4JUUA

Crystal structure of a putative hydroxyproline epimerase from xanthomonas campestris (target efi-506516) with bound phosphate and unknown ligand
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
315
structure length
315
Chain Sequence
FQSMHTIDVIDSHTAGEPTRVVLAGFPDLGDGDLAQCRERFRSDFDHWRSAIACEPRGSDTMVGALLLPPRDPSACTGVIFFNNVGYLGMCGHGTIGVVRTLAELGRIAPGQHRIETPVGTVGVALADDGTVSIDNVESYRHAAGVEVDVPGHGRVRGDVAWGGNWFFITEQAPCALGLAQQRELTAYTEAIRLALEAAGITGEAGGEIDHIEISGVAPDGSGAARNFVLCPGLAYDRSPCGTGTSAKLACLAADGKLAEGERWLQQGILGSAFEGSYRHSGRGIAPRISGHAFITARSQLLIDPADPFAWGIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative hydroxyproline epimerase from xanthomonas campestris (TARGET EFI-506516) with bound phosphate and unknown ligand
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Isomerase
molecule keywords Epimerase
total genus 76
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4juuA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4juuA01
4Q2HA 1U1VA 2H9FA 4J9WA 1T6KA 5H2YA 2Q9HA 4IK0A 3G7KA 5M47A 4K7XA 4IJZA 1QYAA 1TM0A 4JUUA 5HA4A 1QY9A 2GKEA 1U0KA 5H2GA 2OTNA 1BWZA 1W61A 1U1XA 1GQZA 3EJXA 4DUNA 5IWEA 4K8LA 4K7GB 2PVZA 2PW0A 4JCIA 3EKMA 4JD7A 1YM5A 1S7JA 1XUAA 4JBDA 1U1WA 1W62A 2AZPA 4J9XA 4LB0A 3EDNA 2Q9JA 1XUBA 2GKJA 3FVEA 1SDJA 4Q60A
chains in the Genus database with same CATH superfamily
2KPTA 4IK0A 3G7KA 4IJZA 1TM0A 4JUUA 5HA4A 1U0KA 5H2GA 4OA3A 2OTNA 1GQZA 3EJXA 1WPMA 1K20A 2PVZA 4JCIA 3PTJA 3G98A 2ZXOA 1U1WA 2MPBA 2Q9HA 4Q60A 4GL6A 1U1VA 1T6KA 5M47A 1QYAA 2QB8A 4RPAA 1WPPA 2EB0A 4DUNA 4K7GB 2HAWA 2LT2A 2IW4A 4LB0A 2AZPA 3EDNA 2GKJA 1K23A 2ENXA 3WQZA 4Q2HA 2H9FA 4J9WA 3PW9A 4K7XA 4LG3A 1QY9A 2YMAA 3DEVA 3PVHA 1W61A 2QB7A 4K8LA 2ZXPA 2PW0A 1IR6A 1W62A 4J9XA 2QB6A 2KW7A 2ZXRA 4LS9A 5H2YA 5ANPA 2GKEA 4PY9A 1BWZA 1U1XA 3IGHX 3W5WA 5IWEA 3EKMA 2ZVFA 4JD7A 1YM5A 1S7JA 1XUAA 1I74A 4JBDA 3FVEA 2Q9JA 1XUBA 3ICJA 1SDJA
chains in the Genus database with same CATH topology
2KPTA 4IK0A 3G7KA 4IJZA 1TM0A 4JUUA 5HA4A 1U0KA 5H2GA 4OA3A 2OTNA 1GQZA 3EJXA 1WPMA 1K20A 2PVZA 4JCIA 3PTJA 3G98A 2ZXOA 1U1WA 2MPBA 2Q9HA 4Q60A 4GL6A 1U1VA 1T6KA 5M47A 1QYAA 2QB8A 4RPAA 1WPPA 2EB0A 4DUNA 4K7GB 2HAWA 2LT2A 2IW4A 4LB0A 2AZPA 3EDNA 2GKJA 1K23A 2ENXA 3WQZA 4Q2HA 2H9FA 4J9WA 3PW9A 4K7XA 4LG3A 1QY9A 2YMAA 3DEVA 3PVHA 1W61A 2QB7A 4K8LA 2ZXPA 2PW0A 1IR6A 1W62A 4J9XA 2QB6A 2KW7A 2ZXRA 4LS9A 5H2YA 5ANPA 2GKEA 4PY9A 1BWZA 1U1XA 3IGHX 3W5WA 