2YMAA

X-ray structure of the yos9 dimerization domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
135
structure length
135
Chain Sequence
SIGSNSIDLITKYEPIFLGSGIYFLRPFNTDERDKLMVTDNAMSNWDEITETYYQKFGNAINKMLSLRLVSLPNGHILQPGDSCVWLAEVVDMKDRFQTTLSLNILNSQRAEIFFNKTFTFNEDNGNFLSYKIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Biochemical Basis of Yos9 Protein Dimerization and Possible Contribution to Self-Association of 3-Hydroxy-3-Methylglutaryl-Coenzyme a Reductase Degradation Ubiquitin-Ligase Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Carbohydrate binding protein
molecule keywords PROTEIN OS-9 HOMOLOG
total genus 24
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17880 Yos9_DD Yos9 dimerzation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.60 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2ymaA00
2YMAA
chains in the Genus database with same CATH superfamily
5H2GA 4K7XA 3ICJA 2GKEA 4K8LA 1W62A 2QB8A 2HAWA 2ZXPA 5H2YA 4DUNA 4PY9A 3IGHX 1WPMA 1WPPA 1K20A 2MPBA 3PVHA 3W5WA 2QB6A 1U0KA 2EB0A 1T6KA 2AZPA 2IW4A 2H9FA 2Q9JA 2ENXA 4IK0A 5HA4A 3EJXA 1YM5A 3G7KA 2OTNA 4J9WA 4GL6A 4RPAA 4J9XA 4IJZA 4JCIA 1TM0A 1QYAA 4OA3A 1XUBA 3DEVA 2KPTA 1U1WA 1U1XA 3PTJA 3FVEA 2LT2A 4K7GB 2ZXOA 1QY9A 4LS9A 2Q9HA 4LG3A 1K23A 2PW0A 1GQZA 5IWEA 5M47A 1S7JA 4LB0A 2YMAA 1W61A 1IR6A 2PVZA 1U1VA 2ZXRA 4Q60A 3PW9A 1BWZA 4JBDA 1XUAA 2GKJA 3G98A 4JUUA 3EDNA 3EKMA 2ZVFA 1SDJA 1I74A 4Q2HA 5ANPA 4JD7A 2KW7A 2QB7A 3WQZA
chains in the Genus database with same CATH topology
5H2GA 4K7XA 3ICJA 2GKEA 4K8LA 1W62A 2QB8A 2HAWA 2ZXPA 5H2YA 4DUNA 4PY9A 3IGHX 1WPMA 1WPPA 1K20A 2MPBA 3PVHA 3W5WA 2QB6A 1U0KA 2EB0A 1T6KA 2AZPA 2IW4A 2H9FA 2Q9JA 2ENXA 4IK0A 5HA4A 3EJXA 1YM5A 3G7KA 2OTNA 4J9WA 4GL6A 4RPAA 4J9XA 4IJZA 4JCIA 1TM0A 1QYAA 4OA3A 1XUBA 3DEVA 2KPTA 1U1WA 1U1XA 3PTJA 3FVEA 2LT2A 4K7GB 2ZXOA 1QY9A 4LS9A 2Q9HA 4LG3A 1K23A 2PW0A 1GQZA 5IWEA 5M47A 1S7JA 4LB0A 2YMAA 1W61A 1IR6A 2PVZA 1U1VA 2ZXRA 4Q60A 3PW9A 1BWZA 4JBDA 1XUAA 2GKJA 3G98A 4JUUA 3EDNA 3EKMA 2ZVFA 1SDJA 1I74A 4Q2HA 5ANPA 4JD7A 2KW7A 2QB7A 3WQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMA A; 
#chains in the Genus database with same CATH topology
 5H2G A;  4K7X A;  3ICJ A;  2GKE A;  4K8L A;  1W62 A;  2QB8 A;  2HAW A;  2ZXP A;  5H2Y A;  4DUN A;  4PY9 A;  3IGH X;  1WPM A;  1WPP A;  1K20 A;  2MPB A;  3PVH A;  3W5W A;  2QB6 A;  1U0K A;  2EB0 A;  1T6K A;  2AZP A;  2IW4 A;  2H9F A;  2Q9J A;  2ENX A;  4IK0 A;  5HA4 A;  3EJX A;  1YM5 A;  3G7K A;  2OTN A;  4J9W A;  4GL6 A;  4RPA A;  4J9X A;  4IJZ A;  4JCI A;  1TM0 A;  1QYA A;  4OA3 A;  1XUB A;  3DEV A;  2KPT A;  1U1W A;  1U1X A;  3PTJ A;  3FVE A;  2LT2 A;  4K7G B;  2ZXO A;  1QY9 A;  4LS9 A;  2Q9H A;  4LG3 A;  1K23 A;  2PW0 A;  1GQZ A;  5IWE A;  5M47 A;  1S7J A;  4LB0 A;  2YMA A;  1W61 A;  1IR6 A;  2PVZ A;  1U1V A;  2ZXR A;  4Q60 A;  3PW9 A;  1BWZ A;  4JBD A;  1XUA A;  2GKJ A;  3G98 A;  4JUU A;  3EDN A;  3EKM A;  2ZVF A;  1SDJ A;  1I74 A;  4Q2H A;  5ANP A;  4JD7 A;  2KW7 A;  2QB7 A;  3WQZ A; 
#chains in the Genus database with same CATH homology
 5H2G A;  4K7X A;  3ICJ A;  2GKE A;  4K8L A;  1W62 A;  2QB8 A;  2HAW A;  2ZXP A;  5H2Y A;  4DUN A;  4PY9 A;  3IGH X;  1WPM A;  1WPP A;  1K20 A;  2MPB A;  3PVH A;  3W5W A;  2QB6 A;  1U0K A;  2EB0 A;  1T6K A;  2AZP A;  2IW4 A;  2H9F A;  2Q9J A;  2ENX A;  4IK0 A;  5HA4 A;  3EJX A;  1YM5 A;  3G7K A;  2OTN A;  4J9W A;  4GL6 A;  4RPA A;  4J9X A;  4IJZ A;  4JCI A;  1TM0 A;  1QYA A;  4OA3 A;  1XUB A;  3DEV A;  2KPT A;  1U1W A;  1U1X A;  3PTJ A;  3FVE A;  2LT2 A;  4K7G B;  2ZXO A;  1QY9 A;  4LS9 A;  2Q9H A;  4LG3 A;  1K23 A;  2PW0 A;  1GQZ A;  5IWE A;  5M47 A;  1S7J A;  4LB0 A;  2YMA A;  1W61 A;  1IR6 A;  2PVZ A;  1U1V A;  2ZXR A;  4Q60 A;  3PW9 A;  1BWZ A;  4JBD A;  1XUA A;  2GKJ A;  3G98 A;  4JUU A;  3EDN A;  3EKM A;  2ZVF A;  1SDJ A;  1I74 A;  4Q2H A;  5ANP A;  4JD7 A;  2KW7 A;  2QB7 A;  3WQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...