1AU1A

Human interferon-beta crystal structure
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
166
structure length
166
Chain Sequence
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human interferon beta at 2.2-A resolution.
pubmed doi rcsb
molecule keywords INTERFERON-BETA
molecule tags Interferon
source organism Homo sapiens
total genus 64
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00143 Interferon Interferon alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1au1A00
1B5LA 3QAZA 1JLIA 1CN4C 1EXZA 2D9QA 3L5XA 1A22A 1EKUA 1Y6KL 4RS1A 1HWGA 2Q98A 1BP3A 1HWHA 1RFBA 3BPOA 1KF9A 1V7MV 3NCEA 4O6KA 1PW6A 4O9HA 5FUCA 3N0PA 5D70A 4MHLA 1RCBA 3WCYI 1F45B 1F6FA 1ETEA 3PIVA 5D22A 5FHXA 3BESL 1M48A 3QB1A 3BPNA 4YPGC 2ILKA 1HULA 3UF5A 1M47A 1Z7CA 2CYKA 3EW3A 1FG9A 1IRLA 1HZIA 3SE4B 1HGUA 1AU1A 1Y6NL 1PVHB 1M4AA 5E4EA 1D9CA 3G6DA 1N1FA 1ILKA 1BUYA 2IL6A 3NPZA 4YQXA 2LAGA 1CYLA 4YDYI 1INRA 2ERJD 1RHGA 1HIJA 1IARA 4WRLB 3MZGA 1M4BA 2B5IA 4NI7A 1PY2A 1D9GA 3HHRA 1PGRA 1ITIA 1GA3A 2INTA 3L5WI 4PS4A 3UX9A 1BBNA 2B8UA 2B8ZA 3NCBA 5KNHI 4ZF7A 1LQSL 4Z5RD 3DLQI 5C7XA 1IJZA 3S9DA 1AX8A 1J7VL 1M4RA 1YKBA 2O27A 3QWRB 1Y6ML 1IK0A 1EMRA 2O26A 1A7MA 3B5KA 1RW5A 5LQBA 3DGCL 4GRWA 3D87A 1HIKA 1VLKA 3QB7A 1Z92A 1ITFA 2L3YA 3UEZE 1M49A 3Q1SI 3EJJA 1IL6A 3QT2C 1AXIA 3D85C 3UF2A 3NCFA 3INKC 1BGEA 4ZS7A 3VA2A 4NEMA 1I1RB 4X51A 2GMFA 1CSGA 1BGCA 4FA8E 4I77Z 1ALUA 1M4CA 2L3OA 1FYHA 1NBPA 5L6YC 2B91A 2Q7NB 2B90A 2B8YA 3DUHC 2D48A 1CNT1 3LB6A 2E9WC 4YUEC 1LK3A 1ITLA 2B8XA 1WU3I 1SCFA 4NI9A 1BGDA 1CD9A 4NEJA 5D28B 5D72A 1P9MB 1LKIA 3OQ3A 1EVSA 3LB6B 3SE3B 3N06A 3PIWA 1V7NV 3BPLA 1EERA 3HMXB 2LMSA 2KZ1A 1QVNA 3D48P 4NKQC 1BCNA 4DOHA 5D71A 3NCCA 1HUWA 1ITMA 2H24A 2HYMB 4J4LC 4CNIC 1GNCA 3G9VB
chains in the Genus database with same CATH superfamily
