1BGEA

Crystal structure of canine and bovine granulocyte-colony stimulating factor (g-csf)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
PLPQSFLLKCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQPPLSSCSSQALQLMGCLRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMAPTMPAFTSAFQRRAGGVLVASNLQSFLELAYRALRHFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of canine and bovine granulocyte-colony stimulating factor (G-CSF).
pubmed doi rcsb
molecule keywords GRANULOCYTE COLONY-STIMULATING FACTOR
molecule tags Cytokine
source organism Canis lupus familiaris
total genus 59
structure length 159
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16647 GCSF Granulocyte colony-stimulating factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1bgeA00
1HWGA 2INTA 1FYHA 1V7MV 2HYMB 5C7XA 3DLQI 3OQ3A 1CYLA 4RS1A 3D87A 3QAZA 2H24A 1ILKA 1Z92A 3G6DA 1Y6KL 3QB1A 1LQSL 4Z5RD 3UF2A 5LQBA 1WU3I 4J4LC 3UX9A 2B8YA 4GRWA 3L5WI 3Q1SI 1HIKA 1AX8A 1M4CA 1GA3A 1Y6ML 4WRLB 2Q98A 3VA2A 1ALUA 2LAGA 4NKQC 1CNT1 2O26A 3UEZE 4MHLA 2B5IA 2B91A 3MZGA 4X51A 2D9QA 4DOHA 1PGRA 3INKC 5L6YC 1HZIA 3D48P 2ERJD 1ITMA 3QT2C 2D48A 1AU1A 3SE3B 1IJZA 1CD9A 1CN4C 3BPNA 5KNHI 1RFBA 1M49A 1EMRA 1BP3A 1J7VL 3L5XA 3EJJA 1AXIA 1N1FA 2B8ZA 1JLIA 3QB7A 3SE4B 3N0PA 4YQXA 1IK0A 1BGEA 1BUYA 1EKUA 1ITLA 2GMFA 2IL6A 1A22A 1BGCA 5FUCA 1CSGA 2B90A 3DUHC 1M4BA 4YPGC 3WCYI 4NEJA 5D22A 1D9CA 3BESL 1EVSA 2LMSA 1D9GA 1ITFA 4CNIC 2L3OA 1F6FA 2E9WC 1HWHA 4O9HA 1RCBA 1ETEA 5D71A 3PIVA 3UF5A 1FG9A 3LB6B 5D72A 1KF9A 1I1RB 1NBPA 2ILKA 1B5LA 1EERA 2KZ1A 4FA8E 3EW3A 3NPZA 1GNCA 3S9DA 1HULA 3LB6A 3B5KA 3NCEA 1EXZA 3HMXB 3BPOA 4YUEC 1IRLA 1Z7CA 2B8XA 3HHRA 1HIJA 4I77Z 4NI9A 5D70A 3NCFA 1ITIA 3DGCL 1RHGA 3N06A 1A7MA 1PY2A 3BPLA 2Q7NB 1M48A 4ZS7A 1QVNA 1PW6A 1BBNA 5FHXA 1VLKA 1BGDA 1LKIA 1LK3A 4NI7A 5D28B 2B8UA 1IL6A 3PIWA 1HGUA 2L3YA 1Y6NL 4ZF7A 4PS4A 1V7NV 3NCCA 2O27A 1M47A 1PVHB 2CYKA 3NCBA 1YKBA 3D85C 4NEMA 4O6KA 1HUWA 1SCFA 3G9VB 1INRA 1IARA 1M4AA 1P9MB 4YDYI 3QWRB 1BCNA 1M4RA 5E4EA 1F45B 1RW5A
