3EDNA

Crystal structure of the bacillus anthracis phenazine biosynthesis protein, phzf family
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
299
structure length
299
Chain Sequence
MKTINVFHYDAFTNKPNMGNPAGIVLDADGLTEEEMQRIAEKVGFNETSFVLSSEVADIRMRYFTPGYEMDLCGHGTVGTIYALRERGLLEEKASLTIETKAGILPIQIGVNENGETFIKMRQTAPQFKDFAGSKEELAHSIGLEVNDLDVSLPIVYGSTGNWTVIVPVKNLDVCERMKPNNEVFPSVLKEIPNASIHPICLETYDEKVHMHGRHFSSAYAGTIEDPVTGTASGVMGAYYATYVEKDFDHEMELIVEQGQEIHKDGRVTVYVTKDVESEKLQIDIAGTAVYVKEFEVLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Bacillus anthracis phenazine biosynthesis protein, PhzF family
rcsb
source organism Bacillus anthracis
molecule tags Biosynthetic protein
molecule keywords Phenazine biosynthesis protein, PhzF family
total genus 76
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02567 PhzC-PhzF Phenazine biosynthesis-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3ednA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 3ednA01
1BWZA 1GQZA 2GKJA 1QY9A 1T6KA 3FVEA 1XUAA 5IWEA 3EJXA 2GKEA 1W61A 4J9XA 2OTNA 1U1WA 1W62A 3EKMA 1TM0A 2Q9HA 2PW0A 4IK0A 4Q2HA 1U1XA 4IJZA 4K8LA 5HA4A 1S7JA 1XUBA 3G7KA 4K7GB 3EDNA 4JUUA 4Q60A 1QYAA 4JCIA 2H9FA 4LB0A 1U1VA 4JD7A 2Q9JA 1YM5A 1U0KA 4J9WA 4K7XA 1SDJA 2PVZA 5M47A 4DUNA 4JBDA 5H2GA 5H2YA 2AZPA
chains in the Genus database with same CATH superfamily
3PW9A 1QY9A 2GKEA 4J9XA 1K23A 1U1WA 4LS9A 3PTJA 2HAWA 4Q2HA 2ZVFA 3G98A 5HA4A 3DEVA 1XUBA 4GL6A 1U0KA 4J9WA 1WPMA 4DUNA 5H2GA 2IW4A 2QB7A 1T6KA 3FVEA 1XUAA 5IWEA 3ICJA 1TM0A 2Q9HA 2EB0A 4Q60A 3EDNA 4JUUA 2KPTA 4JCIA 1U1VA 4JD7A 1YM5A 1SDJA 4JBDA 5H2YA 2GKJA 2ZXOA 3WQZA 2YMAA 1W61A 2KW7A 1W62A 3EKMA 5ANPA 4IK0A 4OA3A 1U1XA 4IJZA 1S7JA 3PVHA 3G7KA 1IR6A 1QYAA 2H9FA 2QB6A 4K7XA 4PY9A 2PVZA 1K20A 1BWZA 1GQZA 2MPBA 4RPAA 3IGHX 3W5WA 2LT2A 3EJXA 2OTNA 2PW0A 4K8LA 4LG3A 4K7GB 1I74A 2ZXPA 4LB0A 2Q9JA 2ENXA 2QB8A 1WPPA 5M47A 2ZXRA 2AZPA
chains in the Genus database with same CATH topology
3PW9A 1QY9A 2GKEA 4J9XA 1K23A 1U1WA 4LS9A 3PTJA 2HAWA 4Q2HA 2ZVFA 3G98A 5HA4A 3DEVA 1XUBA 4GL6A 1U0KA 4J9WA 1WPMA 4DUNA 5H2GA 2IW4A 2QB7A 1T6KA 3FVEA 1XUAA 5IWEA 3ICJA 1TM0A 2Q9HA 2EB0A 4Q60A 3EDNA 4JUUA 2KPTA 4JCIA 1U1VA 4JD7A 1YM5A 1SDJA 4JBDA 5H2YA 2GKJA 2ZXOA 3WQZA 2YMAA 1W61A 2KW7A 1W62A 3EKMA 5ANPA 4IK0A 4OA3A 1U1XA 4IJZA 1S7JA 3PVHA 3G7KA 1IR6A 1QYAA 2H9FA 2QB6A 4K7XA 4PY9A 2PVZA 1K20A 1BWZA 1GQZA 2MPBA 4RPAA 3IGHX 3W5WA 2LT2A 3EJXA 