1B5LA 3QAZA 1JLIA 1CN4C 5C4XD 1EXZA 3HOYD 1HWGA 2Q98A 1HWHA 4TPHA 3NCEA 4O9HA 3WCYI 1F6FA 5D22A 3BESL 4A3LD 4A93D 2R93D 3BPNA 4YPGC 3HOZD 1FG9A 4EXNA 2CFQA 3SE4B 1Y14A 5EQGA 5D6KA 3NPZA 3WDOA 3HOXD 1M4BA 4APSA 5EQHA 4PS4A 4DKCA 3O7PA 2B8UA 2XUTA 1LQSL 3S9DA 1AX8A 1J7VL 1YKBA 1IK0A 3OG6A 4W6VA 3IRHA 3QB7A 2L3YA 1M49A 3Q1SI 4NN5A 3HOWD 4X51A 5IYBD 1CSGA 1BGCA 2C35A 1NBPA 2B91A 4YBQA 2JA8D 5IYDD 1BGDA 1CD9A 1P9MB 1LKIA 3OQ3A 3SE3B 3PIWA 1V7NV 4JR9A 4U4TA 4OH3A 4QIQA 2KZ1A 1QVNA 5D71A 5IP7D 4YB9D 5TS9A 4A3ID 4IKYA 3L5XA 1A22A 3FKID 4GBYA 1BP3A 2R92D 5FUCA 2R7ZD 4MHLA 1ETEA 3O7QA 3HOUD 4U4VA 4IKVA 4Q65A 2ILKA 1HULA 3UF5A 3EW3A 4DKDA 5EQIA 3PO2D 1M4AA 3HOVD 4A3JD 3G6DA 4XNJA 1ILKA 1CYLA 1INRA 2ERJD 3MZGA 1ITIA 4BY7D 4BBRD 1BBNA 3OG4A 3NCBA 5KNHI 4TPGA 4Z5RD 3DLQI 1IJZA 1M4RA 5C65A 1EMRA 1Y1WD 3B5KA 1RW5A 3DGCL 4GRWA 5A2OA 2Q14A 3UEZE 4ZW9A 3QT2C 1AXIA 1PW4A 3D85C 3NCFA 4ZS7A 4IKXA 1ALUA 1FYHA 5IP9D 2Q7NB 2B8YA 1ITLA 2B8XA 1SCFA 4NEJA 4IKWA 1Y1VD 1PV6A 1EVSA 4A3ED 4PYPA 1EERA 3D48P 5C3ED 1BCNA 3NCCA 4UVMA 4JA3A 2V8NA 1GNCA 4JREA 3DI2A 2D9QA 4NN6A 1EKUA 4D2BA 1Y6KL 5D58A 2JA5D 3BPOA 3TGXB 1PW6A 3N0PA 4OAAA 1F45B 3PIVA 5FHXA 1M48A 3QB1A 1Z7CA 1HZIA 1Y6NL 1PVHB 1D9CA 1N1FA 4IU8A 1BUYA 4YQXA 4U4WA 4ZWCA 2LAGA 4D2CA 1HIJA 3H3VE 4WRLB 1PGRA 1GA3A 2INTA 3UX9A 5A2NA 4ZYRA 4ZF7A 2JA7D 3QWRB 1PV7A 5LQBA 3D87A 1HIKA 4GBZA 4IU9A 3EJJA 1IL6A 2OQPA 3INKC 1BGEA 4A3KD 3I4ND 1I1RB 4FA8E 4I77Z 4EXPA 5L6YC 2O6IA 2B90A 2D48A 2PSMA 1CNT1 4J05A 2E9WC 2Z3RA 1LK3A 4XNIA 4YUEC 1WU3I 4NN7A 5D28B 3LB6B 3N06A 2Z3QA 5GXBA 3H0GD 2LMSA 4NKQC 2CFPA 3AYHA 1HUWA 2HYMB 4LDSA 4BBSD 5IYCD 4IKZA 4RS1A 4LEPA 1RFBA 3PO3D 1KF9A 4LRLA 3I4MD 1V7MV 4GS7A 2B63D 4O6KA 5D70A 5D59A 1RCBA 2Y5YA 1M47A 2CYKA 5C44D 1IRLA 1HGUA 1AU1A 5E4EA 2IL6A 4YDYI 1RHGA 1IARA 2B5IA 4NI7A 1PY2A 1D9GA 3HHRA 4A3CD 3L5WI 2B8ZA 5C7XA 4A3BD 4D2DA 2O27A 4BXXD 1Y6ML 2O26A 1A7MA 1VLKA 1Z92A 1ITFA 4A3MD 3UF2A 4A3GD 4DKEA 3VA2A 5FLMD 4NEMA 4BY1D 2GMFA 4TPJA 1M4CA 2L3OA 3DUHC 3LB6A 4GC0A 2VUMD 4A3FD 4NI9A 5D72A 3HHCA 4A3DD 3BPLA 3HMXB 4DKFA 1WCMD 4DOHA 1ITMA 2H24A 4ZWBA 4J4LC 4CNIC 2JA6D 3DI3A 3G9VB 2XQBA
