3EDNA

Crystal structure of the bacillus anthracis phenazine biosynthesis protein, phzf family
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
299
structure length
299
Chain Sequence
MKTINVFHYDAFTNKPNMGNPAGIVLDADGLTEEEMQRIAEKVGFNETSFVLSSEVADIRMRYFTPGYEMDLCGHGTVGTIYALRERGLLEEKASLTIETKAGILPIQIGVNENGETFIKMRQTAPQFKDFAGSKEELAHSIGLEVNDLDVSLPIVYGSTGNWTVIVPVKNLDVCERMKPNNEVFPSVLKEIPNASIHPICLETYDEKVHMHGRHFSSAYAGTIEDPVTGTASGVMGAYYATYVEKDFDHEMELIVEQGQEIHKDGRVTVYVTKDVESEKLQIDIAGTAVYVKEFEVLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Bacillus anthracis phenazine biosynthesis protein, PhzF family
rcsb
source organism Bacillus anthracis
molecule tags Biosynthetic protein
molecule keywords Phenazine biosynthesis protein, PhzF family
total genus 76
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3ednA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3ednA01
3EKMA 1SDJA 5H2GA 4JBDA 1S7JA 4JUUA 1U1XA 3FVEA 1QY9A 4IJZA 3G7KA 2AZPA 1QYAA 2GKEA 4LB0A 2PW0A 1GQZA 4JCIA 4Q2HA 2Q9JA 4K8LA 1YM5A 4DUNA 4JD7A 4J9XA 1W61A 1TM0A 5M47A 1T6KA 2PVZA 1U1VA 2OTNA 2Q9HA 3EDNA 1U1WA 4K7GB 2H9FA 4J9WA 4IK0A 4Q60A 1XUAA 3EJXA 5HA4A 1W62A 1U0KA 5H2YA 5IWEA 1BWZA 2GKJA 1XUBA 4K7XA
chains in the Genus database with same CATH superfamily
3EKMA 2YMAA 2IW4A 3FVEA 1QY9A 5ANPA 4LG3A 4Q2HA 2Q9JA 4JD7A 2ZXPA 4J9XA 3PVHA 1TM0A 5M47A 2EB0A 2Q9HA 4K7GB 5HA4A 3G98A 1U0KA 1BWZA 2GKJA 1XUBA 4JUUA 2KW7A 2ZVFA 4RPAA 2PW0A 4K8LA 4GL6A 4PY9A 2KPTA 1WPPA 3W5WA 1U1WA 2QB8A 2HAWA 4Q60A 2ZXOA 4K7XA 3PW9A 4JBDA 3IGHX 1WPMA 3G7KA 2AZPA 2GKEA 4LB0A 1GQZA 1IR6A 1YM5A 4DUNA 1W61A 2LT2A 1T6KA 2PVZA 2OTNA 1K23A 1W62A 5H2YA 5IWEA 3PTJA 5H2GA 1I74A 1SDJA 1S7JA 1U1XA 1K20A 2MPBA 4IJZA 3WQZA 1QYAA 4JCIA 2QB6A 1U1VA 3ICJA 4OA3A 2H9FA 4J9WA 4IK0A 1XUAA 3EJXA 2ENXA 2ZXRA 4LS9A 2QB7A 3EDNA 3DEVA
chains in the Genus database with same CATH topology
3EKMA 2YMAA 2IW4A 3FVEA 1QY9A 5ANPA 4LG3A 4Q2HA 2Q9JA 4JD7A 2ZXPA 4J9XA 3PVHA 1TM0A 5M47A 2EB0A 2Q9HA 4K7GB 5HA4A 3G98A 1U0KA 1BWZA 2GKJA 1XUBA 4JUUA 2KW7A 2ZVFA 4RPAA 2PW0A 4K8LA 4GL6A 4PY9A 2KPTA 1WPPA 3W5WA 1U1WA 2QB8A 2HAWA 4Q60A 2ZXOA 4K7XA 3PW9A 4JBDA 3IGHX 1WPMA 3G7KA 2AZPA 2GKEA 4LB0A 1GQZA 1IR6A 1YM5A 4DUNA 1W61A 2LT2A 1T6KA 2PVZA 2OTNA 1K23A 1W62A 5H2YA 5IWEA 3PTJA 5H2GA 1I74A 1SDJA 1S7JA 1U1XA 1K20A 2MPBA 4IJZA 3WQZA 1QYAA 4JCIA 2QB6A 1U1VA 3ICJA 4OA3A 2H9FA 4J9WA 4IK0A 1XUAA 