerase
publication title Crystal structure of a putative hydroxyproline epimerase from xanthomonas campestris (TARGET EFI-506516) with bound phosphate and unknown ligand
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Isomerase
total genus 76
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4juuA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4juuA01
3FVEA 2PW0A 1QY9A 2OTNA 4J9WA 1YM5A 2AZPA 2Q9JA 4JD7A 4K7XA 3EKMA 4K8LA 2H9FA 3EDNA 1XUAA 2GKJA 1GQZA 1S7JA 5H2GA 1U1XA 1XUBA 5H2YA 5HA4A 4J9XA 4JBDA 1W62A 4IK0A 1T6KA 4K7GB 1BWZA 1TM0A 1U1WA 2Q9HA 1U0KA 4IJZA 4DUNA 1QYAA 4JCIA 5IWEA 3G7KA 4Q60A 2GKEA 2PVZA 1SDJA 4LB0A 1W61A 4Q2HA 3EJXA 4JUUA 1U1VA 5M47A
chains in the Genus database with same CATH superfamily
2IW4A 3IGHX 3ICJA 3EKMA 4K7XA 4K8LA 2H9FA 1XUAA 2GKJA 2KPTA 5H2GA 1U1XA 1XUBA 5H2YA 4GL6A 2ZVFA 4J9XA 2YMAA 3W5WA 4Q60A 2PVZA 4LB0A 1W61A 3FVEA 1QY9A 2AZPA 2MPBA 2Q9JA 5ANPA 1S7JA 2ZXRA 4IK0A 1T6KA 4RPAA 4K7GB 3PVHA 2Q9HA 1U0KA 4DUNA 2ENXA 2LT2A 2QB7A 3G98A 4LS9A 1SDJA 5M47A 2PW0A 2OTNA 4J9WA 3EDNA 2QB8A 2KW7A 2QB6A 4OA3A 4LG3A 1TM0A 1U1WA 1I74A 4IJZA 1QYAA 1IR6A 4JCIA 2GKEA 4Q2HA 4JUUA 1U1VA 2EB0A 1K20A 1YM5A 2HAWA 4JD7A 1WPPA 3DEVA 2ZXOA 3PTJA 4PY9A 1GQZA 5HA4A 1K23A 4JBDA 1W62A 3PW9A 1BWZA 3WQZA 2ZXPA 1WPMA 5IWEA 3G7KA 3EJXA
chains in the Genus database with same CATH topology
2IW4A 3IGHX 3ICJA 3EKMA 4K7XA 4K8LA 2H9FA 1XUAA 2GKJA 2KPTA 5H2GA 1U1XA 1XUBA 5H2YA 4GL6A 2ZVFA 4J9XA 2YMAA 3W5WA 4Q60A 2PVZA 4LB0A 1W61A 3FVEA 1QY9A 2AZPA 2MPBA 2Q9JA 5ANPA 1S7JA 2ZXRA 4IK0A 1T6KA 4RPAA 4K7GB 3PVHA 2Q9HA 1U0KA 4DUNA 2ENXA 2LT2A 2QB7A 3G98A 4LS9A 1SDJA 5M47A 2PW0A 2OTNA 4J9WA 3EDNA 2QB8A 2KW7A 2QB6A 4OA3A 4LG3A 1TM0A 1U1WA 1I74A 4IJZA 1QYAA 1IR6A 4JCIA 2GKEA 4Q2HA 4JUUA 1U1VA 2EB0A 1K20A 1YM5A 2HAWA 4JD7A 1WPPA 3DEVA 2ZXOA 3PTJA 4PY9A 1GQZA 5HA4A 1K23A 4JBDA 1W62A 3PW9A 1BWZA 3WQZA 2ZXPA 1WPMA 5IWEA 3G7KA 3EJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVE A;  2PW0 A;  1QY9 A;  2OTN A;  4J9W A;  1YM5 A;  2AZP A;  2Q9J A;  4JD7 A;  4K7X A;  3EKM A;  4K8L A;  2H9F A;  3EDN A;  1XUA A;  2GKJ A;  1GQZ A;  1S7J A;  5H2G A;  1U1X A;  1XUB A;  5H2Y A;  5HA4 A;  4J9X A;  4JBD A;  1W62 A;  4IK0 A;  1T6K A;  4K7G B;  1BWZ A;  1TM0 A;  1U1W A;  2Q9H A;  1U0K A;  4IJZ A;  4DUN A;  1QYA A;  4JCI A;  5IWE A;  3G7K A;  4Q60 A;  2GKE A;  2PVZ A;  1SDJ A;  4LB0 A;  1W61 A;  4Q2H A;  3EJX A;  4JUU A;  1U1V A;  5M47 A; 