chains in the Genus database with same CATH topology
5IYCD 3DI2A 5TS9A 4A3ID 1B5LA 3QAZA 1JLIA 1CN4C 5C4XD 1EXZA 2D9QA 3L5XA 3HOYD 1A22A 4NN6A 1EKUA 1Y6KL 3FKID 1HWGA 4RS1A 2JA5D 2Q98A 1BP3A 1HWHA 1RFBA 3PO3D 3BPOA 1KF9A 4LRLA 3I4MD 3TGXB 1V7MV 4GS7A 2B63D 3NCEA 4O6KA 1PW6A 4O9HA 5FUCA 2R92D 3N0PA 2R7ZD 5D70A 4MHLA 1RCBA 3WCYI 1F45B 1F6FA 1ETEA 3PIVA 5D22A 3HOUD 5FHXA 3BESL 1M48A 4A3LD 3QB1A 4A93D 2R93D 3BPNA 4YPGC 2ILKA 1HULA 3HOZD 3UF5A 1M47A 1Z7CA 2CYKA 3EW3A 5C44D 1FG9A 4EXNA 1IRLA 1HZIA 3SE4B 1HGUA 1AU1A 4DKDA 3PO2D 1Y6NL 1PVHB 1Y14A 1M4AA 5E4EA 1D9CA 4A3JD 3HOVD 3G6DA 1N1FA 1ILKA 1BUYA 2IL6A 3NPZA 4YQXA 2LAGA 3HOXD 1CYLA 4YDYI 1INRA 2ERJD 1RHGA 1HIJA 3H3VE 1IARA 4WRLB 3MZGA 1M4BA 2B5IA 4NI7A 1PY2A 1D9GA 3HHRA 1PGRA 1ITIA 4BY7D 2INTA 3L5WI 4PS4A 3UX9A 4A3CD 1GA3A 4BBRD 4DKCA 1BBNA 2B8UA 3OG4A 2B8ZA 3NCBA 5KNHI 4ZF7A 1LQSL 2JA7D 4Z5RD 3DLQI 5C7XA 1IJZA 3S9DA 4A3BD 1AX8A 1J7VL 1M4RA 1YKBA 2O27A 4BXXD 3QWRB 1Y6ML 1IK0A 3OG6A 1EMRA 2O26A 1Y1WD 1A7MA 3B5KA 3IRHA 1RW5A 5LQBA 3DGCL 4GRWA 3D87A 1HIKA 1VLKA 3QB7A 1Z92A 2Q14A 2L3YA 3UEZE 1ITFA 1M49A 3Q1SI 3EJJA 1IL6A 3QT2C 1AXIA 4A3MD 3D85C 3UF2A 2OQPA 3NCFA 3INKC 4DKEA 4A3GD 1BGEA 4ZS7A 4NN5A 3VA2A 5FLMD 4A3KD 3I4ND 4NEMA 3HOWD 4BBSD 1I1RB 4X51A 4BY1D 2GMFA 5IYBD 1CSGA 1BGCA 4FA8E 4I77Z 1ALUA 1M4CA 2C35A 2L3OA 1FYHA 1NBPA 5IP9D 4EXPA 5L6YC 2B91A 2O6IA 2B90A 2B8YA 2Q7NB 3DUHC 2D48A 2JA8D 2PSMA 1CNT1 3LB6A 2E9WC 2Z3RA 1LK3A 4YUEC 1ITLA 2B8XA 5IYDD 1WU3I 4NN7A 2VUMD 4A3FD 1SCFA 4NI9A 1BGDA 1CD9A 4NEJA 5D28B 5D72A 1Y1VD 1P9MB 1LKIA 3OQ3A 1EVSA 3LB6B 3SE3B 3N06A 3HHCA 2Z3QA 3PIWA 4A3ED 4A3DD 1V7NV 3BPLA 1EERA 3H0GD 3HMXB 4DKFA 1WCMD 2LMSA 2KZ1A 1QVNA 3D48P 5C3ED 4NKQC 1BCNA 4DOHA 3AYHA 3NCCA 5D71A 1HUWA 1ITMA 2H24A 2HYMB 4J4LC 4CNIC 2JA6D 3DI3A 5IP7D 1GNCA 3G9VB 2XQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B5L A;  3QAZ A;  1JLI A;  1CN4 C;  1EXZ A;  