3EDNA

Crystal structure of the bacillus anthracis phenazine biosynthesis protein, phzf family
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
299
structure length
299
Chain Sequence
b'MKTINVFHYDAFTNKPNMGNPAGIVLDADGLTEEEMQRIAEKVGFNETSFVLSSEVADIRMRYFTPGYEMDLCGHGTVGTIYALRERGLLEEKASLTIETKAGILPIQIGVNENGETFIKMRQTAPQFKDFAGSKEELAHSIGLEVNDLDVSLPIVYGSTGNWTVIVPVKNLDVCERMKPNNEVFPSVLKEIPNASIHPICLETYDEKVHMHGRHFSSAYAGTIEDPVTGTASGVMGAYYATYVEKDFDHEMELIVEQGQEIHKDGRVTVYVTKDVESEKLQIDIAGTAVYVKEFEVLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenazine biosynthesis protein, PhzF family
publication title Crystal structure of the Bacillus anthracis phenazine biosynthesis protein, PhzF family
rcsb
source organism Bacillus anthracis
molecule tags Biosynthetic protein
total genus 76
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3ednA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3ednA01
2Q9JA 1GQZA 1W61A 2OTNA 3EDNA 2AZPA 5M47A 1W62A 4JBDA 1QYAA 3EKMA 1XUBA 4IK0A 4DUNA 2GKEA 5H2GA 4K7XA 4JUUA 4JD7A 1YM5A 2GKJA 1U1XA 5H2YA 3EJXA 4K8LA 4Q60A 1T6KA 4LB0A 1U0KA 4Q2HA 1BWZA 4JCIA 1SDJA 1U1VA 1XUAA 2H9FA 1TM0A 4J9XA 1S7JA 1QY9A 4J9WA 2PW0A 3G7KA 5IWEA 5HA4A 4IJZA 1U1WA 4K7GB 2Q9HA 3FVEA 2PVZA
chains in the Genus database with same CATH superfamily
5ANPA 1W61A 2AZPA 1W62A 2MPBA 4JBDA 5H2GA 2GKEA 1K23A 4JD7A 2ZXPA 4LB0A 4LG3A 4J9WA 2YMAA 1U1WA 1WPPA 2ENXA 4RPAA 2OTNA 3PVHA 1IR6A 4IK0A 3PTJA 4JUUA 1U1XA 4Q60A 1U0KA 4JCIA 1U1VA 1TM0A 2ZXRA 4PY9A 4J9XA 1QY9A 1S7JA 4OA3A 5IWEA 1WPMA 4IJZA 2LT2A 3WQZA 2Q9HA 2ZVFA 2KPTA 3EDNA 1GQZA 2QB6A 5M47A 1QYAA 4GL6A 4DUNA 3IGHX 3W5WA 2HAWA 5H2YA 3EJXA 1K20A 1I74A 1T6KA 3ICJA 4Q2HA 3G98A 1SDJA 2QB8A 2PW0A 5HA4A 4K7GB 2Q9JA 3DEVA 3EKMA 2QB7A 3PW9A 4LS9A 2EB0A 1XUBA 4K7XA 1YM5A 2GKJA 4K8LA 2KW7A 1BWZA 1XUAA 2H9FA 3G7KA 2IW4A 2ZXOA 3FVEA 2PVZA
chains in the Genus database with same CATH topology
5ANPA 1W61A 2AZPA 1W62A 2MPBA 4JBDA 5H2GA 2GKEA 1K23A 4JD7A 2ZXPA 4LB0A 4LG3A 4J9WA 2YMAA 1U1WA 1WPPA 2ENXA 4RPAA 2OTNA 3PVHA 1IR6A 4IK0A 3PTJA 4JUUA 1U1XA 4Q60A 1U0KA 4JCIA 1U1VA 1TM0A 2ZXRA 4PY9A 4J9XA 1QY9A 1S7JA 4OA3A 5IWEA 1WPMA 4IJZA 2LT2A 3WQZA 2Q9HA 2ZVFA 2KPTA 3EDNA 1GQZA 2QB6A 5M47A 1QYAA 4GL6A 4DUNA 3IGHX 3W5WA 2HAWA 5H2YA 3EJXA 1K20A 1I74A 1T6KA 3ICJA 4Q2HA 3G98A 1SDJA 2QB8A 2PW0A 5HA4A 4K7GB 2Q9JA 3DEVA 3EKMA 2QB7A 3PW9A 4LS9A 2EB0A 1XUBA 4K7XA 1YM5A 2GKJA 4K8LA 