chains in the Genus database with same CATH superfamily
2INTA 5EQHA 1V7MV 3OQ3A 5TS9A 4BY1D 1ILKA 1Z92A 3O7QA 4Z5RD 1WU3I 4J4LC 4U4VA 4D2BA 1Y6ML 3VA2A 2LAGA 2B63D 3UEZE 2C35A 2PSMA 4OAAA 4ZWBA 1WCMD 4ZYRA 2ERJD 3QT2C 3PO2D 2D48A 3FKID 3BPNA 3HOWD 4QIQA 1BP3A 1N1FA 2Y5YA 4Q65A 1BGEA 1EKUA 4YB9D 1A22A 1Y1WD 3WCYI 4NEJA 1D9CA 4NN5A 1EVSA 4DKFA 2L3OA 1F6FA 5D71A 3PIVA 4LEPA 1FG9A 4XNIA 5D72A 4IKZA 4DKDA 1NBPA 2ILKA 1B5LA 5D58A 3EW3A 4IKYA 4BY7D 1Z7CA 3HHRA 1HIJA 3IRHA 5D70A 5IP7D 3NCFA 1A7MA 2Q7NB 1LK3A 4U4WA 1Y14A 5D28B 2R92D 4DKEA 4PS4A 2CYKA 4NEMA 1PW4A 3G9VB 4NN7A 3OG6A 3QWRB 1RW5A 1HWGA 1FYHA 2HYMB 3QAZA 2H24A 3G6DA 4W6VA 5A2NA 2O6IA 1GA3A 4A3BD 1CNT1 2O26A 4MHLA 4U4TA 2B91A 4X51A 3DI2A 4BXXD 1PGRA 3AYHA 1ITMA 5IP9D 1AU1A 1IJZA 1CD9A 3HOXD 3L5XA 2XUTA 5IYCD 2B8ZA 4ZWCA 1JLIA 1IK0A 3N0PA 4A3MD 1BUYA 5C4XD 4IU8A 1BGCA 4OH3A 5FUCA 4A3KD 1CSGA 2B90A 3DUHC 1M4BA 4YPGC 5D22A 2LMSA 1D9GA 2CFQA 4GS7A 4CNIC 1HWHA 1ETEA 3UF5A 4IKWA 3LB6B 1EERA 4FA8E 3B5KA 3NCEA 3H3VE 3BPOA 5EQGA 4EXPA 1IRLA 3I4MD 4I77Z 3DGCL 5C65A 4ZS7A 3BPLA 1M48A 2XQBA 1BGDA 1LKIA 3TGXB 4TPGA 4NI7A 2Q14A 3PIWA 1HGUA 4ZF7A 4UVMA 5FLMD 1V7NV 4LDSA 1M47A 1PVHB 5EQIA 3PO3D 1INRA 1BCNA 2R7ZD 1CYLA 4RS1A 3D87A 3QB1A 1Y6KL 1LQSL 5LQBA 5IYDD 3UX9A 2B8YA 4GRWA 4A3ID 1HIKA 4WRLB 1ALUA 3MZGA 4TPJA 2D9QA 4APSA 2JA8D 4DOHA 5L6YC 1HZIA 3D48P 1PV7A 3SE3B 1CN4C 4BBRD 2Z3RA 1EMRA 1J7VL 3EJJA 3SE4B 2GMFA 1ITLA 4JA3A 4J05A 1PV6A 5IYBD 3HOUD 1Y1VD 3BESL 4GBYA 1ITFA 2E9WC 4O9HA 3DI3A 1RCBA 1KF9A 2KZ1A 3NPZA 1GNCA 3S9DA 1HULA 3LB6A 3HMXB 3O7PA 4YUEC 2B8XA 4EXNA 4NN6A 4NI9A 4GBZA 1ITIA 3N06A 1RHGA 5D6KA 1PY2A 4A3JD 1QVNA 2V8NA 4GC0A 5A2OA 2B8UA 1Y6NL 2O27A 3NCBA 1YKBA 4O6KA 1SCFA 3HOYD 2OQPA 4JREA 5D59A 4YDYI 5C3ED 1M4RA 5E4EA 1F45B 5C7XA 3DLQI 2R93D 3UF2A 3WDOA 3L5WI 3H0GD 3Q1SI 1AX8A 1M4CA 2Q98A 4NKQC 2B5IA 4A3LD 2JA6D 3HOZD 4A93D 3INKC 3OG4A 4LRLA 5KNHI 4A3GD 3HOVD 1RFBA 1M49A 4D2DA 4XNJA 1AXIA 4JR9A 3QB7A 4YQXA 5C44D 2IL6A 2VUMD 4A3FD 4PYPA 2JA5D 4IU9A 4A3DD 5GXBA 4ZW9A 4DKCA 4D2CA 4A3CD 2CFPA 3HHCA 1I1RB 4IKXA 4BBSD 1EXZA 3I4ND 4A3ED 4TPHA 2Z3QA 1PW6A 2JA7D 1BBNA 5FHXA 1VLKA 1IL6A 2L3YA 4IKVA 3NCCA 3D85C 1HUWA 4YBQA 1IARA 1M4AA 1P9MB