2D9Q A;  3L5X A;  1A22 A;  1EKU A;  1Y6K L;  4RS1 A;  1HWG A;  2Q98 A;  1BP3 A;  1HWH A;  1RFB A;  3BPO A;  1KF9 A;  1V7M V;  3NCE A;  4O6K A;  1PW6 A;  4O9H A;  5FUC A;  3N0P A;  5D70 A;  4MHL A;  1RCB A;  3WCY I;  1F45 B;  1F6F A;  1ETE A;  3PIV A;  5D22 A;  5FHX A;  3BES L;  1M48 A;  3QB1 A;  3BPN A;  4YPG C;  2ILK A;  1HUL A;  3UF5 A;  1M47 A;  1Z7C A;  2CYK A;  3EW3 A;  1FG9 A;  1IRL A;  1HZI A;  3SE4 B;  1HGU A;  1AU1 A;  1Y6N L;  1PVH B;  1M4A A;  5E4E A;  1D9C A;  3G6D A;  1N1F A;  1ILK A;  1BUY A;  2IL6 A;  3NPZ A;  4YQX A;  2LAG A;  1CYL A;  4YDY I;  1INR A;  2ERJ D;  1RHG A;  1HIJ A;  1IAR A;  4WRL B;  3MZG A;  1M4B A;  2B5I A;  4NI7 A;  1PY2 A;  1D9G A;  3HHR A;  1PGR A;  1ITI A;  1GA3 A;  2INT A;  3L5W I;  4PS4 A;  3UX9 A;  1BBN A;  2B8U A;  2B8Z A;  3NCB A;  5KNH I;  4ZF7 A;  1LQS L;  4Z5R D;  3DLQ I;  5C7X A;  1IJZ A;  3S9D A;  1AX8 A;  1J7V L;  1M4R A;  1YKB A;  2O27 A;  3QWR B;  1Y6M L;  1IK0 A;  1EMR A;  2O26 A;  1A7M A;  3B5K A;  1RW5 A;  5LQB A;  3DGC L;  4GRW A;  3D87 A;  1HIK A;  1VLK A;  3QB7 A;  1Z92 A;  1ITF A;  2L3Y A;  3UEZ E;  1M49 A;  3Q1S I;  3EJJ A;  1IL6 A;  3QT2 C;  1AXI A;  3D85 C;  3UF2 A;  3NCF A;  3INK C;  1BGE A;  4ZS7 A;  3VA2 A;  4NEM A;  1I1R B;  4X51 A;  2GMF A;  1CSG A;  1BGC A;  4FA8 E;  4I77 Z;  1ALU A;  1M4C A;  2L3O A;  1FYH A;  1NBP A;  5L6Y C;  2B91 A;  2Q7N B;  2B90 A;  2B8Y A;  3DUH C;  2D48 A;  1CNT 1;  3LB6 A;  2E9W C;  4YUE C;  1LK3 A;  1ITL A;  2B8X A;  1WU3 I;  1SCF A;  4NI9 A;  1BGD A;  1CD9 A;  4NEJ A;  5D28 B;  5D72 A;  1P9M B;  1LKI A;  3OQ3 A;  1EVS A;  3LB6 B;  3SE3 B;  3N06 A;  3PIW A;  1V7N V;  3BPL A;  1EER A;  3HMX B;  2LMS A;  2KZ1 A;  1QVN A;  3D48 P;  4NKQ C;  1BCN A;  4DOH A;  5D71 A;  3NCC A;  1HUW A;  1ITM A;  2H24 A;  2HYM B;  4J4L C;  4CNI C;  1GNC A;  3G9V B; 
#chains in the Genus database with same CATH topology