#chains in the Genus database with same CATH topology
 2IW4 A;  3IGH X;  3ICJ A;  3EKM A;  4K7X A;  4K8L A;  2H9F A;  1XUA A;  2GKJ A;  2KPT A;  5H2G A;  1U1X A;  1XUB A;  5H2Y A;  4GL6 A;  2ZVF A;  4J9X A;  2YMA A;  3W5W A;  4Q60 A;  2PVZ A;  4LB0 A;  1W61 A;  3FVE A;  1QY9 A;  2AZP A;  2MPB A;  2Q9J A;  5ANP A;  1S7J A;  2ZXR A;  4IK0 A;  1T6K A;  4RPA A;  4K7G B;  3PVH A;  2Q9H A;  1U0K A;  4DUN A;  2ENX A;  2LT2 A;  2QB7 A;  3G98 A;  4LS9 A;  1SDJ A;  5M47 A;  2PW0 A;  2OTN A;  4J9W A;  3EDN A;  2QB8 A;  2KW7 A;  2QB6 A;  4OA3 A;  4LG3 A;  1TM0 A;  1U1W A;  1I74 A;  4IJZ A;  1QYA A;  1IR6 A;  4JCI A;  2GKE A;  4Q2H A;  4JUU A;  1U1V A;  2EB0 A;  1K20 A;  1YM5 A;  2HAW A;  4JD7 A;  1WPP A;  3DEV A;  2ZXO A;  3PTJ A;  4PY9 A;  1GQZ A;  5HA4 A;  1K23 A;  4JBD A;  1W62 A;  3PW9 A;  1BWZ A;  3WQZ A;  2ZXP A;  1WPM A;  5IWE A;  3G7K A;  3EJX A; 
#chains in the Genus database with same CATH homology
 2IW4 A;  3IGH X;  3ICJ A;  3EKM A;  4K7X A;  4K8L A;  2H9F A;  1XUA A;  2GKJ A;  2KPT A;  5H2G A;  1U1X A;  1XUB A;  5H2Y A;  4GL6 A;  2ZVF A;  4J9X A;  2YMA A;  3W5W A;  4Q60 A;  2PVZ A;  4LB0 A;  1W61 A;  3FVE A;  1QY9 A;  2AZP A;  2MPB A;  2Q9J A;  5ANP A;  1S7J A;  2ZXR A;  4IK0 A;  1T6K A;  4RPA A;  4K7G B;  3PVH A;  2Q9H A;  1U0K A;  4DUN A;  2ENX A;  2LT2 A;  2QB7 A;  3G98 A;  4LS9 A;  1SDJ A;  5M47 A;  2PW0 A;  2OTN A;  4J9W A;  3EDN A;  2QB8 A;  2KW7 A;  2QB6 A;  4OA3 A;  4LG3 A;  1TM0 A;  1U1W A;  1I74 A;  4IJZ A;  1QYA A;  1IR6 A;  4JCI A;  2GKE A;  4Q2H A;  4JUU A;  1U1V A;  2EB0 A;  1K20 A;  1YM5 A;  2HAW A;  4JD7 A;  1WPP A;  3DEV A;  2ZXO A;  3PTJ A;  4PY9 A;  1GQZ A;  5HA4 A;  1K23 A;  4JBD A;  1W62 A;  3PW9 A;  1BWZ A;  3WQZ A;  2ZXP A;  1WPM A;  5IWE A;  3G7K A;  3EJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...