chains in the Genus database with same CATH topology
1HWGA 2INTA 1FYHA 1V7MV 2R7ZD 2HYMB 5C7XA 3DLQI 3OQ3A 2R93D 1CYLA 4RS1A 3D87A 3QAZA 5TS9A 2H24A 1ILKA 1Z92A 3G6DA 1Y6KL 3QB1A 1LQSL 4Z5RD 4BY1D 3UF2A 5LQBA 1WU3I 5IYDD 4J4LC 2O6IA 3UX9A 2B8YA 4GRWA 4A3ID 3L5WI 3H0GD 3Q1SI 1HIKA 1AX8A 1M4CA 1GA3A 1Y6ML 4WRLB 2Q98A 3VA2A 1ALUA 2LAGA 4NKQC 4A3BD 2B63D 1CNT1 2O26A 3UEZE 4MHLA 2B5IA 2B91A 3MZGA 2JA6D 4X51A 2C35A 4A3LD 3DI2A 2D9QA 2JA8D 3HOZD 4DOHA 4BXXD 4A93D 1PGRA 3INKC 5L6YC 1HZIA 2PSMA 3D48P 1WCMD 3AYHA 2ERJD 1ITMA 3QT2C 5IP9D 3OG4A 4LRLA 2D48A 3FKID 3PO2D 1AU1A 3SE3B 1IJZA 1CD9A 1CN4C 3BPNA 5KNHI 4BBRD 3HOXD 3HOWD 4A3GD 3HOVD 1RFBA 1M49A 2Z3RA 1EMRA 1BP3A 1J7VL 3L5XA 3EJJA 5IYCD 1AXIA 1N1FA 2B8ZA 1JLIA 3QB7A 3SE4B 3N0PA 4YQXA 4A3MD 1BGEA 1BUYA 1IK0A 5C4XD 1EKUA 1ITLA 2GMFA 5C44D 2IL6A 1A22A 1BGCA 5FUCA 1Y1WD 4A3KD 2VUMD 1CSGA 5IYBD 3HOUD 2B90A 4A3FD 3DUHC 1M4BA 4YPGC 1Y1VD 3WCYI 4NEJA 5D22A 1D9CA 4NN5A 3BESL 1EVSA 2LMSA 1D9GA 2JA5D 4A3DD 4DKFA 4GS7A 1ITFA 4CNIC 2L3OA 1F6FA 2E9WC 1HWHA 3DI3A 1RCBA 4O9HA 4DKCA 1ETEA 5D71A 3PIVA 4A3CD 3UF5A 1FG9A 3LB6B 3HHCA 5D72A 1KF9A 1I1RB 4DKDA 1NBPA 2ILKA 1B5LA 1EERA 2KZ1A 4FA8E 3EW3A 3NPZA 1GNCA 4BBSD 3S9DA 1HULA 3LB6A 3B5KA 4BY7D 3NCEA 1EXZA 3HMXB 4A3ED 3BPOA 4YUEC 4EXPA 1IRLA 3H3VE 1Z7CA 2B8XA 3I4ND 3HHRA 3I4MD 1HIJA 3IRHA 4EXNA 4NN6A 4I77Z 4NI9A 5D70A 5IP7D 3NCFA 1ITIA 3DGCL 1RHGA 3N06A 1A7MA 1PY2A 3BPLA 2Q7NB 1M48A 4ZS7A 2XQBA 1QVNA 2Z3QA 1PW6A 4A3JD 2JA7D 1BBNA 5FHXA 1VLKA 1BGDA 1LKIA 1LK3A 3TGXB 1Y14A 4NI7A 5D28B 2Q14A 2R92D 2B8UA 1IL6A 3PIWA 1HGUA 2L3YA 1Y6NL 4ZF7A 5FLMD 4DKEA 4PS4A 1V7NV 3NCCA 2O27A 1M47A 1PVHB 2CYKA 3NCBA 1YKBA 3D85C 4NEMA 4O6KA 1HUWA 1SCFA 3G9VB 3HOYD 2OQPA 3PO3D 1INRA 1IARA 1M4AA 1P9MB 