2YMAA

X-ray structure of the yos9 dimerization domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
135
structure length
135
Chain Sequence
SIGSNSIDLITKYEPIFLGSGIYFLRPFNTDERDKLMVTDNAMSNWDEITETYYQKFGNAINKMLSLRLVSLPNGHILQPGDSCVWLAEVVDMKDRFQTTLSLNILNSQRAEIFFNKTFTFNEDNGNFLSYKIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Biochemical Basis of Yos9 Protein Dimerization and Possible Contribution to Self-Association of 3-Hydroxy-3-Methylglutaryl-Coenzyme a Reductase Degradation Ubiquitin-Ligase Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Carbohydrate binding protein
molecule keywords PROTEIN OS-9 HOMOLOG
total genus 24
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17880 Yos9_DD Yos9 dimerzation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.60 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2ymaA00
2YMAA
chains in the Genus database with same CATH superfamily
1K20A 2ZXRA 1U0KA 2IW4A 1WPMA 2Q9HA 3W5WA 4K7XA 1QY9A 1IR6A 2AZPA 2ZXPA 1XUAA 2MPBA 2Q9JA 2PW0A 1QYAA 1W61A 5H2YA 2QB6A 1W62A 3PVHA 2KW7A 4Q60A 4LB0A 1T6KA 1U1VA 1WPPA 1YM5A 3PTJA 4K8LA 4LG3A 3EJXA 3IGHX 3G98A 2ENXA 2PVZA 1I74A 2ZXOA 4JBDA 2GKJA 3EDNA 4PY9A 4Q2HA 2QB7A 2KPTA 3PW9A 4DUNA 5H2GA 5HA4A 3FVEA 3ICJA 2EB0A 5M47A 2LT2A 3WQZA 3DEVA 2H9FA 4K7GB 4JCIA 1U1XA 1BWZA 1XUBA 4JD7A 4JUUA 4IK0A 2ZVFA 1S7JA 5ANPA 2YMAA 1GQZA 1TM0A 4J9WA 5IWEA 2OTNA 4LS9A 1U1WA 3EKMA 4IJZA 3G7KA 1K23A 2QB8A 1SDJA 4OA3A 4GL6A 2GKEA 4RPAA 4J9XA 2HAWA
chains in the Genus database with same CATH topology
1K20A 2ZXRA 1U0KA 2IW4A 1WPMA 2Q9HA 3W5WA 4K7XA 1QY9A 1IR6A 2AZPA 2ZXPA 1XUAA 2MPBA 2Q9JA 2PW0A 1QYAA 1W61A 5H2YA 2QB6A 1W62A 3PVHA 2KW7A 4Q60A 4LB0A 1T6KA 1U1VA 1WPPA 1YM5A 3PTJA 4K8LA 4LG3A 3EJXA 3IGHX 3G98A 2ENXA 2PVZA 1I74A 2ZXOA 4JBDA 2GKJA 3EDNA 4PY9A 4Q2HA 2QB7A 2KPTA 3PW9A 4DUNA 5H2GA 5HA4A 3FVEA 3ICJA 2EB0A 5M47A 2LT2A 3WQZA 3DEVA 2H9FA 4K7GB 4JCIA 1U1XA 1BWZA 1XUBA 4JD7A 4JUUA 4IK0A 2ZVFA 1S7JA 5ANPA 2YMAA 1GQZA 1TM0A 4J9WA 5IWEA 2OTNA 4LS9A 1U1WA 3EKMA 4IJZA 3G7KA 1K23A 2QB8A 1SDJA 4OA3A 4GL6A 2GKEA 4RPAA 4J9XA 2HAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMA A; 
#chains in the Genus database with same CATH topology
 1K20 A;  2ZXR A;  1U0K A;  2IW4 A;  1WPM A;  2Q9H A;  3W5W A;  4K7X A;  1QY9 A;  1IR6 A;  2AZP A;  2ZXP A;  1XUA A;  2MPB A;  2Q9J A;  2PW0 A;  1QYA A;  1W61 A;  5H2Y A;  2QB6 A;  1W62 A;  3PVH A;  2KW7 A;  4Q60 A;  4LB0 A;  1T6K A;  1U1V A;  1WPP A;  1YM5 A;  3PTJ A;  4K8L A;  4LG3 A;  3EJX A;  3IGH X;  3G98 A;  2ENX A;  2PVZ A;  1I74 A;  2ZXO A;  4JBD A;  2GKJ A;  3EDN A;  4PY9 A;  4Q2H A;  2QB7 A;  2KPT A;  3PW9 A;  4DUN A;  5H2G A;  5HA4 A;  3FVE A;  3ICJ A;  2EB0 A;  5M47 A;  2LT2 A;  3WQZ A;  3DEV A;  2H9F A;  4K7G B;  4JCI A;  1U1X A;  1BWZ A;  1XUB A;  4JD7 A;  4JUU A;  4IK0 A;  2ZVF A;  1S7J A;  5ANP A;  2YMA A;  1GQZ A;  1TM0 A;  4J9W A;  5IWE A;  2OTN A;  4LS9 A;  1U1W A;  3EKM A;  4IJZ A;  3G7K A;  1K23 A;  2QB8 A;  1SDJ A;  4OA3 A;  4GL6 A;  2GKE A;  4RPA A;  4J9X A;  2HAW A; 
#chains in the Genus database with same CATH homology
 1K20 A;  2ZXR A;  1U0K A;  2IW4 A;  1WPM A;  2Q9H A;  3W5W A;  4K7X A;  1QY9 A;  1IR6 A;  2AZP A;  2ZXP A;  1XUA A;  2MPB A;  2Q9J A;  2PW0 A;  1QYA A;  1W61 A;  5H2Y A;  2QB6 A;  1W62 A;  3PVH A;  2KW7 A;  4Q60 A;  4LB0 A;  1T6K A;  1U1V A;  1WPP A;  1YM5 A;  3PTJ A;  4K8L A;  4LG3 A;  3EJX A;  3IGH X;  3G98 A;  2ENX A;  2PVZ A;  1I74 A;  2ZXO A;  4JBD A;  2GKJ A;  3EDN A;  4PY9 A;  4Q2H A;  2QB7 A;  2KPT A;  3PW9 A;  4DUN A;  5H2G A;  5HA4 A;  3FVE A;  3ICJ A;  2EB0 A;  5M47 A;  2LT2 A;  3WQZ A;  3DEV A;  2H9F A;  4K7G B;  4JCI A;  1U1X A;  1BWZ A;  1XUB A;  4JD7 A;  4JUU A;  4IK0 A;  2ZVF A;  1S7J A;  5ANP A;  2YMA A;  1GQZ A;  1TM0 A;  4J9W A;  5IWE A;  2OTN A;  4LS9 A;  1U1W A;  3EKM A;  4IJZ A;  3G7K A;  1K23 A;  2QB8 A;  1SDJ A;  4OA3 A;  4GL6 A;  2GKE A;  4RPA A;  4J9X A;  2HAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...