2KW7A 1BWZA 1XUAA 2H9FA 3G7KA 2IW4A 2ZXOA 3FVEA 2PVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9J A;  1GQZ A;  1W61 A;  2OTN A;  3EDN A;  2AZP A;  5M47 A;  1W62 A;  4JBD A;  1QYA A;  3EKM A;  1XUB A;  4IK0 A;  4DUN A;  2GKE A;  5H2G A;  4K7X A;  4JUU A;  4JD7 A;  1YM5 A;  2GKJ A;  1U1X A;  5H2Y A;  3EJX A;  4K8L A;  4Q60 A;  1T6K A;  4LB0 A;  1U0K A;  4Q2H A;  1BWZ A;  4JCI A;  1SDJ A;  1U1V A;  1XUA A;  2H9F A;  1TM0 A;  4J9X A;  1S7J A;  1QY9 A;  4J9W A;  2PW0 A;  3G7K A;  5IWE A;  5HA4 A;  4IJZ A;  1U1W A;  4K7G B;  2Q9H A;  3FVE A;  2PVZ A; 
#chains in the Genus database with same CATH topology
 5ANP A;  1W61 A;  2AZP A;  1W62 A;  2MPB A;  4JBD A;  5H2G A;  2GKE A;  1K23 A;  4JD7 A;  2ZXP A;  4LB0 A;  4LG3 A;  4J9W A;  2YMA A;  1U1W A;  1WPP A;  2ENX A;  4RPA A;  2OTN A;  3PVH A;  1IR6 A;  4IK0 A;  3PTJ A;  4JUU A;  1U1X A;  4Q60 A;  1U0K A;  4JCI A;  1U1V A;  1TM0 A;  2ZXR A;  4PY9 A;  4J9X A;  1QY9 A;  1S7J A;  4OA3 A;  5IWE A;  1WPM A;  4IJZ A;  2LT2 A;  3WQZ A;  2Q9H A;  2ZVF A;  2KPT A;  3EDN A;  1GQZ A;  2QB6 A;  5M47 A;  1QYA A;  4GL6 A;  4DUN A;  3IGH X;  3W5W A;  2HAW A;  5H2Y A;  3EJX A;  1K20 A;  1I74 A;  1T6K A;  3ICJ A;  4Q2H A;  3G98 A;  1SDJ A;  2QB8 A;  2PW0 A;  5HA4 A;  4K7G B;  2Q9J A;  3DEV A;  3EKM A;  2QB7 A;  3PW9 A;  4LS9 A;  2EB0 A;  1XUB A;  4K7X A;  1YM5 A;  2GKJ A;  4K8L A;  2KW7 A;  1BWZ A;  1XUA A;  2H9F A;  3G7K A;  2IW4 A;  2ZXO A;  3FVE A;  2PVZ A; 
#chains in the Genus database with same CATH homology
 5ANP A;  1W61 A;  2AZP A;  1W62 A;  2MPB A;  4JBD A;  5H2G A;  2GKE A;  1K23 A;  4JD7 A;  2ZXP A;  4LB0 A;  4LG3 A;  4J9W A;  2YMA A;  1U1W A;  1WPP A;  2ENX A;  4RPA A;  2OTN A;  3PVH A;  1IR6 A;  4IK0 A;  3PTJ A;  4JUU A;  1U1X A;  4Q60 A;  1U0K A;  4JCI A;  1U1V A;  1TM0 A;  2ZXR A;  4PY9 A;  4J9X A;  1QY9 A;  1S7J A;  4OA3 A;  5IWE A;  1WPM A;  4IJZ A;  2LT2 A;  3WQZ A;  2Q9H A;  2ZVF A;  2KPT A;  3EDN A;  1GQZ A;  2QB6 A;  5M47 A;  1QYA A;  4GL6 A;  4DUN A;  3IGH X;  3W5W A;  2HAW A;  5H2Y A;  3EJX A;  1K20 A;  1I74 A;  1T6K A;  3ICJ A;  4Q2H A;  3G98 A;  1SDJ A;  2QB8 A;  2PW0 A;  5HA4 A;  4K7G B;  2Q9J A;  3DEV A;  3EKM A;  2QB7 A;  3PW9 A;  4LS9 A;  2EB0 A;  1XUB A;  4K7X A;  1YM5 A;  2GKJ A;  4K8L A;  2KW7 A;  1BWZ A;  1XUA A;  2H9F A;  3G7K A;  2IW4 A;  2ZXO A;  3FVE A;  2PVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...