 1B5L A;  3QAZ A;  1JLI A;  1CN4 C;  5C4X D;  1EXZ A;  3HOY D;  1HWG A;  2Q98 A;  1HWH A;  4TPH A;  3NCE A;  4O9H A;  3WCY I;  1F6F A;  5D22 A;  3BES L;  4A3L D;  4A93 D;  2R93 D;  3BPN A;  4YPG C;  3HOZ D;  1FG9 A;  4EXN A;  2CFQ A;  3SE4 B;  1Y14 A;  5EQG A;  5D6K A;  3NPZ A;  3WDO A;  3HOX D;  1M4B A;  4APS A;  5EQH A;  4PS4 A;  4DKC A;  3O7P A;  2B8U A;  2XUT A;  1LQS L;  3S9D A;  1AX8 A;  1J7V L;  1YKB A;  1IK0 A;  3OG6 A;  4W6V A;  3IRH A;  3QB7 A;  2L3Y A;  1M49 A;  3Q1S I;  4NN5 A;  3HOW D;  4X51 A;  5IYB D;  1CSG A;  1BGC A;  2C35 A;  1NBP A;  2B91 A;  4YBQ A;  2JA8 D;  5IYD D;  1BGD A;  1CD9 A;  1P9M B;  1LKI A;  3OQ3 A;  3SE3 B;  3PIW A;  1V7N V;  4JR9 A;  4U4T A;  4OH3 A;  4QIQ A;  2KZ1 A;  1QVN A;  5D71 A;  5IP7 D;  4YB9 D;  5TS9 A;  4A3I D;  4IKY A;  3L5X A;  1A22 A;  3FKI D;  4GBY A;  1BP3 A;  2R92 D;  5FUC A;  2R7Z D;  4MHL A;  1ETE A;  3O7Q A;  3HOU D;  4U4V A;  4IKV A;  4Q65 A;  2ILK A;  1HUL A;  3UF5 A;  3EW3 A;  4DKD A;  5EQI A;  3PO2 D;  1M4A A;  3HOV D;  4A3J D;  3G6D A;  4XNJ A;  1ILK A;  1CYL A;  1INR A;  2ERJ D;  3MZG A;  1ITI A;  4BY7 D;  4BBR D;  1BBN A;  3OG4 A;  3NCB A;  5KNH I;  4TPG A;  4Z5R D;  3DLQ I;  1IJZ A;  1M4R A;  5C65 A;  1EMR A;  1Y1W D;  3B5K A;  1RW5 A;  3DGC L;  4GRW A;  5A2O A;  2Q14 A;  3UEZ E;  4ZW9 A;  3QT2 C;  1AXI A;  1PW4 A;  3D85 C;  3NCF A;  4ZS7 A;  4IKX A;  1ALU A;  1FYH A;  5IP9 D;  2Q7N B;  2B8Y A;  1ITL A;  2B8X A;  1SCF A;  4NEJ A;  4IKW A;  1Y1V D;  1PV6 A;  1EVS A;  4A3E D;  4PYP A;  1EER A;  3D48 P;  5C3E D;  1BCN A;  3NCC A;  4UVM A;  4JA3 A;  2V8N A;  1GNC A;  4JRE A;  3DI2 A;  2D9Q A;  4NN6 A;  1EKU A;  4D2B A;  1Y6K L;  5D58 A;  2JA5 D;  3BPO A;  3TGX B;  1PW6 A;  3N0P A;  4OAA A;  1F45 B;  3PIV A;  5FHX A;  1M48 A;  3QB1 A;  1Z7C A;  1HZI A;  1Y6N L;  1PVH B;  1D9C A;  1N1F A;  4IU8 A;  1BUY A;  4YQX A;  4U4W A;  4ZWC A;  2LAG A;  4D2C A;  1HIJ A;  3H3V E;  4WRL B;  1PGR A;  1GA3 A;  2INT A;  3UX9 A;  5A2N A;  4ZYR A;  4ZF7 A;  2JA7 D;  3QWR B;  1PV7 A;  