The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
79
|
sequence length |
314
|
structure length |
314
|
Chain Sequence |
NLYFQSMKQIHVIDSHTGGEPTRLVMKGFPQLHGRSMAEQRDELRELHDRWRRACLLEPRGNDVLVGALYCPPVSADATCGVIFFNNAGYLNMCGHGTIGLVASLQHLGLIAPGVHKIDTPVGQVSATLHEDGAITVANVPSYRYRQHVAVNVPGHGVVHGDIAWGGNWFFLVAEHGQRIELDNREVLTEYTWAMLKALEAQGITGENGAPIDHVELFADDPNADSRNFVMCPGKAYDRSPCGTGTSAKLACLAADGTLAEGQTWVQASITGSQFHGRYERDGERIRPFITGRAHMTADSTLLIDEQDPFAWGI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of pput_1285, a putative hydroxyproline epimerase from Pseudomonas putida f1 (target EFI-506500), open form, space group P212121, bound sulfate
rcsb |
| molecule keywords |
Proline racemase
|
| molecule tags |
Isomerase
|
| source organism |
Pseudomonas putida
|
| total genus |
79
|
| structure length |
314
|
| sequence length |
314
|
| chains with identical sequence |
D
|
| ec nomenclature |
ec
5.1.1.8: 4-hydroxyproline epimerase. |
| pdb deposition date | 2013-02-24 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05544 | Pro_racemase | Proline racemase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Diaminopimelate Epimerase; Chain A, domain 1 | Diaminopimelate Epimerase; Chain A, domain 1 | ||
| Alpha Beta | Roll | Diaminopimelate Epimerase; Chain A, domain 1 | Diaminopimelate Epimerase; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 2PVZ A; 2H9F A; 4IJZ A; 1XUA A; 3G7K A; 4JBD A; 2GKE A; 3EDN A; 1U1W A; 4JD7 A; 3FVE A; 1YM5 A; 2GKJ A; 4JUU A; 4K7G B; 1TM0 A; 2PW0 A; 3EJX A; 3EKM A; 4IK0 A; 1BWZ A; 4K8L A; 5H2Y A; 1S7J A; 5H2G A; 2Q9H A; 1U1X A; 4LB0 A; 1W62 A; 1XUB A; 1W61 A; 1U1V A; 1QYA A; 1SDJ A; 1QY9 A; 4JCI A; 4J9X A; 5HA4 A; 5IWE A; 2OTN A; 2AZP A; 4J9W A; 4DUN A; 4Q60 A; 2Q9J A; 1U0K A; 4K7X A; 1GQZ A; 4Q2H A; 5M47 A; 1T6K A; #chains in the Genus database with same CATH topology 2EB0 A; 2PVZ A; 3EDN A; 1YM5 A; 2GKJ A; 2LT2 A; 2ZVF A; 4LS9 A; 1TM0 A; 2QB8 A; 1BWZ A; 5H2Y A; 1S7J A; 3PVH A; 1W62 A; 2KPT A; 5HA4 A; 2OTN A; 2ZXP A; 1U0K A; 3PTJ A; 4Q2H A; 4Q60 A; 5M47 A; 4OA3 A; 4IJZ A; 3PW9 A; 3G7K A; 4JBD A; 4JD7 A; 4JUU A; 2HAW A; 3EKM A; 1WPM A; 2KW7 A; 4LB0 A; 1W61 A; 4JCI A; 3G98 A; 3DEV A; 2AZP A; 4J9W A; 4DUN A; 1WPP A; 2Q9J A; 4K7X A; 2QB6 A; 1XUA A; 2GKE A; 1U1W A; 1I74 A; 4K7G B; 3EJX A; 4IK0 A; 3IGH X; 5H2G A; 1U1X A; 1XUB A; 2ZXR A; 1U1V A; 3WQZ A; 1QY9 A; 4PY9 A; 4GL6 A; 1GQZ A; 1IR6 A; 2H9F A; 3W5W A; 4RPA A; 1K23 A; 3FVE A; 1K20 A; 2PW0 A; 3ICJ A; 2ENX A; 2QB7 A; 4K8L A; 5ANP A; 2Q9H A; 2ZXO A; 2IW4 A; 1QYA A; 1SDJ A; 4J9X A; 5IWE A; 4LG3 A; 2YMA A; 2MPB A; 1T6K A; #chains in the Genus database with same CATH homology 2EB0 A; 2PVZ A; 3EDN A; 1YM5 A; 2GKJ A; 2LT2 A; 2ZVF A; 4LS9 A; 1TM0 A; 2QB8 A; 1BWZ A; 5H2Y A; 1S7J A; 3PVH A; 1W62 A; 2KPT A; 5HA4 A; 2OTN A; 2ZXP A; 1U0K A; 3PTJ A; 4Q2H A; 4Q60 A; 5M47 A; 4OA3 A; 4IJZ A; 3PW9 A; 3G7K A; 4JBD A; 4JD7 A; 4JUU A; 2HAW A; 3EKM A; 1WPM A; 2KW7 A; 4LB0 A; 1W61 A; 4JCI A; 3G98 A; 3DEV A; 2AZP A; 4J9W A; 4DUN A; 1WPP A; 2Q9J A; 4K7X A; 2QB6 A; 1XUA A; 2GKE A; 1U1W A; 1I74 A; 4K7G B; 3EJX A; 4IK0 A; 3IGH X; 5H2G A; 1U1X A; 1XUB A; 2ZXR A; 1U1V A; 3WQZ A; 1QY9 A; 4PY9 A; 4GL6 A; 1GQZ A; 1IR6 A; 2H9F A; 3W5W A; 4RPA A; 1K23 A; 3FVE A; 1K20 A; 2PW0 A; 3ICJ A; 2ENX A; 2QB7 A; 4K8L A; 5ANP A; 2Q9H A; 2ZXO A; 2IW4 A; 1QYA A; 1SDJ A; 4J9X A; 5IWE A; 4LG3 A; 2YMA A; 2MPB A; 1T6K A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...