The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
49
|
sequence length |
157
|
structure length |
157
|
Chain Sequence |
MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFETGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution NMR Structure of the N-terminal domain of protein PG_0361 from P.gingivalis, Northeast Structural Genomics Consortium Target Target PgR37A
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Porphyromonas gingivalis
|
molecule keywords |
Conserved domain protein
|
total genus |
49
|
structure length |
157
|
sequence length |
157
|
ec nomenclature | |
pdb deposition date | 2010-03-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04536 | TPM_phosphatase | TPM domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Diaminopimelate Epimerase; Chain A, domain 1 | Diaminopimelate Epimerase; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 3PW9 A; 4OA3 A; 2LT2 A; 3PVH A; 2KPT A; 2KW7 A; 5ANP A; 2MPB A; 3PTJ A; #chains in the Genus database with same CATH topology 2KW7 A; 2PVZ A; 4Q60 A; 5HA4 A; 2YMA A; 2ZVF A; 5IWE A; 1K20 A; 1GQZ A; 2OTN A; 2Q9H A; 1S7J A; 3WQZ A; 1SDJ A; 4LS9 A; 4IJZ A; 1WPP A; 4J9X A; 2GKE A; 4LG3 A; 2KPT A; 1U1X A; 4IK0 A; 1WPM A; 5H2G A; 2PW0 A; 4K7X A; 4LB0 A; 1XUB A; 1K23 A; 4OA3 A; 4JUU A; 2ZXR A; 2GKJ A; 2QB7 A; 2HAW A; 3EJX A; 2MPB A; 2ZXO A; 2H9F A; 1W62 A; 2ZXP A; 3EKM A; 4K8L A; 4K7G B; 4J9W A; 5ANP A; 4DUN A; 2LT2 A; 1U1V A; 1XUA A; 2QB8 A; 3DEV A; 4JBD A; 3ICJ A; 3EDN A; 4Q2H A; 2AZP A; 1I74 A; 3FVE A; 1QYA A; 5H2Y A; 3PVH A; 1T6K A; 3W5W A; 2EB0 A; 1U0K A; 4JD7 A; 3PTJ A; 2IW4 A; 3IGH X; 1TM0 A; 1BWZ A; 2Q9J A; 1U1W A; 2QB6 A; 1YM5 A; 3PW9 A; 4PY9 A; 3G98 A; 1IR6 A; 5M47 A; 4JCI A; 3G7K A; 4RPA A; 2ENX A; 1W61 A; 1QY9 A; 4GL6 A; #chains in the Genus database with same CATH homology 2KW7 A; 2PVZ A; 4Q60 A; 5HA4 A; 2YMA A; 2ZVF A; 5IWE A; 1K20 A; 1GQZ A; 2OTN A; 2Q9H A; 1S7J A; 3WQZ A; 1SDJ A; 4LS9 A; 4IJZ A; 1WPP A; 4J9X A; 2GKE A; 4LG3 A; 2KPT A; 1U1X A; 4IK0 A; 1WPM A; 5H2G A; 2PW0 A; 4K7X A; 4LB0 A; 1XUB A; 1K23 A; 4OA3 A; 4JUU A; 2ZXR A; 2GKJ A; 2QB7 A; 2HAW A; 3EJX A; 2MPB A; 2ZXO A; 2H9F A; 1W62 A; 2ZXP A; 3EKM A; 4K8L A; 4K7G B; 4J9W A; 5ANP A; 4DUN A; 2LT2 A; 1U1V A; 1XUA A; 2QB8 A; 3DEV A; 4JBD A; 3ICJ A; 3EDN A; 4Q2H A; 2AZP A; 1I74 A; 3FVE A; 1QYA A; 5H2Y A; 3PVH A; 1T6K A; 3W5W A; 2EB0 A; 1U0K A; 4JD7 A; 3PTJ A; 2IW4 A; 3IGH X; 1TM0 A; 1BWZ A; 2Q9J A; 1U1W A; 2QB6 A; 1YM5 A; 3PW9 A; 4PY9 A; 3G98 A; 1IR6 A; 5M47 A; 4JCI A; 3G7K A; 4RPA A; 2ENX A; 1W61 A; 1QY9 A; 4GL6 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...