5IWEA 3EKMA 2ZVFA 4JD7A 1YM5A 1S7JA 1XUAA 1I74A 4JBDA 3FVEA 2Q9JA 1XUBA 3ICJA 1SDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2H A;  1U1V A;  2H9F A;  4J9W A;  1T6K A;  5H2Y A;  2Q9H A;  4IK0 A;  3G7K A;  5M47 A;  4K7X A;  4IJZ A;  1QYA A;  1TM0 A;  4JUU A;  5HA4 A;  1QY9 A;  2GKE A;  1U0K A;  5H2G A;  2OTN A;  1BWZ A;  1W61 A;  1U1X A;  1GQZ A;  3EJX A;  4DUN A;  5IWE A;  4K8L A;  4K7G B;  2PVZ A;  2PW0 A;  4JCI A;  3EKM A;  4JD7 A;  1YM5 A;  1S7J A;  1XUA A;  4JBD A;  1U1W A;  1W62 A;  2AZP A;  4J9X A;  4LB0 A;  3EDN A;  2Q9J A;  1XUB A;  2GKJ A;  3FVE A;  1SDJ A;  4Q60 A; 
#chains in the Genus database with same CATH topology
 2KPT A;  4IK0 A;  3G7K A;  4IJZ A;  1TM0 A;  4JUU A;  5HA4 A;  1U0K A;  5H2G A;  4OA3 A;  2OTN A;  1GQZ A;  3EJX A;  1WPM A;  1K20 A;  2PVZ A;  4JCI A;  3PTJ A;  3G98 A;  2ZXO A;  1U1W A;  2MPB A;  2Q9H A;  4Q60 A;  4GL6 A;  1U1V A;  1T6K A;  5M47 A;  1QYA A;  2QB8 A;  4RPA A;  1WPP A;  2EB0 A;  4DUN A;  4K7G B;  2HAW A;  2LT2 A;  2IW4 A;  4LB0 A;  2AZP A;  3EDN A;  2GKJ A;  1K23 A;  2ENX A;  3WQZ A;  4Q2H A;  2H9F A;  4J9W A;  3PW9 A;  4K7X A;  4LG3 A;  1QY9 A;  2YMA A;  3DEV A;  3PVH A;  1W61 A;  2QB7 A;  4K8L A;  2ZXP A;  2PW0 A;  1IR6 A;  1W62 A;  4J9X A;  2QB6 A;  2KW7 A;  2ZXR A;  4LS9 A;  5H2Y A;  5ANP A;  2GKE A;  4PY9 A;  1BWZ A;  1U1X A;  3IGH X;  3W5W A;  5IWE A;  3EKM A;  2ZVF A;  4JD7 A;  1YM5 A;  1S7J A;  1XUA A;  1I74 A;  4JBD A;  3FVE A;  2Q9J A;  1XUB A;  3ICJ A;  1SDJ A; 
#chains in the Genus database with same CATH homology
 2KPT A;  4IK0 A;  3G7K A;  4IJZ A;  1TM0 A;  4JUU A;  5HA4 A;  1U0K A;  5H2G A;  4OA3 A;  2OTN A;  1GQZ A;  3EJX A;  1WPM A;  1K20 A;  2PVZ A;  4JCI A;  3PTJ A;  3G98 A;  2ZXO A;  1U1W A;  2MPB A;  2Q9H A;  4Q60 A;  4GL6 A;  1U1V A;  1T6K A;  5M47 A;  1QYA A;  2QB8 A;  4RPA A;  1WPP A;  2EB0 A;  4DUN A;  4K7G B;  2HAW A;  2LT2 A;  2IW4 A;  4LB0 A;  2AZP A;  3EDN A;  2GKJ A;  1K23 A;  2ENX A;  3WQZ A;  4Q2H A;  2H9F A;  4J9W A;  3PW9 A;  4K7X A;  4LG3 A;  1QY9 A;  2YMA A;  3DEV A;  3PVH A;  1W61 A;  2QB7 A;  4K8L A;  2ZXP A;  2PW0 A;  1IR6 A;  1W62 A;  4J9X A;  2QB6 A;  2KW7 A;  2ZXR A;  4LS9 A;  5H2Y A;  5ANP A;  2GKE A;  4PY9 A;  1BWZ A;  1U1X A;  3IGH X;  3W5W A;  5IWE A;  3EKM A;  2ZVF A;  4JD7 A;  1YM5 A;  1S7J A;  1XUA A;  1I74 A;  4JBD A;  3FVE A;  2Q9J A;  1XUB A;  3ICJ A;  1SDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...