2ILKA

Crystal structure of human interleukin-10 at 1.6 angstroms resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
TQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.
pubmed rcsb
molecule keywords INTERLEUKIN-10
molecule tags Cytokine
source organism Homo sapiens
total genus 53
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 1996-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 2ilkA00
1CNT1 1ILKA 1INRA 2ILKA 1BGDA 1HWHA 1EERA 3HMXB 3QT2C 1VLKA 3QWRB 1FYHA 1BP3A 1PVHB 2D48A 3VA2A 4DOHA 2O27A 1YKBA 1HIKA 3BPNA 3QB7A 4NKQC 4X51A 1M4RA 3LB6A 2LMSA 3D87A 1Z92A 1Y6NL 2E9WC 1M4AA 3SE4B 1F45B 1ITFA 5FHXA 1GNCA 5D22A 1IARA 4FA8E 1IK0A 1PW6A 2B8ZA 3LB6B 1BGCA 3NCBA 1HUWA 1CD9A 1Z7CA 2B8UA 1FG9A 4Z5RD 1EXZA 5D71A 1AX8A 1N1FA 2D9QA 1CYLA 1ETEA 2B8YA 1M4BA 4YDYI 1EKUA 3DLQI 3NCFA 1Y6ML 3NPZA 1RHGA 3D48P 2INTA 1M49A 4O9HA 1KF9A 4WRLB 1A7MA 2LAGA 2IL6A 1Y6KL 1ALUA 1JLIA 2L3OA 3B5KA 5E4EA 3UX9A 1D9CA 1V7MV 3D85C 3N06A 3PIWA 5LQBA 1PY2A 3OQ3A 1A22A 2O26A 1J7VL 1EVSA 4PS4A 4ZF7A 2B90A 1RCBA 4J4LC 4NI7A 1ITLA 3WCYI 1BGEA 1HGUA 3QAZA 3BPLA 1B5LA 3EW3A 3G9VB 1GA3A 1EMRA 2Q7NB 1HIJA 3INKC 4YUEC 3SE3B 3N0PA 1CN4C 1NBPA 1IL6A 4GRWA 1M48A 3UEZE 3HHRA 1P9MB 5C7XA 4NEMA 1BCNA 1LK3A 1SCFA 2ERJD 1M47A 1RFBA 1HZIA 1I1RB 2GMFA 4O6KA 1HWGA 1LQSL 5D70A 1LKIA 3NCCA 3EJJA 4CNIC 1ITIA 4MHLA 4YPGC 2L3YA 3MZGA 2HYMB 3G6DA 2KZ1A 1BBNA 4RS1A 3BESL 4ZS7A 1IRLA 3UF2A 3Q1SI 1WU3I 4NI9A 3PIVA 1CSGA 2H24A 1PGRA 1IJZA 1BUYA 3BPOA 3QB1A 3L5XA 3L5WI 1M4CA 5KNHI 5D28B 5L6YC 3S9DA 1HULA 2B91A 2B5IA 1D9GA 1AU1A 2CYKA 3DUHC 1V7NV 1AXIA 1QVNA 1RW5A 4YQXA 1ITMA 2Q98A 5D72A 4I77Z 5FUCA 3UF5A 3NCEA 1F6FA 3DGCL 4NEJA 2B8XA
chains in the Genus database with same CATH superfamily