5LQB A;  3D87 A;  1HIK A;  4GBZ A;  4IU9 A;  3EJJ A;  1IL6 A;  2OQP A;  3INK C;  1BGE A;  4A3K D;  3I4N D;  1I1R B;  4FA8 E;  4I77 Z;  4EXP A;  5L6Y C;  2O6I A;  2B90 A;  2D48 A;  2PSM A;  1CNT 1;  4J05 A;  2E9W C;  2Z3R A;  1LK3 A;  4XNI A;  4YUE C;  1WU3 I;  4NN7 A;  5D28 B;  3LB6 B;  3N06 A;  2Z3Q A;  5GXB A;  3H0G D;  2LMS A;  4NKQ C;  2CFP A;  3AYH A;  1HUW A;  2HYM B;  4LDS A;  4BBS D;  5IYC D;  4IKZ A;  4RS1 A;  4LEP A;  1RFB A;  3PO3 D;  1KF9 A;  4LRL A;  3I4M D;  1V7M V;  4GS7 A;  2B63 D;  4O6K A;  5D70 A;  5D59 A;  1RCB A;  2Y5Y A;  1M47 A;  2CYK A;  5C44 D;  1IRL A;  1HGU A;  1AU1 A;  5E4E A;  2IL6 A;  4YDY I;  1RHG A;  1IAR A;  2B5I A;  4NI7 A;  1PY2 A;  1D9G A;  3HHR A;  4A3C D;  3L5W I;  2B8Z A;  5C7X A;  4A3B D;  4D2D A;  2O27 A;  4BXX D;  1Y6M L;  2O26 A;  1A7M A;  1VLK A;  1Z92 A;  1ITF A;  4A3M D;  3UF2 A;  4A3G D;  4DKE A;  3VA2 A;  5FLM D;  4NEM A;  4BY1 D;  2GMF A;  4TPJ A;  1M4C A;  2L3O A;  3DUH C;  3LB6 A;  4GC0 A;  2VUM D;  4A3F D;  4NI9 A;  5D72 A;  3HHC A;  4A3D D;  3BPL A;  3HMX B;  4DKF A;  1WCM D;  4DOH A;  1ITM A;  2H24 A;  4ZWB A;  4J4L C;  4CNI C;  2JA6 D;  3DI3 A;  3G9V B;  2XQB A; 
#chains in the Genus database with same CATH homology
 5IYC D;  3DI2 A;  5TS9 A;  4A3I D;  1B5L A;  3QAZ A;  1JLI A;  1CN4 C;  5C4X D;  1EXZ A;  2D9Q A;  3L5X A;  3HOY D;  1A22 A;  4NN6 A;  1EKU A;  1Y6K L;  3FKI D;  1HWG A;  4RS1 A;  2JA5 D;  2Q98 A;  1BP3 A;  1HWH A;  1RFB A;  3PO3 D;  3BPO A;  1KF9 A;  4LRL A;  3I4M D;  3TGX B;  1V7M V;  4GS7 A;  2B63 D;  3NCE A;  4O6K A;  1PW6 A;  4O9H A;  5FUC A;  2R92 D;  3N0P A;  2R7Z D;  5D70 A;  4MHL A;  1RCB A;  3WCY I;  1F45 B;  1F6F A;  1ETE A;  3PIV A;  5D22 A;  3HOU D;  5FHX A;  3BES L;  1M48 A;  4A3L D;  3QB1 A;  4A93 D;  2R93 D;  3BPN A;  4YPG C;  2ILK A;  1HUL A;  3HOZ D;  3UF5 A;  1M47 A;  1Z7C A;  2CYK A;  3EW3 A;  5C44 D;  1FG9 A;  4EXN A;  1IRL A;  1HZI A;  3SE4 B;  1HGU A;  1AU1 A;  