The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
135
|
structure length |
135
|
Chain Sequence |
SIGSNSIDLITKYEPIFLGSGIYFLRPFNTDERDKLMVTDNAMSNWDEITETYYQKFGNAINKMLSLRLVSLPNGHILQPGDSCVWLAEVVDMKDRFQTTLSLNILNSQRAEIFFNKTFTFNEDNGNFLSYKIGD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural and Biochemical Basis of Yos9 Protein Dimerization and Possible Contribution to Self-Association of 3-Hydroxy-3-Methylglutaryl-Coenzyme a Reductase Degradation Ubiquitin-Ligase Complex.
pubmed doi rcsb |
molecule tags |
Carbohydrate binding protein
|
source organism |
Saccharomyces cerevisiae
|
molecule keywords |
PROTEIN OS-9 HOMOLOG
|
total genus |
24
|
structure length |
135
|
sequence length |
135
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2011-06-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF17880 | Yos9_DD | Yos9 dimerzation domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Diaminopimelate Epimerase; Chain A, domain 1 | Diaminopimelate Epimerase; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 2YMA A; #chains in the Genus database with same CATH topology 1QYA A; 2ENX A; 2HAW A; 1W61 A; 4JCI A; 1U0K A; 3G7K A; 2QB8 A; 2YMA A; 4Q60 A; 3IGH X; 1WPP A; 1I74 A; 1K20 A; 1U1W A; 3W5W A; 2IW4 A; 2H9F A; 2GKE A; 1YM5 A; 2Q9H A; 4K8L A; 1GQZ A; 2KW7 A; 4LS9 A; 2AZP A; 1QY9 A; 4LG3 A; 3DEV A; 4GL6 A; 4OA3 A; 3PTJ A; 1SDJ A; 3FVE A; 5H2Y A; 5M47 A; 2ZXO A; 1WPM A; 2MPB A; 3EKM A; 5IWE A; 3PVH A; 2LT2 A; 1BWZ A; 4J9W A; 3ICJ A; 2PVZ A; 1IR6 A; 2QB7 A; 2QB6 A; 4Q2H A; 4IK0 A; 1XUA A; 2ZXP A; 4PY9 A; 4K7G B; 2KPT A; 1S7J A; 2GKJ A; 2Q9J A; 1W62 A; 2PW0 A; 1TM0 A; 3WQZ A; 4K7X A; 4LB0 A; 2EB0 A; 4DUN A; 3EJX A; 3PW9 A; 4J9X A; 1U1V A; 1U1X A; 4JD7 A; 4JBD A; 5ANP A; 5H2G A; 1XUB A; 4IJZ A; 2ZVF A; 1K23 A; 1T6K A; 2ZXR A; 5HA4 A; 3G98 A; 4JUU A; 2OTN A; 3EDN A; 4RPA A; #chains in the Genus database with same CATH homology 1QYA A; 2ENX A; 2HAW A; 1W61 A; 4JCI A; 1U0K A; 3G7K A; 2QB8 A; 2YMA A; 4Q60 A; 3IGH X; 1WPP A; 1I74 A; 1K20 A; 1U1W A; 3W5W A; 2IW4 A; 2H9F A; 2GKE A; 1YM5 A; 2Q9H A; 4K8L A; 1GQZ A; 2KW7 A; 4LS9 A; 2AZP A; 1QY9 A; 4LG3 A; 3DEV A; 4GL6 A; 4OA3 A; 3PTJ A; 1SDJ A; 3FVE A; 5H2Y A; 5M47 A; 2ZXO A; 1WPM A; 2MPB A; 3EKM A; 5IWE A; 3PVH A; 2LT2 A; 1BWZ A; 4J9W A; 3ICJ A; 2PVZ A; 1IR6 A; 2QB7 A; 2QB6 A; 4Q2H A; 4IK0 A; 1XUA A; 2ZXP A; 4PY9 A; 4K7G B; 2KPT A; 1S7J A; 2GKJ A; 2Q9J A; 1W62 A; 2PW0 A; 1TM0 A; 3WQZ A; 4K7X A; 4LB0 A; 2EB0 A; 4DUN A; 3EJX A; 3PW9 A; 4J9X A; 1U1V A; 1U1X A; 4JD7 A; 4JBD A; 5ANP A; 5H2G A; 1XUB A; 4IJZ A; 2ZVF A; 1K23 A; 1T6K A; 2ZXR A; 5HA4 A; 3G98 A; 4JUU A; 2OTN A; 3EDN A; 4RPA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...