2LT2A

Nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of BA42 protein from the psychrophilic bacteria Bizionia argentinensis sp. nov.
rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 41
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2lt2A00
2LT2A 3PW9A 5ANPA 2KPTA 3PVHA 4OA3A 2KW7A 3PTJA 2MPBA
chains in the Genus database with same CATH superfamily
2GKJA 1U1WA 3PW9A 2PVZA 3EDNA 2ZVFA 3G98A 1YM5A 1K20A 2PW0A 2ENXA 4JD7A 1IR6A 2ZXOA 4DUNA 1QY9A 4IJZA 4IK0A 1T6KA 2AZPA 4LG3A 1WPMA 1U1VA 4J9WA 3G7KA 2QB7A 4LB0A 4JUUA 1I74A 2QB6A 3ICJA 5M47A 2KPTA 3PVHA 4RPAA 3W5WA 2OTNA 3WQZA 2GKEA 2IW4A 1SDJA 4LS9A 3PTJA 1U1XA 1S7JA 5H2GA 1WPPA 5HA4A 1K23A 5IWEA 4PY9A 4Q60A 2LT2A 1XUBA 1W62A 4JCIA 5H2YA 1QYAA 1XUAA 4K7XA 1GQZA 3EJXA 2KW7A 2Q9HA 1U0KA 2EB0A 2H9FA 1TM0A 4Q2HA 3FVEA 2QB8A 3EKMA 3IGHX 1BWZA 4OA3A 2MPBA 2HAWA 2Q9JA 5ANPA 4JBDA 4K8LA 2ZXPA 2YMAA 4K7GB 4GL6A 3DEVA 1W61A 4J9XA 2ZXRA
chains in the Genus database with same CATH topology
2GKJA 1U1WA 3PW9A 2PVZA 3EDNA 2ZVFA 3G98A 1YM5A 1K20A 2PW0A 2ENXA 4JD7A 1IR6A 2ZXOA 4DUNA 1QY9A 4IJZA 4IK0A 1T6KA 2AZPA 4LG3A 1WPMA 1U1VA 4J9WA 3G7KA 2QB7A 4LB0A 4JUUA 1I74A 2QB6A 3ICJA 5M47A 2KPTA 3PVHA 4RPAA 3W5WA 2OTNA 3WQZA 2GKEA 2IW4A 1SDJA 4LS9A 3PTJA 1U1XA 1S7JA 5H2GA 1WPPA 5HA4A 1K23A 5IWEA 4PY9A 4Q60A 2LT2A 1XUBA 1W62A 4JCIA 5H2YA 1QYAA 1XUAA 4K7XA 1GQZA 3EJXA 2KW7A 2Q9HA 1U0KA 2EB0A 2H9FA 1TM0A 4Q2HA 3FVEA 2QB8A 3EKMA 3IGHX 1BWZA 4OA3A 2MPBA 2HAWA 2Q9JA 5ANPA 4JBDA 4K8LA 2ZXPA 2YMAA 4K7GB 4GL6A 3DEVA 1W61A 4J9XA 2ZXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT2 A;  3PW9 A;  5ANP A;  2KPT A;  3PVH A;  4OA3 A;  2KW7 A;  3PTJ A;  2MPB A; 
#chains in the Genus database with same CATH topology
 2GKJ A;  1U1W A;  3PW9 A;  2PVZ A;  3EDN A;  2ZVF A;  3G98 A;  1YM5 A;  1K20 A;  2PW0 A;  2ENX A;  4JD7 A;  1IR6 A;  2ZXO A;  4DUN A;  1QY9 A;  4IJZ A;  4IK0 A;  1T6K A;  2AZP A;  4LG3 A;  1WPM A;  1U1V A;  4J9W A;  3G7K A;  2QB7 A;  4LB0 A;  4JUU A;  1I74 A;  2QB6 A;  3ICJ A;  5M47 A;  2KPT A;  3PVH A;  4RPA A;  3W5W A;  2OTN A;  3WQZ A;  2GKE A;  2IW4 A;  1SDJ A;  4LS9 A;  3PTJ A;  1U1X A;  1S7J A;  5H2G A;  1WPP A;  5HA4 A;  1K23 A;  5IWE A;  4PY9 A;  4Q60 A;  2LT2 A;  1XUB A;  1W62 A;  4JCI A;  5H2Y A;  1QYA A;  1XUA A;  4K7X A;  1GQZ A;  3EJX A;  2KW7 A;  2Q9H A;  1U0K A;  2EB0 A;  2H9F A;  1TM0 A;  4Q2H A;  3FVE A;  2QB8 A;  3EKM A;  3IGH X;  1BWZ A;  4OA3 A;  2MPB A;  2HAW A;  2Q9J A;  5ANP A;  4JBD A;  4K8L A;  2ZXP A;  2YMA A;  4K7G B;  4GL6 A;  3DEV A;  1W61 A;  4J9X A;  2ZXR A; 
#chains in the Genus database with same CATH homology
 2GKJ A;  1U1W A;  3PW9 A;  2PVZ A;  3EDN A;  2ZVF A;  3G98 A;  1YM5 A;  1K20 A;  2PW0 A;  2ENX A;  4JD7 A;  1IR6 A;  2ZXO A;  4DUN A;  1QY9 A;  4IJZ A;  4IK0 A;  1T6K A;  2AZP A;  4LG3 A;  1WPM A;  1U1V A;  4J9W A;  3G7K A;  2QB7 A;  4LB0 A;  4JUU A;  1I74 A;  2QB6 A;  3ICJ A;  5M47 A;  2KPT A;  3PVH A;  4RPA A;  3W5W A;  2OTN A;  3WQZ A;  2GKE A;  2IW4 A;  1SDJ A;  4LS9 A;  3PTJ A;  1U1X A;  1S7J A;  5H2G A;  1WPP A;  5HA4 A;  1K23 A;  5IWE A;  4PY9 A;  4Q60 A;  2LT2 A;  1XUB A;  1W62 A;  4JCI A;  5H2Y A;  1QYA A;  1XUA A;  4K7X A;  1GQZ A;  3EJX A;  2KW7 A;  2Q9H A;  1U0K A;  2EB0 A;  2H9F A;  1TM0 A;  4Q2H A;  3FVE A;  2QB8 A;  3EKM A;  3IGH X;  1BWZ A;  4OA3 A;  2MPB A;  2HAW A;  2Q9J A;  5ANP A;  4JBD A;  4K8L A;  2ZXP A;  2YMA A;  4K7G B;  4GL6 A;  3DEV A;  1W61 A;  4J9X A;  2ZXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...