2YMAA

X-ray structure of the yos9 dimerization domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
135
structure length
135
Chain Sequence
b'SIGSNSIDLITKYEPIFLGSGIYFLRPFNTDERDKLMVTDNAMSNWDEITETYYQKFGNAINKMLSLRLVSLPNGHILQPGDSCVWLAEVVDMKDRFQTTLSLNILNSQRAEIFFNKTFTFNEDNGNFLSYKIGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN OS-9 HOMOLOG
publication title Structural and Biochemical Basis of Yos9 Protein Dimerization and Possible Contribution to Self-Association of 3-Hydroxy-3-Methylglutaryl-Coenzyme a Reductase Degradation Ubiquitin-Ligase Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Carbohydrate binding protein
total genus 24
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17880 Yos9_DD Yos9 dimerzation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.60 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2ymaA00
2YMAA
chains in the Genus database with same CATH superfamily
1QY9A 2Q9HA 4IJZA 3ICJA 4RPAA 2ENXA 1WPPA 2H9FA 2GKEA 1BWZA 3W5WA 1YM5A 4Q2HA 1T6KA 1K23A 4J9WA 3PW9A 1GQZA 5H2YA 1SDJA 2ZVFA 2LT2A 1S7JA 1IR6A 1U1WA 5HA4A 2QB6A 2HAWA 5ANPA 1WPMA 4JD7A 2QB8A 1U0KA 1W62A 4JCIA 4JBDA 2ZXOA 1U1VA 2OTNA 4Q60A 2MPBA 3DEVA 1XUBA 2PW0A 2GKJA 4DUNA 5H2GA 3PVHA 4IK0A 4J9XA 3G7KA 1K20A 2ZXPA 4K7GB 5IWEA 3EDNA 3WQZA 4OA3A 2KW7A 3EJXA 4LG3A 4PY9A 4LB0A 2PVZA 2KPTA 5M47A 2ZXRA 4K7XA 2Q9JA 1XUAA 3PTJA 2YMAA 4GL6A 2AZPA 1I74A 3FVEA 3EKMA 1U1XA 2IW4A 4K8LA 4LS9A 3IGHX 4JUUA 1W61A 1QYAA 3G98A 2EB0A 1TM0A 2QB7A
chains in the Genus database with same CATH topology
1QY9A 2Q9HA 4IJZA 3ICJA 4RPAA 2ENXA 1WPPA 2H9FA 2GKEA 1BWZA 3W5WA 1YM5A 4Q2HA 1T6KA 1K23A 4J9WA 3PW9A 1GQZA 5H2YA 1SDJA 2ZVFA 2LT2A 1S7JA 1IR6A 1U1WA 5HA4A 2QB6A 2HAWA 5ANPA 1WPMA 4JD7A 2QB8A 1U0KA 1W62A 4JCIA 4JBDA 2ZXOA 1U1VA 2OTNA 4Q60A 2MPBA 3DEVA 1XUBA 2PW0A 2GKJA 4DUNA 5H2GA 3PVHA 4IK0A 4J9XA 3G7KA 1K20A 2ZXPA 4K7GB 5IWEA 3EDNA 3WQZA 4OA3A 2KW7A 3EJXA 4LG3A 4PY9A 4LB0A 2PVZA 2KPTA 5M47A 2ZXRA 4K7XA 2Q9JA 1XUAA 3PTJA 2YMAA 4GL6A 2AZPA 1I74A 3FVEA 3EKMA 1U1XA 2IW4A 4K8LA 4LS9A 3IGHX 4JUUA 1W61A 1QYAA 3G98A 2EB0A 1TM0A 2QB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMA A; 
#chains in the Genus database with same CATH topology
 1QY9 A;  2Q9H A;  4IJZ A;  3ICJ A;  4RPA A;  2ENX A;  1WPP A;  2H9F A;  2GKE A;  1BWZ A;  3W5W A;  1YM5 A;  4Q2H A;  1T6K A;  1K23 A;  4J9W A;  3PW9 A;  1GQZ A;  5H2Y A;  1SDJ A;  2ZVF A;  2LT2 A;  1S7J A;  1IR6 A;  1U1W A;  5HA4 A;  2QB6 A;  2HAW A;  5ANP A;  1WPM A;  4JD7 A;  2QB8 A;  1U0K A;  1W62 A;  4JCI A;  4JBD A;  2ZXO A;  1U1V A;  2OTN A;  4Q60 A;  2MPB A;  3DEV A;  1XUB A;  2PW0 A;  2GKJ A;  4DUN A;  5H2G A;  3PVH A;  4IK0 A;  4J9X A;  3G7K A;  1K20 A;  2ZXP A;  4K7G B;  5IWE A;  3EDN A;  3WQZ A;  4OA3 A;  2KW7 A;  3EJX A;  4LG3 A;  4PY9 A;  4LB0 A;  2PVZ A;  2KPT A;  5M47 A;  2ZXR A;  4K7X A;  2Q9J A;  1XUA A;  3PTJ A;  2YMA A;  4GL6 A;  2AZP A;  1I74 A;  3FVE A;  3EKM A;  1U1X A;  2IW4 A;  4K8L A;  4LS9 A;  3IGH X;  4JUU A;  1W61 A;  1QYA A;  3G98 A;  2EB0 A;  1TM0 A;  2QB7 A; 
#chains in the Genus database with same CATH homology
 1QY9 A;  2Q9H A;  4IJZ A;  3ICJ A;  4RPA A;  2ENX A;  1WPP A;  2H9F A;  2GKE A;  1BWZ A;  3W5W A;  1YM5 A;  4Q2H A;  1T6K A;  1K23 A;  4J9W A;  3PW9 A;  1GQZ A;  5H2Y A;  1SDJ A;  2ZVF A;  2LT2 A;  1S7J A;  1IR6 A;  1U1W A;  5HA4 A;  2QB6 A;  2HAW A;  5ANP A;  1WPM A;  4JD7 A;  2QB8 A;  1U0K A;  1W62 A;  4JCI A;  4JBD A;  2ZXO A;  1U1V A;  2OTN A;  4Q60 A;  2MPB A;  3DEV A;  1XUB A;  2PW0 A;  2GKJ A;  4DUN A;  5H2G A;  3PVH A;  4IK0 A;  4J9X A;  3G7K A;  1K20 A;  2ZXP A;  4K7G B;  5IWE A;  3EDN A;  3WQZ A;  4OA3 A;  2KW7 A;  3EJX A;  4LG3 A;  4PY9 A;  4LB0 A;  2PVZ A;  2KPT A;  5M47 A;  2ZXR A;  4K7X A;  2Q9J A;  1XUA A;  3PTJ A;  2YMA A;  4GL6 A;  2AZP A;  1I74 A;  3FVE A;  3EKM A;  1U1X A;  2IW4 A;  4K8L A;  4LS9 A;  3IGH X;  4JUU A;  1W61 A;  1QYA A;  3G98 A;  2EB0 A;  1TM0 A;  2QB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...