1Y1VD 2ILKA 1EERA 4W6VA 3QT2C 1VLKA 1BP3A 1YKBA 3BPNA 4NKQC 1M4RA 3LB6A 5IYBD 3WDOA 1PV7A 3D87A 1F45B 2R93D 5FHXA 3HOUD 1IK0A 2B8ZA 3NCBA 2PSMA 5D71A 1Y14A 2JA8D 1CYLA 1M4BA 4YDYI 1EKUA 4GS7A 1Y6ML 4A3CD 3D48P 1M49A 1KF9A 2VUMD 1ALUA 5C44D 5D58A 3DI2A 4ZWCA 4PS4A 1ITLA 3EW3A 4JR9A 1GA3A 1HIJA 3O7PA 4OAAA 4YBQA 2O6IA 4GRWA 1M48A 4ZWBA 3HHRA 1P9MB 4A3KD 2ERJD 1SCFA 1RFBA 1HWGA 3I4ND 4YPGC 3MZGA 3DI3A 4EXPA 3L5XA 3L5WI 5EQGA 1AXIA 4YQXA 1ITMA 1F6FA 2B8XA 1ILKA 3HMXB 4JA3A 5FLMD 1FYHA 2D48A 1PVHB 5D6KA 5GXBA 4DOHA 4IU9A 3QB7A 4TPGA 3SE4B 4BY1D 1GNCA 1PW6A 1CD9A 1Z7CA 2B8UA 1AX8A 4BBSD 4A3JD 4A3LD 2XUTA 4PYPA 4UVMA 4YB9D 4IU8A 1Y1WD 2INTA 1A7MA 2LAGA 5IP9D 4IKZA 3UX9A 4D2BA 1D9CA 4JREA 3D85C 4U4VA 5LQBA 4A3MD 1PY2A 3OQ3A 4GC0A 2O26A 1EVSA 2B90A 3QAZA 3BPLA 1EMRA 3SE3B 3HOWD 4A93D 4A3ID 3N0PA 1CN4C 4APSA 1IL6A 4NEMA 5TS9A 1I1RB 2B63D 4O6KA 5D70A 4LDSA 1LKIA 3NCCA 4QIQA 4CNIC 5A2NA 5IP7D 3H0GD 3TGXB 2L3YA 3G6DA 3BESL 1IRLA 2JA6D 2H24A 4A3BD 1IJZA 5D28B 5D59A 3S9DA 2B5IA 2CYKA 4DKDA 2Q14A 5C3ED 1RW5A 4EXNA 5FUCA 5EQHA 3HOVD 4IKWA 4TPJA 4NEJA 1INRA 4NN5A 2XQBA 1HWHA 3QWRB 2O27A 5A2OA 2Y5YA 1Y6NL 4LEPA 4IKYA 4D2CA 1ITFA 5D22A 1IARA 4FA8E 5EQIA 3LB6B 1HUWA 3IRHA 1PW4A 4NN6A 3NPZA 4A3FD 2IL6A 1Y6KL 1JLIA 2Z3QA 3B5KA 1A22A 1J7VL 4IKXA 1RCBA 4J4LC 4D2DA 1HGUA 1B5LA 2C35A 2Q7NB 3INKC 3PO2D 1NBPA 5IYCD 5C7XA 2Z3RA 2JA5D 1LK3A 1M47A 1HZIA 4IKVA 4DKFA 2OQPA 1ITIA 3O7QA 4J05A 1BBNA 4LRLA 3Q1SI 3UF2A 3PIVA 1PGRA 3BPOA 1M4CA 5KNHI 4BXXD 1AU1A 3HOYD 5IYDD 4XNIA 4ZYRA 1QVNA 4OH3A 2Q98A 4I77Z 4A3ED 3NCEA 4DKEA 1CNT1 4BBRD 4GBYA 1BGDA 3OG4A 3VA2A 4A3DD 1HIKA 4X51A 2LMSA 1Z92A 2E9WC 4U4TA 2JA7D 1M4AA 4TPHA 1BGCA 5C4XD 4BY7D 1FG9A 4Z5RD 1EXZA 1N1FA 2D9QA 1ETEA 2B8YA 2CFPA 3DLQI 3NCFA 1RHGA 4WRLB 4O9HA 4ZW9A 2L3OA 5E4EA 1V7MV 3N06A 3PIWA 4GBZA 5C65A 4ZF7A 4NI7A 3WCYI 1BGEA 2R92D 3H3VE 3G9VB 3OG6A 4YUEC 2V8NA 4DKCA 3UEZE 3PO3D 4NN7A 1BCNA 4U4WA 2GMFA 1LQSL 3EJJA 4MHLA 2R7ZD 3I4MD 3HOZD 2HYMB 2KZ1A 3HOXD 3HHCA 4RS1A 4ZS7A 4A3GD 4XNJA 1WU3I 4NI9A 1WCMD 3AYHA 1CSGA 3QB1A 1BUYA 1PV6A 4Q65A 5L6YC 1HULA 2B91A 1D9GA 3FKID 3DUHC 2CFQA 1V7NV 5D72A 3UF5A 3DGCL
chains in the Genus database with same CATH topology