4YDYI 4NN7A 3OG6A 3QWRB 5C3ED 1BCNA 1M4RA 5E4EA 1F45B 1RW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HWG A;  2INT A;  1FYH A;  1V7M V;  2HYM B;  5C7X A;  3DLQ I;  3OQ3 A;  1CYL A;  4RS1 A;  3D87 A;  3QAZ A;  2H24 A;  1ILK A;  1Z92 A;  3G6D A;  1Y6K L;  3QB1 A;  1LQS L;  4Z5R D;  3UF2 A;  5LQB A;  1WU3 I;  4J4L C;  3UX9 A;  2B8Y A;  4GRW A;  3L5W I;  3Q1S I;  1HIK A;  1AX8 A;  1M4C A;  1GA3 A;  1Y6M L;  4WRL B;  2Q98 A;  3VA2 A;  1ALU A;  2LAG A;  4NKQ C;  1CNT 1;  2O26 A;  3UEZ E;  4MHL A;  2B5I A;  2B91 A;  3MZG A;  4X51 A;  2D9Q A;  4DOH A;  1PGR A;  3INK C;  5L6Y C;  1HZI A;  3D48 P;  2ERJ D;  1ITM A;  3QT2 C;  2D48 A;  1AU1 A;  3SE3 B;  1IJZ A;  1CD9 A;  1CN4 C;  3BPN A;  5KNH I;  1RFB A;  1M49 A;  1EMR A;  1BP3 A;  1J7V L;  3L5X A;  3EJJ A;  1AXI A;  1N1F A;  2B8Z A;  1JLI A;  3QB7 A;  3SE4 B;  3N0P A;  4YQX A;  1IK0 A;  1BGE A;  1BUY A;  1EKU A;  1ITL A;  2GMF A;  2IL6 A;  1A22 A;  1BGC A;  5FUC A;  1CSG A;  2B90 A;  3DUH C;  1M4B A;  4YPG C;  3WCY I;  4NEJ A;  5D22 A;  1D9C A;  3BES L;  1EVS A;  2LMS A;  1D9G A;  1ITF A;  4CNI C;  2L3O A;  1F6F A;  2E9W C;  1HWH A;  4O9H A;  1RCB A;  1ETE A;  5D71 A;  3PIV A;  3UF5 A;  1FG9 A;  3LB6 B;  5D72 A;  1KF9 A;  1I1R B;  1NBP A;  2ILK A;  1B5L A;  1EER A;  2KZ1 A;  4FA8 E;  3EW3 A;  3NPZ A;  1GNC A;  3S9D A;  1HUL A;  3LB6 A;  3B5K A;  3NCE A;  1EXZ A;  3HMX B;  3BPO A;  4YUE C;  1IRL A;  1Z7C A;  2B8X A;  3HHR A;  1HIJ A;  4I77 Z;  4NI9 A;  5D70 A;  3NCF A;  1ITI A;  3DGC L;  1RHG A;  3N06 A;  1A7M A;  1PY2 A;  3BPL A;  2Q7N B;  1M48 A;  4ZS7 A;  1QVN A;  1PW6 A;  1BBN A;  5FHX A;  1VLK A;  1BGD A;  1LKI A;  1LK3 A;  4NI7 A;  5D28 B;  2B8U A;  1IL6 A;  3PIW A;  1HGU A;  2L3Y A;  1Y6N L;  4ZF7 A;  4PS4 A;  1V7N V;  3NCC A;  2O27 A;  1M47 A;  1PVH B;  2CYK A;  3NCB A;  1YKB A;  3D85 C;  4NEM A;  4O6K A;  1HUW A;  1SCF A;  3G9V B;  1INR A;  1IAR A;  1M4A A;  1P9M B;  4YDY I;  3QWR B;  1BCN A;  1M4R A;  5E4E A;  1F45 B;  1RW5 A; 
