2LT2A

Nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of BA42 protein from the psychrophilic bacteria Bizionia argentinensis sp. nov.
rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 41
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2lt2A00
2LT2A 4OA3A 3PVHA 2KW7A 3PW9A 3PTJA 2MPBA 2KPTA 5ANPA
chains in the Genus database with same CATH superfamily
1WPMA 4Q60A 4J9WA 2EB0A 1QY9A 1WPPA 3FVEA 1XUBA 1U1XA 2OTNA 3W5WA 5ANPA 1SDJA 2GKEA 1IR6A 4PY9A 2IW4A 4J9XA 2ZVFA 1YM5A 2ENXA 2H9FA 1XUAA 2YMAA 1QYAA 3PVHA 4JCIA 3EJXA 3EKMA 1W62A 4Q2HA 1TM0A 1U0KA 4LG3A 4GL6A 1I74A 4JUUA 2HAWA 2QB6A 2Q9JA 2QB7A 1BWZA 4K7XA 2PW0A 1U1WA 2QB8A 1U1VA 5H2YA 2KW7A 5HA4A 1K23A 1S7JA 3DEVA 2LT2A 4IJZA 4OA3A 4IK0A 5M47A 4LB0A 3G7KA 4JD7A 3EDNA 3IGHX 4JBDA 3PW9A 4K7GB 5H2GA 2ZXRA 3ICJA 4LS9A 2ZXOA 2PVZA 4DUNA 1W61A 3G98A 2AZPA 1K20A 2MPBA 3WQZA 5IWEA 4K8LA 1T6KA 3PTJA 4RPAA 1GQZA 2ZXPA 2GKJA 2KPTA 2Q9HA
chains in the Genus database with same CATH topology
1WPMA 4Q60A 4J9WA 2EB0A 1QY9A 1WPPA 3FVEA 1XUBA 1U1XA 2OTNA 3W5WA 5ANPA 1SDJA 2GKEA 1IR6A 4PY9A 2IW4A 4J9XA 2ZVFA 1YM5A 2ENXA 2H9FA 1XUAA 2YMAA 1QYAA 3PVHA 4JCIA 3EJXA 3EKMA 1W62A 4Q2HA 1TM0A 1U0KA 4LG3A 4GL6A 1I74A 4JUUA 2HAWA 2QB6A 2Q9JA 2QB7A 1BWZA 4K7XA 2PW0A 1U1WA 2QB8A 1U1VA 5H2YA 2KW7A 5HA4A 1K23A 1S7JA 3DEVA 2LT2A 4IJZA 4OA3A 4IK0A 5M47A 4LB0A 3G7KA 4JD7A 3EDNA 3IGHX 4JBDA 3PW9A 4K7GB 5H2GA 2ZXRA 3ICJA 4LS9A 2ZXOA 2PVZA 4DUNA 1W61A 3G98A 2AZPA 1K20A 2MPBA 3WQZA 5IWEA 4K8LA 1T6KA 3PTJA 4RPAA 1GQZA 2ZXPA 2GKJA 2KPTA 2Q9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT2 A;  4OA3 A;  3PVH A;  2KW7 A;  3PW9 A;  3PTJ A;  2MPB A;  2KPT A;  5ANP A; 
#chains in the Genus database with same CATH topology
 1WPM A;  4Q60 A;  4J9W A;  2EB0 A;  1QY9 A;  1WPP A;  3FVE A;  1XUB A;  1U1X A;  2OTN A;  3W5W A;  5ANP A;  1SDJ A;  2GKE A;  1IR6 A;  4PY9 A;  2IW4 A;  4J9X A;  2ZVF A;  1YM5 A;  2ENX A;  2H9F A;  1XUA A;  2YMA A;  1QYA A;  3PVH A;  4JCI A;  3EJX A;  3EKM A;  1W62 A;  4Q2H A;  1TM0 A;  1U0K A;  4LG3 A;  4GL6 A;  1I74 A;  4JUU A;  2HAW A;  2QB6 A;  2Q9J A;  2QB7 A;  1BWZ A;  4K7X A;  2PW0 A;  1U1W A;  2QB8 A;  1U1V A;  5H2Y A;  2KW7 A;  5HA4 A;  1K23 A;  1S7J A;  3DEV A;  2LT2 A;  4IJZ A;  4OA3 A;  4IK0 A;  5M47 A;  4LB0 A;  3G7K A;  4JD7 A;  3EDN A;  3IGH X;  4JBD A;  3PW9 A;  4K7G B;  5H2G A;  2ZXR A;  3ICJ A;  4LS9 A;  2ZXO A;  2PVZ A;  4DUN A;  1W61 A;  3G98 A;  2AZP A;  1K20 A;  2MPB A;  3WQZ A;  5IWE A;  4K8L A;  1T6K A;  3PTJ A;  4RPA A;  1GQZ A;  2ZXP A;  2GKJ A;  2KPT A;  2Q9H A; 
#chains in the Genus database with same CATH homology
 1WPM A;  4Q60 A;  4J9W A;  2EB0 A;  1QY9 A;  1WPP A;  3FVE A;  1XUB A;  1U1X A;  2OTN A;  3W5W A;  5ANP A;  1SDJ A;  2GKE A;  1IR6 A;  4PY9 A;  2IW4 A;  4J9X A;  2ZVF A;  1YM5 A;  2ENX A;  2H9F A;  1XUA A;  2YMA A;  1QYA A;  3PVH A;  4JCI A;  3EJX A;  3EKM A;  1W62 A;  4Q2H A;  1TM0 A;  1U0K A;  4LG3 A;  4GL6 A;  1I74 A;  4JUU A;  2HAW A;  2QB6 A;  2Q9J A;  2QB7 A;  1BWZ A;  4K7X A;  2PW0 A;  1U1W A;  2QB8 A;  1U1V A;  5H2Y A;  2KW7 A;  5HA4 A;  1K23 A;  1S7J A;  3DEV A;  2LT2 A;  4IJZ A;  4OA3 A;  4IK0 A;  5M47 A;  4LB0 A;  3G7K A;  4JD7 A;  3EDN A;  3IGH X;  4JBD A;  3PW9 A;  4K7G B;  5H2G A;  2ZXR A;  3ICJ A;  4LS9 A;  2ZXO A;  2PVZ A;  4DUN A;  1W61 A;  3G98 A;  2AZP A;  1K20 A;  2MPB A;  3WQZ A;  5IWE A;  4K8L A;  1T6K A;  3PTJ A;  4RPA A;  1GQZ A;  2ZXP A;  2GKJ A;  2KPT A;  2Q9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...