4DKEA 1Y1VD 1CNT1 4BBRD 1ILKA 1INRA 2ILKA 4NN5A 1BGDA 2XQBA 1HWHA 1EERA 3HMXB 3OG4A 3QT2C 1VLKA 5FLMD 3QWRB 1FYHA 1BP3A 1PVHB 2D48A 3VA2A 4A3DD 4DOHA 2O27A 1YKBA 1HIKA 3BPNA 3QB7A 4NKQC 4X51A 1M4RA 3LB6A 5IYBD 2LMSA 3D87A 1Z92A 1Y6NL 2E9WC 2JA7D 1M4AA 3SE4B 1F45B 4BY1D 2R93D 1ITFA 5FHXA 3HOUD 1GNCA 5D22A 1IARA 4FA8E 1IK0A 1PW6A 2B8ZA 3LB6B 1BGCA 3NCBA 1HUWA 1CD9A 1Z7CA 2B8UA 1FG9A 2PSMA 1EXZA 5D71A 1AX8A 4Z5RD 4BY7D 4BBSD 1Y14A 3IRHA 4A3JD 1N1FA 2D9QA 4A3LD 2JA8D 1CYLA 1ETEA 2B8YA 1M4BA 4YDYI 1EKUA 3DLQI 3NCFA 4GS7A 4NN6A 1Y6ML 4A3CD 3NPZA 1RHGA 1Y1WD 3D48P 2INTA 1M49A 4O9HA 1KF9A 4WRLB 1A7MA 4A3FD 2VUMD 2LAGA 2IL6A 5IP9D 1Y6KL 1ALUA 1JLIA 2L3OA 2Z3QA 3B5KA 5E4EA 3UX9A 1D9CA 5C44D 1V7MV 3D85C 3N06A 3PIWA 5LQBA 4A3MD 1PY2A 3OQ3A 1A22A 3DI2A 2O26A 1J7VL 1EVSA 4PS4A 4ZF7A 2B90A 1RCBA 4J4LC 4NI7A 1ITLA 3WCYI 1BGEA 1HGUA 3QAZA 3BPLA 2R92D 3H3VE 1B5LA 2C35A 3EW3A 3G9VB 3OG6A 1GA3A 1EMRA 2Q7NB 1HIJA 3INKC 4YUEC 3SE3B 3HOWD 4A93D 3PO2D 4A3ID 3N0PA 1CN4C 1NBPA 1IL6A 2O6IA 4GRWA 1M48A 3UEZE 4DKCA 5IYCD 3HHRA 1P9MB 5C7XA 4NEMA 3PO3D 4A3KD 4NN7A 2Z3RA 1BCNA 5TS9A 2JA5D 1LK3A 1SCFA 2ERJD 1M47A 1RFBA 1HZIA 1I1RB 2GMFA 2B63D 4O6KA 1HWGA 1LQSL 5D70A 4DKFA 1LKIA 3I4ND 3NCCA 2OQPA 3EJJA 4CNIC 5IP7D 1ITIA 4MHLA 2R7ZD 3H0GD 3I4MD 4YPGC 3TGXB 2L3YA 3MZGA 2HYMB 3HOZD 3G6DA 2KZ1A 3HOXD 3HHCA 1BBNA 4RS1A 3BESL 4ZS7A 4A3GD 1IRLA 4LRLA 3Q1SI 3UF2A 3DI3A 1WU3I 2JA6D 4NI9A 3PIVA 1WCMD 3AYHA 1CSGA 2H24A 1PGRA 4A3BD 1IJZA 1BUYA 3BPOA 3QB1A 4EXPA 3L5XA 3L5WI 1M4CA 5KNHI 5D28B 4BXXD 5L6YC 3S9DA 1HULA 2B91A 2B5IA 1D9GA 1AU1A 3HOYD 5IYDD 3FKID 2CYKA 3DUHC 2Q14A 4DKDA 1V7NV 1AXIA 1QVNA 5C3ED 1RW5A 4YQXA 1ITMA 2Q98A 5D72A 4I77Z 4EXNA 5FUCA 4A3ED 3UF5A 3HOVD 3NCEA 5C4XD 1F6FA 3DGCL 4NEJA 2B8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CNT 1;  1ILK A;  1INR A;  2ILK A;  1BGD A;  1HWH A;  1EER A;  3HMX B;  3QT2 C;  1VLK A;  3QWR B;  1FYH A;  1BP3 A;  1PVH B;  2D48 A;  3VA2 A;  4DOH A;  2O27 A;  1YKB A;  