3EJXA 2ENXA 2ZXRA 4LS9A 2QB7A 3EDNA 3DEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKM A;  1SDJ A;  5H2G A;  4JBD A;  1S7J A;  4JUU A;  1U1X A;  3FVE A;  1QY9 A;  4IJZ A;  3G7K A;  2AZP A;  1QYA A;  2GKE A;  4LB0 A;  2PW0 A;  1GQZ A;  4JCI A;  4Q2H A;  2Q9J A;  4K8L A;  1YM5 A;  4DUN A;  4JD7 A;  4J9X A;  1W61 A;  1TM0 A;  5M47 A;  1T6K A;  2PVZ A;  1U1V A;  2OTN A;  2Q9H A;  3EDN A;  1U1W A;  4K7G B;  2H9F A;  4J9W A;  4IK0 A;  4Q60 A;  1XUA A;  3EJX A;  5HA4 A;  1W62 A;  1U0K A;  5H2Y A;  5IWE A;  1BWZ A;  2GKJ A;  1XUB A;  4K7X A; 
#chains in the Genus database with same CATH topology
 3EKM A;  2YMA A;  2IW4 A;  3FVE A;  1QY9 A;  5ANP A;  4LG3 A;  4Q2H A;  2Q9J A;  4JD7 A;  2ZXP A;  4J9X A;  3PVH A;  1TM0 A;  5M47 A;  2EB0 A;  2Q9H A;  4K7G B;  5HA4 A;  3G98 A;  1U0K A;  1BWZ A;  2GKJ A;  1XUB A;  4JUU A;  2KW7 A;  2ZVF A;  4RPA A;  2PW0 A;  4K8L A;  4GL6 A;  4PY9 A;  2KPT A;  1WPP A;  3W5W A;  1U1W A;  2QB8 A;  2HAW A;  4Q60 A;  2ZXO A;  4K7X A;  3PW9 A;  4JBD A;  3IGH X;  1WPM A;  3G7K A;  2AZP A;  2GKE A;  4LB0 A;  1GQZ A;  1IR6 A;  1YM5 A;  4DUN A;  1W61 A;  2LT2 A;  1T6K A;  2PVZ A;  2OTN A;  1K23 A;  1W62 A;  5H2Y A;  5IWE A;  3PTJ A;  5H2G A;  1I74 A;  1SDJ A;  1S7J A;  1U1X A;  1K20 A;  2MPB A;  4IJZ A;  3WQZ A;  1QYA A;  4JCI A;  2QB6 A;  1U1V A;  3ICJ A;  4OA3 A;  2H9F A;  4J9W A;  4IK0 A;  1XUA A;  3EJX A;  2ENX A;  2ZXR A;  4LS9 A;  2QB7 A;  3EDN A;  3DEV A; 
#chains in the Genus database with same CATH homology
 3EKM A;  2YMA A;  2IW4 A;  3FVE A;  1QY9 A;  5ANP A;  4LG3 A;  4Q2H A;  2Q9J A;  4JD7 A;  2ZXP A;  4J9X A;  3PVH A;  1TM0 A;  5M47 A;  2EB0 A;  2Q9H A;  4K7G B;  5HA4 A;  3G98 A;  1U0K A;  1BWZ A;  2GKJ A;  1XUB A;  4JUU A;  2KW7 A;  2ZVF A;  4RPA A;  2PW0 A;  4K8L A;  4GL6 A;  4PY9 A;  2KPT A;  1WPP A;  3W5W A;  1U1W A;  2QB8 A;  2HAW A;  4Q60 A;  2ZXO A;  4K7X A;  3PW9 A;  4JBD A;  3IGH X;  1WPM A;  3G7K A;  2AZP A;  2GKE A;  4LB0 A;  1GQZ A;  1IR6 A;  1YM5 A;  4DUN A;  1W61 A;  2LT2 A;  1T6K A;  2PVZ A;  2OTN A;  1K23 A;  1W62 A;  5H2Y A;  5IWE A;  3PTJ A;  5H2G A;  1I74 A;  1SDJ A;  1S7J A;  1U1X A;  1K20 A;  2MPB A;  4IJZ A;  3WQZ A;  1QYA A;  4JCI A;  2QB6 A;  1U1V A;  3ICJ A;  4OA3 A;  2H9F A;  4J9W A;  4IK0 A;  1XUA A;  3EJX A;  2ENX A;  2ZXR A;  4LS9 A;  2QB7 A;  3EDN A;  3DEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...