#chains in the Genus database with same CATH topology
 2INT A;  5EQH A;  1V7M V;  3OQ3 A;  5TS9 A;  4BY1 D;  1ILK A;  1Z92 A;  3O7Q A;  4Z5R D;  1WU3 I;  4J4L C;  4U4V A;  4D2B A;  1Y6M L;  3VA2 A;  2LAG A;  2B63 D;  3UEZ E;  2C35 A;  2PSM A;  4OAA A;  4ZWB A;  1WCM D;  4ZYR A;  2ERJ D;  3QT2 C;  3PO2 D;  2D48 A;  3FKI D;  3BPN A;  3HOW D;  4QIQ A;  1BP3 A;  1N1F A;  2Y5Y A;  4Q65 A;  1BGE A;  1EKU A;  4YB9 D;  1A22 A;  1Y1W D;  3WCY I;  4NEJ A;  1D9C A;  4NN5 A;  1EVS A;  4DKF A;  2L3O A;  1F6F A;  5D71 A;  3PIV A;  4LEP A;  1FG9 A;  4XNI A;  5D72 A;  4IKZ A;  4DKD A;  1NBP A;  2ILK A;  1B5L A;  5D58 A;  3EW3 A;  4IKY A;  4BY7 D;  1Z7C A;  3HHR A;  1HIJ A;  3IRH A;  5D70 A;  5IP7 D;  3NCF A;  1A7M A;  2Q7N B;  1LK3 A;  4U4W A;  1Y14 A;  5D28 B;  2R92 D;  4DKE A;  4PS4 A;  2CYK A;  4NEM A;  1PW4 A;  3G9V B;  4NN7 A;  3OG6 A;  3QWR B;  1RW5 A;  1HWG A;  1FYH A;  2HYM B;  3QAZ A;  2H24 A;  3G6D A;  4W6V A;  5A2N A;  2O6I A;  1GA3 A;  4A3B D;  1CNT 1;  2O26 A;  4MHL A;  4U4T A;  2B91 A;  4X51 A;  3DI2 A;  4BXX D;  1PGR A;  3AYH A;  1ITM A;  5IP9 D;  1AU1 A;  1IJZ A;  1CD9 A;  3HOX D;  3L5X A;  2XUT A;  5IYC D;  2B8Z A;  4ZWC A;  1JLI A;  1IK0 A;  3N0P A;  4A3M D;  1BUY A;  5C4X D;  4IU8 A;  1BGC A;  4OH3 A;  5FUC A;  4A3K D;  1CSG A;  2B90 A;  3DUH C;  1M4B A;  4YPG C;  5D22 A;  2LMS A;  1D9G A;  2CFQ A;  4GS7 A;  4CNI C;  1HWH A;  1ETE A;  3UF5 A;  4IKW A;  3LB6 B;  1EER A;  4FA8 E;  3B5K A;  3NCE A;  3H3V E;  3BPO A;  5EQG A;  4EXP A;  1IRL A;  3I4M D;  4I77 Z;  3DGC L;  5C65 A;  4ZS7 A;  3BPL A;  1M48 A;  2XQB A;  1BGD A;  1LKI A;  3TGX B;  4TPG A;  4NI7 A;  2Q14 A;  3PIW A;  1HGU A;  4ZF7 A;  4UVM A;  5FLM D;  1V7N V;  4LDS A;  1M47 A;  1PVH B;  5EQI A;  3PO3 D;  1INR A;  1BCN A;  2R7Z D;  1CYL A;  4RS1 A;  3D87 A;  3QB1 A;  1Y6K L;  1LQS L;  5LQB A;  5IYD D;  3UX9 A;  2B8Y A;  4GRW A;  4A3I D;  1HIK A;  4WRL B;  1ALU A;  3MZG A;  4TPJ A;  2D9Q A;  4APS A;  2JA8 D;  4DOH A;  5L6Y C;  1HZI A;  