1HIK A;  3BPN A;  3QB7 A;  4NKQ C;  4X51 A;  1M4R A;  3LB6 A;  2LMS A;  3D87 A;  1Z92 A;  1Y6N L;  2E9W C;  1M4A A;  3SE4 B;  1F45 B;  1ITF A;  5FHX A;  1GNC A;  5D22 A;  1IAR A;  4FA8 E;  1IK0 A;  1PW6 A;  2B8Z A;  3LB6 B;  1BGC A;  3NCB A;  1HUW A;  1CD9 A;  1Z7C A;  2B8U A;  1FG9 A;  4Z5R D;  1EXZ A;  5D71 A;  1AX8 A;  1N1F A;  2D9Q A;  1CYL A;  1ETE A;  2B8Y A;  1M4B A;  4YDY I;  1EKU A;  3DLQ I;  3NCF A;  1Y6M L;  3NPZ A;  1RHG A;  3D48 P;  2INT A;  1M49 A;  4O9H A;  1KF9 A;  4WRL B;  1A7M A;  2LAG A;  2IL6 A;  1Y6K L;  1ALU A;  1JLI A;  2L3O A;  3B5K A;  5E4E A;  3UX9 A;  1D9C A;  1V7M V;  3D85 C;  3N06 A;  3PIW A;  5LQB A;  1PY2 A;  3OQ3 A;  1A22 A;  2O26 A;  1J7V L;  1EVS A;  4PS4 A;  4ZF7 A;  2B90 A;  1RCB A;  4J4L C;  4NI7 A;  1ITL A;  3WCY I;  1BGE A;  1HGU A;  3QAZ A;  3BPL A;  1B5L A;  3EW3 A;  3G9V B;  1GA3 A;  1EMR A;  2Q7N B;  1HIJ A;  3INK C;  4YUE C;  3SE3 B;  3N0P A;  1CN4 C;  1NBP A;  1IL6 A;  4GRW A;  1M48 A;  3UEZ E;  3HHR A;  1P9M B;  5C7X A;  4NEM A;  1BCN A;  1LK3 A;  1SCF A;  2ERJ D;  1M47 A;  1RFB A;  1HZI A;  1I1R B;  2GMF A;  4O6K A;  1HWG A;  1LQS L;  5D70 A;  1LKI A;  3NCC A;  3EJJ A;  4CNI C;  1ITI A;  4MHL A;  4YPG C;  2L3Y A;  3MZG A;  2HYM B;  3G6D A;  2KZ1 A;  1BBN A;  4RS1 A;  3BES L;  4ZS7 A;  1IRL A;  3UF2 A;  3Q1S I;  1WU3 I;  4NI9 A;  3PIV A;  1CSG A;  2H24 A;  1PGR A;  1IJZ A;  1BUY A;  3BPO A;  3QB1 A;  3L5X A;  3L5W I;  1M4C A;  5KNH I;  5D28 B;  5L6Y C;  3S9D A;  1HUL A;  2B91 A;  2B5I A;  1D9G A;  1AU1 A;  2CYK A;  3DUH C;  1V7N V;  1AXI A;  1QVN A;  1RW5 A;  4YQX A;  1ITM A;  2Q98 A;  5D72 A;  4I77 Z;  5FUC A;  3UF5 A;  3NCE A;  1F6F A;  3DGC L;  4NEJ A;  2B8X A; 
#chains in the Genus database with same CATH topology
