2LT2A

Nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
b'MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title NMR structure of BA42 protein from the psychrophilic bacteria Bizionia argentinensis sp. nov.
rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
total genus 41
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2lt2A00
3PTJA 2MPBA 2LT2A 4OA3A 2KW7A 3PW9A 5ANPA 2KPTA 3PVHA
chains in the Genus database with same CATH superfamily
2H9FA 3PTJA 1TM0A 1GQZA 4DUNA 1WPMA 3PVHA 2YMAA 1XUAA 3EJXA 2PW0A 4J9XA 4JD7A 1S7JA 1K23A 2Q9HA 1YM5A 3W5WA 4GL6A 1U1VA 4JCIA 1T6KA 2ZXPA 3WQZA 2ZXOA 2QB7A 2KPTA 3IGHX 2ZXRA 3G98A 4LB0A 1IR6A 2GKJA 5H2GA 2LT2A 3EDNA 2IW4A 2MPBA 2HAWA 4K7XA 2PVZA 2GKEA 1U0KA 4LS9A 3PW9A 1U1XA 1K20A 5H2YA 2KW7A 1BWZA 4PY9A 4K8LA 4RPAA 4K7GB 1QY9A 3DEVA 3EKMA 2AZPA 1SDJA 4J9WA 1U1WA 4IJZA 1W62A 4JUUA 1W61A 1QYAA 5IWEA 2ENXA 2Q9JA 1I74A 5M47A 4OA3A 2QB8A 1WPPA 4Q2HA 4LG3A 3FVEA 4JBDA 1XUBA 2QB6A 2ZVFA 3G7KA 4Q60A 2OTNA 2EB0A 4IK0A 5HA4A 5ANPA 3ICJA
chains in the Genus database with same CATH topology
2H9FA 3PTJA 1TM0A 1GQZA 4DUNA 1WPMA 3PVHA 2YMAA 1XUAA 3EJXA 2PW0A 4J9XA 4JD7A 1S7JA 1K23A 2Q9HA 1YM5A 3W5WA 4GL6A 1U1VA 4JCIA 1T6KA 2ZXPA 3WQZA 2ZXOA 2QB7A 2KPTA 3IGHX 2ZXRA 3G98A 4LB0A 1IR6A 2GKJA 5H2GA 2LT2A 3EDNA 2IW4A 2MPBA 2HAWA 4K7XA 2PVZA 2GKEA 1U0KA 4LS9A 3PW9A 1U1XA 1K20A 5H2YA 2KW7A 1BWZA 4PY9A 4K8LA 4RPAA 4K7GB 1QY9A 3DEVA 3EKMA 2AZPA 1SDJA 4J9WA 1U1WA 4IJZA 1W62A 4JUUA 1W61A 1QYAA 5IWEA 2ENXA 2Q9JA 1I74A 5M47A 4OA3A 2QB8A 1WPPA 4Q2HA 4LG3A 3FVEA 4JBDA 1XUBA 2QB6A 2ZVFA 3G7KA 4Q60A 2OTNA 2EB0A 4IK0A 5HA4A 5ANPA 3ICJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTJ A;  2MPB A;  2LT2 A;  4OA3 A;  2KW7 A;  3PW9 A;  5ANP A;  2KPT A;  3PVH A; 
#chains in the Genus database with same CATH topology
 2H9F A;  3PTJ A;  1TM0 A;  1GQZ A;  4DUN A;  1WPM A;  3PVH A;  2YMA A;  1XUA A;  3EJX A;  2PW0 A;  4J9X A;  4JD7 A;  1S7J A;  1K23 A;  2Q9H A;  1YM5 A;  3W5W A;  4GL6 A;  1U1V A;  4JCI A;  1T6K A;  2ZXP A;  3WQZ A;  2ZXO A;  2QB7 A;  2KPT A;  3IGH X;  2ZXR A;  3G98 A;  4LB0 A;  1IR6 A;  2GKJ A;  5H2G A;  2LT2 A;  3EDN A;  2IW4 A;  2MPB A;  2HAW A;  4K7X A;  2PVZ A;  2GKE A;  1U0K A;  4LS9 A;  3PW9 A;  1U1X A;  1K20 A;  5H2Y A;  2KW7 A;  1BWZ A;  4PY9 A;  4K8L A;  4RPA A;  4K7G B;  1QY9 A;  3DEV A;  3EKM A;  2AZP A;  1SDJ A;  4J9W A;  1U1W A;  4IJZ A;  1W62 A;  4JUU A;  1W61 A;  1QYA A;  5IWE A;  2ENX A;  2Q9J A;  1I74 A;  5M47 A;  4OA3 A;  2QB8 A;  1WPP A;  4Q2H A;  4LG3 A;  3FVE A;  4JBD A;  1XUB A;  2QB6 A;  2ZVF A;  3G7K A;  4Q60 A;  2OTN A;  2EB0 A;  4IK0 A;  5HA4 A;  5ANP A;  3ICJ A; 
#chains in the Genus database with same CATH homology
 2H9F A;  3PTJ A;  1TM0 A;  1GQZ A;  4DUN A;  1WPM A;  3PVH A;  2YMA A;  1XUA A;  3EJX A;  2PW0 A;  4J9X A;  4JD7 A;  1S7J A;  1K23 A;  2Q9H A;  1YM5 A;  3W5W A;  4GL6 A;  1U1V A;  4JCI A;  1T6K A;  2ZXP A;  3WQZ A;  2ZXO A;  2QB7 A;  2KPT A;  3IGH X;  2ZXR A;  3G98 A;  4LB0 A;  1IR6 A;  2GKJ A;  5H2G A;  2LT2 A;  3EDN A;  2IW4 A;  2MPB A;  2HAW A;  4K7X A;  2PVZ A;  2GKE A;  1U0K A;  4LS9 A;  3PW9 A;  1U1X A;  1K20 A;  5H2Y A;  2KW7 A;  1BWZ A;  4PY9 A;  4K8L A;  4RPA A;  4K7G B;  1QY9 A;  3DEV A;  3EKM A;  2AZP A;  1SDJ A;  4J9W A;  1U1W A;  4IJZ A;  1W62 A;  4JUU A;  1W61 A;  1QYA A;  5IWE A;  2ENX A;  2Q9J A;  1I74 A;  5M47 A;  4OA3 A;  2QB8 A;  1WPP A;  4Q2H A;  4LG3 A;  3FVE A;  4JBD A;  1XUB A;  2QB6 A;  2ZVF A;  3G7K A;  4Q60 A;  2OTN A;  2EB0 A;  4IK0 A;  5HA4 A;  5ANP A;  3ICJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...