3D48 P;  1PV7 A;  3SE3 B;  1CN4 C;  4BBR D;  2Z3R A;  1EMR A;  1J7V L;  3EJJ A;  3SE4 B;  2GMF A;  1ITL A;  4JA3 A;  4J05 A;  1PV6 A;  5IYB D;  3HOU D;  1Y1V D;  3BES L;  4GBY A;  1ITF A;  2E9W C;  4O9H A;  3DI3 A;  1RCB A;  1KF9 A;  2KZ1 A;  3NPZ A;  1GNC A;  3S9D A;  1HUL A;  3LB6 A;  3HMX B;  3O7P A;  4YUE C;  2B8X A;  4EXN A;  4NN6 A;  4NI9 A;  4GBZ A;  1ITI A;  3N06 A;  1RHG A;  5D6K A;  1PY2 A;  4A3J D;  1QVN A;  2V8N A;  4GC0 A;  5A2O A;  2B8U A;  1Y6N L;  2O27 A;  3NCB A;  1YKB A;  4O6K A;  1SCF A;  3HOY D;  2OQP A;  4JRE A;  5D59 A;  4YDY I;  5C3E D;  1M4R A;  5E4E A;  1F45 B;  5C7X A;  3DLQ I;  2R93 D;  3UF2 A;  3WDO A;  3L5W I;  3H0G D;  3Q1S I;  1AX8 A;  1M4C A;  2Q98 A;  4NKQ C;  2B5I A;  4A3L D;  2JA6 D;  3HOZ D;  4A93 D;  3INK C;  3OG4 A;  4LRL A;  5KNH I;  4A3G D;  3HOV D;  1RFB A;  1M49 A;  4D2D A;  4XNJ A;  1AXI A;  4JR9 A;  3QB7 A;  4YQX A;  5C44 D;  2IL6 A;  2VUM D;  4A3F D;  4PYP A;  2JA5 D;  4IU9 A;  4A3D D;  5GXB A;  4ZW9 A;  4DKC A;  4D2C A;  4A3C D;  2CFP A;  3HHC A;  1I1R B;  4IKX A;  4BBS D;  1EXZ A;  3I4N D;  4A3E D;  4TPH A;  2Z3Q A;  1PW6 A;  2JA7 D;  1BBN A;  5FHX A;  1VLK A;  1IL6 A;  2L3Y A;  4IKV A;  3NCC A;  3D85 C;  1HUW A;  4YBQ A;  1IAR A;  1M4A A;  1P9M B; 
#chains in the Genus database with same CATH homology
 1HWG A;  2INT A;  1FYH A;  1V7M V;  2R7Z D;  2HYM B;  5C7X A;  3DLQ I;  3OQ3 A;  2R93 D;  1CYL A;  4RS1 A;  3D87 A;  3QAZ A;  5TS9 A;  2H24 A;  1ILK A;  1Z92 A;  3G6D A;  1Y6K L;  3QB1 A;  1LQS L;  4Z5R D;  4BY1 D;  3UF2 A;  5LQB A;  1WU3 I;  5IYD D;  4J4L C;  2O6I A;  3UX9 A;  2B8Y A;  4GRW A;  4A3I D;  3L5W I;  3H0G D;  3Q1S I;  1HIK A;  1AX8 A;  1M4C A;  1GA3 A;  1Y6M L;  4WRL B;  2Q98 A;  3VA2 A;  1ALU A;  2LAG A;  4NKQ C;  4A3B D;  2B63 D;  1CNT 1;  2O26 A;  3UEZ E;  4MHL A;  2B5I A;  2B91 A;  3MZG A;  2JA6 D;  4X51 A;  2C35 A;  4A3L D;  3DI2 A;  2D9Q A;  2JA8 D;  3HOZ D;  4DOH A;  4BXX D;  4A93 D;  1PGR A;  3INK C;  5L6Y C;  1HZI A;  2PSM A;  