 1Y1V D;  2ILK A;  1EER A;  4W6V A;  3QT2 C;  1VLK A;  1BP3 A;  1YKB A;  3BPN A;  4NKQ C;  1M4R A;  3LB6 A;  5IYB D;  3WDO A;  1PV7 A;  3D87 A;  1F45 B;  2R93 D;  5FHX A;  3HOU D;  1IK0 A;  2B8Z A;  3NCB A;  2PSM A;  5D71 A;  1Y14 A;  2JA8 D;  1CYL A;  1M4B A;  4YDY I;  1EKU A;  4GS7 A;  1Y6M L;  4A3C D;  3D48 P;  1M49 A;  1KF9 A;  2VUM D;  1ALU A;  5C44 D;  5D58 A;  3DI2 A;  4ZWC A;  4PS4 A;  1ITL A;  3EW3 A;  4JR9 A;  1GA3 A;  1HIJ A;  3O7P A;  4OAA A;  4YBQ A;  2O6I A;  4GRW A;  1M48 A;  4ZWB A;  3HHR A;  1P9M B;  4A3K D;  2ERJ D;  1SCF A;  1RFB A;  1HWG A;  3I4N D;  4YPG C;  3MZG A;  3DI3 A;  4EXP A;  3L5X A;  3L5W I;  5EQG A;  1AXI A;  4YQX A;  1ITM A;  1F6F A;  2B8X A;  1ILK A;  3HMX B;  4JA3 A;  5FLM D;  1FYH A;  2D48 A;  1PVH B;  5D6K A;  5GXB A;  4DOH A;  4IU9 A;  3QB7 A;  4TPG A;  3SE4 B;  4BY1 D;  1GNC A;  1PW6 A;  1CD9 A;  1Z7C A;  2B8U A;  1AX8 A;  4BBS D;  4A3J D;  4A3L D;  2XUT A;  4PYP A;  4UVM A;  4YB9 D;  4IU8 A;  1Y1W D;  2INT A;  1A7M A;  2LAG A;  5IP9 D;  4IKZ A;  3UX9 A;  4D2B A;  1D9C A;  4JRE A;  3D85 C;  4U4V A;  5LQB A;  4A3M D;  1PY2 A;  3OQ3 A;  4GC0 A;  2O26 A;  1EVS A;  2B90 A;  3QAZ A;  3BPL A;  1EMR A;  3SE3 B;  3HOW D;  4A93 D;  4A3I D;  3N0P A;  1CN4 C;  4APS A;  1IL6 A;  4NEM A;  5TS9 A;  1I1R B;  2B63 D;  4O6K A;  5D70 A;  4LDS A;  1LKI A;  3NCC A;  4QIQ A;  4CNI C;  5A2N A;  5IP7 D;  3H0G D;  3TGX B;  2L3Y A;  3G6D A;  3BES L;  1IRL A;  2JA6 D;  2H24 A;  4A3B D;  1IJZ A;  5D28 B;  5D59 A;  3S9D A;  2B5I A;  2CYK A;  4DKD A;  2Q14 A;  5C3E D;  1RW5 A;  4EXN A;  5FUC A;  5EQH A;  3HOV D;  4IKW A;  4TPJ A;  4NEJ A;  1INR A;  4NN5 A;  2XQB A;  1HWH A;  3QWR B;  2O27 A;  5A2O A;  2Y5Y A;  1Y6N L;  4LEP A;  4IKY A;  4D2C A;  1ITF A;  5D22 A;  1IAR A;  4FA8 E;  5EQI A;  3LB6 B;  1HUW A;  3IRH A;  1PW4 A;  4NN6 A;  3NPZ A;  4A3F D;  2IL6 A;  1Y6K L;  1JLI A;  2Z3Q A;  3B5K A;  1A22 A;  1J7V L;  4IKX A;  1RCB A;  4J4L C;  4D2D A;  1HGU A;  1B5L A;  2C35 A;  2Q7N B;  3INK C;  3PO2 D;  1NBP A;  5IYC D;  5C7X A;  2Z3R A;  2JA5 D;  1LK3 A;  1M47 A;  1HZI A;  4IKV A;  4DKF A;  2OQP A;  1ITI A;  3O7Q A;  4J05 A;  1BBN A;  4LRL A;  3Q1S I;  3UF2 A;  