The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
69
|
sequence length |
290
|
structure length |
283
|
Chain Sequence |
HMIFAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRVTTAGAAQAVGVLDSLPEGVRVTDWYMDYRNADGSAAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHHVEAAYADVSVDMGKANRLGAGEAVFHGLAVDVGNPHLACVDSQLTVDGLAALDVGVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHERGVGETRSCGTGTVAAAVAALAAVGSPTGTLTVHVPGGEVVVTVTDATSFLRGPSVLVARGDLADDWWNAMG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the diaminopimelate epimerase DapF from Mycobacterium tuberculosis
pubmed doi rcsb |
| molecule keywords |
Diaminopimelate epimerase
|
| molecule tags |
Isomerase
|
| source organism |
Mycobacterium tuberculosis
|
| total genus |
69
|
| structure length |
283
|
| sequence length |
290
|
| ec nomenclature |
ec
5.1.1.7: Diaminopimelate epimerase. |
| pdb deposition date | 2009-01-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01678 | DAP_epimerase | Diaminopimelate epimerase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Diaminopimelate Epimerase; Chain A, domain 1 | Diaminopimelate Epimerase; Chain A, domain 1 | ||
| Alpha Beta | Roll | Diaminopimelate Epimerase; Chain A, domain 1 | Diaminopimelate Epimerase; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 2GKE A; 2GKJ A; 1W62 A; 5H2Y A; 2AZP A; 4K7G B; 3EJX A; 1YM5 A; 1U1X A; 2PVZ A; 2Q9J A; 4IK0 A; 2H9F A; 1W61 A; 1XUA A; 4DUN A; 2OTN A; 4Q60 A; 2PW0 A; 5HA4 A; 4LB0 A; 4JBD A; 1U1V A; 4K7X A; 1SDJ A; 1QY9 A; 1S7J A; 1BWZ A; 3G7K A; 4IJZ A; 5M47 A; 2Q9H A; 5H2G A; 4J9X A; 3EDN A; 3FVE A; 1U1W A; 4JUU A; 1QYA A; 4Q2H A; 3EKM A; 4K8L A; 1GQZ A; 1T6K A; 1TM0 A; 4JD7 A; 4J9W A; 5IWE A; 1XUB A; 1U0K A; 4JCI A; #chains in the Genus database with same CATH topology 1I74 A; 2PVZ A; 3IGH X; 4IK0 A; 2OTN A; 2PW0 A; 2ENX A; 4JBD A; 4K7X A; 4J9X A; 3EDN A; 1U1W A; 4JUU A; 3ICJ A; 4K8L A; 4PY9 A; 1IR6 A; 2ZXP A; 4LS9 A; 1T6K A; 4LG3 A; 2QB8 A; 1U1X A; 2H9F A; 4DUN A; 4Q60 A; 5HA4 A; 5M47 A; 3PVH A; 3WQZ A; 2ZVF A; 1K20 A; 2KPT A; 4OA3 A; 1TM0 A; 4JD7 A; 4J9W A; 5IWE A; 1XUB A; 1WPP A; 4GL6 A; 1U0K A; 4JCI A; 2GKE A; 2GKJ A; 1W62 A; 2EB0 A; 5H2Y A; 2AZP A; 2HAW A; 2LT2 A; 4K7G B; 1YM5 A; 2Q9J A; 1W61 A; 2YMA A; 4LB0 A; 1K23 A; 1S7J A; 3G7K A; 4IJZ A; 3FVE A; 1QYA A; 2IW4 A; 3G98 A; 3DEV A; 2QB7 A; 2QB6 A; 2ZXO A; 2KW7 A; 3EJX A; 1XUA A; 2MPB A; 1U1V A; 4RPA A; 1SDJ A; 1QY9 A; 1BWZ A; 2Q9H A; 5H2G A; 3W5W A; 1WPM A; 3PTJ A; 4Q2H A; 3EKM A; 5ANP A; 2ZXR A; 1GQZ A; 3PW9 A; #chains in the Genus database with same CATH homology 1I74 A; 2PVZ A; 3IGH X; 4IK0 A; 2OTN A; 2PW0 A; 2ENX A; 4JBD A; 4K7X A; 4J9X A; 3EDN A; 1U1W A; 4JUU A; 3ICJ A; 4K8L A; 4PY9 A; 1IR6 A; 2ZXP A; 4LS9 A; 1T6K A; 4LG3 A; 2QB8 A; 1U1X A; 2H9F A; 4DUN A; 4Q60 A; 5HA4 A; 5M47 A; 3PVH A; 3WQZ A; 2ZVF A; 1K20 A; 2KPT A; 4OA3 A; 1TM0 A; 4JD7 A; 4J9W A; 5IWE A; 1XUB A; 1WPP A; 4GL6 A; 1U0K A; 4JCI A; 2GKE A; 2GKJ A; 1W62 A; 2EB0 A; 5H2Y A; 2AZP A; 2HAW A; 2LT2 A; 4K7G B; 1YM5 A; 2Q9J A; 1W61 A; 2YMA A; 4LB0 A; 1K23 A; 1S7J A; 3G7K A; 4IJZ A; 3FVE A; 1QYA A; 2IW4 A; 3G98 A; 3DEV A; 2QB7 A; 2QB6 A; 2ZXO A; 2KW7 A; 3EJX A; 1XUA A; 2MPB A; 1U1V A; 4RPA A; 1SDJ A; 1QY9 A; 1BWZ A; 2Q9H A; 5H2G A; 3W5W A; 1WPM A; 3PTJ A; 4Q2H A; 3EKM A; 5ANP A; 2ZXR A; 1GQZ A; 3PW9 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