3D48 P;  1WCM D;  3AYH A;  2ERJ D;  1ITM A;  3QT2 C;  5IP9 D;  3OG4 A;  4LRL A;  2D48 A;  3FKI D;  3PO2 D;  1AU1 A;  3SE3 B;  1IJZ A;  1CD9 A;  1CN4 C;  3BPN A;  5KNH I;  4BBR D;  3HOX D;  3HOW D;  4A3G D;  3HOV D;  1RFB A;  1M49 A;  2Z3R A;  1EMR A;  1BP3 A;  1J7V L;  3L5X A;  3EJJ A;  5IYC D;  1AXI A;  1N1F A;  2B8Z A;  1JLI A;  3QB7 A;  3SE4 B;  3N0P A;  4YQX A;  4A3M D;  1BGE A;  1BUY A;  1IK0 A;  5C4X D;  1EKU A;  1ITL A;  2GMF A;  5C44 D;  2IL6 A;  1A22 A;  1BGC A;  5FUC A;  1Y1W D;  4A3K D;  2VUM D;  1CSG A;  5IYB D;  3HOU D;  2B90 A;  4A3F D;  3DUH C;  1M4B A;  4YPG C;  1Y1V D;  3WCY I;  4NEJ A;  5D22 A;  1D9C A;  4NN5 A;  3BES L;  1EVS A;  2LMS A;  1D9G A;  2JA5 D;  4A3D D;  4DKF A;  4GS7 A;  1ITF A;  4CNI C;  2L3O A;  1F6F A;  2E9W C;  1HWH A;  3DI3 A;  1RCB A;  4O9H A;  4DKC A;  1ETE A;  5D71 A;  3PIV A;  4A3C D;  3UF5 A;  1FG9 A;  3LB6 B;  3HHC A;  5D72 A;  1KF9 A;  1I1R B;  4DKD A;  1NBP A;  2ILK A;  1B5L A;  1EER A;  2KZ1 A;  4FA8 E;  3EW3 A;  3NPZ A;  1GNC A;  4BBS D;  3S9D A;  1HUL A;  3LB6 A;  3B5K A;  4BY7 D;  3NCE A;  1EXZ A;  3HMX B;  4A3E D;  3BPO A;  4YUE C;  4EXP A;  1IRL A;  3H3V E;  1Z7C A;  2B8X A;  3I4N D;  3HHR A;  3I4M D;  1HIJ A;  3IRH A;  4EXN A;  4NN6 A;  4I77 Z;  4NI9 A;  5D70 A;  5IP7 D;  3NCF A;  1ITI A;  3DGC L;  1RHG A;  3N06 A;  1A7M A;  1PY2 A;  3BPL A;  2Q7N B;  1M48 A;  4ZS7 A;  2XQB A;  1QVN A;  2Z3Q A;  1PW6 A;  4A3J D;  2JA7 D;  1BBN A;  5FHX A;  1VLK A;  1BGD A;  1LKI A;  1LK3 A;  3TGX B;  1Y14 A;  4NI7 A;  5D28 B;  2Q14 A;  2R92 D;  2B8U A;  1IL6 A;  3PIW A;  1HGU A;  2L3Y A;  1Y6N L;  4ZF7 A;  5FLM D;  4DKE A;  4PS4 A;  1V7N V;  3NCC A;  2O27 A;  1M47 A;  1PVH B;  2CYK A;  3NCB A;  1YKB A;  3D85 C;  4NEM A;  4O6K A;  1HUW A;  1SCF A;  3G9V B;  3HOY D;  2OQP A;  3PO3 D;  1INR A;  1IAR A;  1M4A A;  1P9M B;  4YDY I;  4NN7 A;  3OG6 A;  3QWR B;  5C3E D;  1BCN A;  1M4R A;  5E4E A;  1F45 B;  1RW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...