4DKD A;  3PO2 D;  1Y6N L;  1PVH B;  1Y14 A;  1M4A A;  5E4E A;  1D9C A;  4A3J D;  3HOV D;  3G6D A;  1N1F A;  1ILK A;  1BUY A;  2IL6 A;  3NPZ A;  4YQX A;  2LAG A;  3HOX D;  1CYL A;  4YDY I;  1INR A;  2ERJ D;  1RHG A;  1HIJ A;  3H3V E;  1IAR A;  4WRL B;  3MZG A;  1M4B A;  2B5I A;  4NI7 A;  1PY2 A;  1D9G A;  3HHR A;  1PGR A;  1ITI A;  4BY7 D;  2INT A;  3L5W I;  4PS4 A;  3UX9 A;  4A3C D;  1GA3 A;  4BBR D;  4DKC A;  1BBN A;  2B8U A;  3OG4 A;  2B8Z A;  3NCB A;  5KNH I;  4ZF7 A;  1LQS L;  2JA7 D;  4Z5R D;  3DLQ I;  5C7X A;  1IJZ A;  3S9D A;  4A3B D;  1AX8 A;  1J7V L;  1M4R A;  1YKB A;  2O27 A;  4BXX D;  3QWR B;  1Y6M L;  1IK0 A;  3OG6 A;  1EMR A;  2O26 A;  1Y1W D;  1A7M A;  3B5K A;  3IRH A;  1RW5 A;  5LQB A;  3DGC L;  4GRW A;  3D87 A;  1HIK A;  1VLK A;  3QB7 A;  1Z92 A;  2Q14 A;  2L3Y A;  3UEZ E;  1ITF A;  1M49 A;  3Q1S I;  3EJJ A;  1IL6 A;  3QT2 C;  1AXI A;  4A3M D;  3D85 C;  3UF2 A;  2OQP A;  3NCF A;  3INK C;  4DKE A;  4A3G D;  1BGE A;  4ZS7 A;  4NN5 A;  3VA2 A;  5FLM D;  4A3K D;  3I4N D;  4NEM A;  3HOW D;  4BBS D;  1I1R B;  4X51 A;  4BY1 D;  2GMF A;  5IYB D;  1CSG A;  1BGC A;  4FA8 E;  4I77 Z;  1ALU A;  1M4C A;  2C35 A;  2L3O A;  1FYH A;  1NBP A;  5IP9 D;  4EXP A;  5L6Y C;  2B91 A;  2O6I A;  2B90 A;  2B8Y A;  2Q7N B;  3DUH C;  2D48 A;  2JA8 D;  2PSM A;  1CNT 1;  3LB6 A;  2E9W C;  2Z3R A;  1LK3 A;  4YUE C;  1ITL A;  2B8X A;  5IYD D;  1WU3 I;  4NN7 A;  2VUM D;  4A3F D;  1SCF A;  4NI9 A;  1BGD A;  1CD9 A;  4NEJ A;  5D28 B;  5D72 A;  1Y1V D;  1P9M B;  1LKI A;  3OQ3 A;  1EVS A;  3LB6 B;  3SE3 B;  3N06 A;  3HHC A;  2Z3Q A;  3PIW A;  4A3E D;  4A3D D;  1V7N V;  3BPL A;  1EER A;  3H0G D;  3HMX B;  4DKF A;  1WCM D;  2LMS A;  2KZ1 A;  1QVN A;  3D48 P;  5C3E D;  4NKQ C;  1BCN A;  4DOH A;  3AYH A;  3NCC A;  5D71 A;  1HUW A;  1ITM A;  2H24 A;  2HYM B;  4J4L C;  4CNI C;  2JA6 D;  3DI3 A;  5IP7 D;  1GNC A;  3G9V B;  2XQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...