2OTNA 2PW0A 4K8LA 4LG3A 4K7GB 1I74A 2ZXPA 4LB0A 2Q9JA 2ENXA 2QB8A 1WPPA 5M47A 2ZXRA 2AZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BWZ A;  1GQZ A;  2GKJ A;  1QY9 A;  1T6K A;  3FVE A;  1XUA A;  5IWE A;  3EJX A;  2GKE A;  1W61 A;  4J9X A;  2OTN A;  1U1W A;  1W62 A;  3EKM A;  1TM0 A;  2Q9H A;  2PW0 A;  4IK0 A;  4Q2H A;  1U1X A;  4IJZ A;  4K8L A;  5HA4 A;  1S7J A;  1XUB A;  3G7K A;  4K7G B;  3EDN A;  4JUU A;  4Q60 A;  1QYA A;  4JCI A;  2H9F A;  4LB0 A;  1U1V A;  4JD7 A;  2Q9J A;  1YM5 A;  1U0K A;  4J9W A;  4K7X A;  1SDJ A;  2PVZ A;  5M47 A;  4DUN A;  4JBD A;  5H2G A;  5H2Y A;  2AZP A; 
#chains in the Genus database with same CATH topology
 3PW9 A;  1QY9 A;  2GKE A;  4J9X A;  1K23 A;  1U1W A;  4LS9 A;  3PTJ A;  2HAW A;  4Q2H A;  2ZVF A;  3G98 A;  5HA4 A;  3DEV A;  1XUB A;  4GL6 A;  1U0K A;  4J9W A;  1WPM A;  4DUN A;  5H2G A;  2IW4 A;  2QB7 A;  1T6K A;  3FVE A;  1XUA A;  5IWE A;  3ICJ A;  1TM0 A;  2Q9H A;  2EB0 A;  4Q60 A;  3EDN A;  4JUU A;  2KPT A;  4JCI A;  1U1V A;  4JD7 A;  1YM5 A;  1SDJ A;  4JBD A;  5H2Y A;  2GKJ A;  2ZXO A;  3WQZ A;  2YMA A;  1W61 A;  2KW7 A;  1W62 A;  3EKM A;  5ANP A;  4IK0 A;  4OA3 A;  1U1X A;  4IJZ A;  1S7J A;  3PVH A;  3G7K A;  1IR6 A;  1QYA A;  2H9F A;  2QB6 A;  4K7X A;  4PY9 A;  2PVZ A;  1K20 A;  1BWZ A;  1GQZ A;  2MPB A;  4RPA A;  3IGH X;  3W5W A;  2LT2 A;  3EJX A;  2OTN A;  2PW0 A;  4K8L A;  4LG3 A;  4K7G B;  1I74 A;  2ZXP A;  4LB0 A;  2Q9J A;  2ENX A;  2QB8 A;  1WPP A;  5M47 A;  2ZXR A;  2AZP A; 
#chains in the Genus database with same CATH homology
 3PW9 A;  1QY9 A;  2GKE A;  4J9X A;  1K23 A;  1U1W A;  4LS9 A;  3PTJ A;  2HAW A;  4Q2H A;  2ZVF A;  3G98 A;  5HA4 A;  3DEV A;  1XUB A;  4GL6 A;  1U0K A;  4J9W A;  1WPM A;  4DUN A;  5H2G A;  2IW4 A;  2QB7 A;  1T6K A;  3FVE A;  1XUA A;  5IWE A;  3ICJ A;  1TM0 A;  2Q9H A;  2EB0 A;  4Q60 A;  3EDN A;  4JUU A;  2KPT A;  4JCI A;  1U1V A;  4JD7 A;  1YM5 A;  1SDJ A;  4JBD A;  5H2Y A;  2GKJ A;  2ZXO A;  3WQZ A;  2YMA A;  1W61 A;  2KW7 A;  1W62 A;  3EKM A;  5ANP A;  4IK0 A;  4OA3 A;  1U1X A;  4IJZ A;  1S7J A;  3PVH A;  3G7K A;  1IR6 A;  1QYA A;  2H9F A;  2QB6 A;  4K7X A;  4PY9 A;  2PVZ A;  1K20 A;  1BWZ A;  1GQZ A;  2MPB A;  4RPA A;  3IGH X;  3W5W A;  2LT2 A;  3EJX A;  2OTN A;  2PW0 A;  4K8L A;  4LG3 A;  4K7G B;  1I74 A;  2ZXP A;  4LB0 A;  2Q9J A;  2ENX A;  2QB8 A;  1WPP A;  5M47 A;  2ZXR A;  2AZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...