3PIV A;  1PGR A;  3BPO A;  1M4C A;  5KNH I;  4BXX D;  1AU1 A;  3HOY D;  5IYD D;  4XNI A;  4ZYR A;  1QVN A;  4OH3 A;  2Q98 A;  4I77 Z;  4A3E D;  3NCE A;  4DKE A;  1CNT 1;  4BBR D;  4GBY A;  1BGD A;  3OG4 A;  3VA2 A;  4A3D D;  1HIK A;  4X51 A;  2LMS A;  1Z92 A;  2E9W C;  4U4T A;  2JA7 D;  1M4A A;  4TPH A;  1BGC A;  5C4X D;  4BY7 D;  1FG9 A;  4Z5R D;  1EXZ A;  1N1F A;  2D9Q A;  1ETE A;  2B8Y A;  2CFP A;  3DLQ I;  3NCF A;  1RHG A;  4WRL B;  4O9H A;  4ZW9 A;  2L3O A;  5E4E A;  1V7M V;  3N06 A;  3PIW A;  4GBZ A;  5C65 A;  4ZF7 A;  4NI7 A;  3WCY I;  1BGE A;  2R92 D;  3H3V E;  3G9V B;  3OG6 A;  4YUE C;  2V8N A;  4DKC A;  3UEZ E;  3PO3 D;  4NN7 A;  1BCN A;  4U4W A;  2GMF A;  1LQS L;  3EJJ A;  4MHL A;  2R7Z D;  3I4M D;  3HOZ D;  2HYM B;  2KZ1 A;  3HOX D;  3HHC A;  4RS1 A;  4ZS7 A;  4A3G D;  4XNJ A;  1WU3 I;  4NI9 A;  1WCM D;  3AYH A;  1CSG A;  3QB1 A;  1BUY A;  1PV6 A;  4Q65 A;  5L6Y C;  1HUL A;  2B91 A;  1D9G A;  3FKI D;  3DUH C;  2CFQ A;  1V7N V;  5D72 A;  3UF5 A;  3DGC L; 
#chains in the Genus database with same CATH homology
 4DKE A;  1Y1V D;  1CNT 1;  4BBR D;  1ILK A;  1INR A;  2ILK A;  4NN5 A;  1BGD A;  2XQB A;  1HWH A;  1EER A;  3HMX B;  3OG4 A;  3QT2 C;  1VLK A;  5FLM D;  3QWR B;  1FYH A;  1BP3 A;  1PVH B;  2D48 A;  3VA2 A;  4A3D D;  4DOH A;  2O27 A;  1YKB A;  1HIK A;  3BPN A;  3QB7 A;  4NKQ C;  4X51 A;  1M4R A;  3LB6 A;  5IYB D;  2LMS A;  3D87 A;  1Z92 A;  1Y6N L;  2E9W C;  2JA7 D;  1M4A A;  3SE4 B;  1F45 B;  4BY1 D;  2R93 D;  1ITF A;  5FHX A;  3HOU D;  1GNC A;  5D22 A;  1IAR A;  4FA8 E;  1IK0 A;  1PW6 A;  2B8Z A;  3LB6 B;  1BGC A;  3NCB A;  1HUW A;  1CD9 A;  1Z7C A;  2B8U A;  1FG9 A;  2PSM A;  1EXZ A;  5D71 A;  1AX8 A;  4Z5R D;  4BY7 D;  4BBS D;  1Y14 A;  3IRH A;  4A3J D;  1N1F A;  2D9Q A;  4A3L D;  2JA8 D;  1CYL A;  1ETE A;  2B8Y A;  1M4B A;  4YDY I;  1EKU A;  3DLQ I;  3NCF A;  4GS7 A;  4NN6 A;  1Y6M L;  4A3C D;  3NPZ A;  1RHG A;  1Y1W D;  3D48 P;  2INT A;  1M49 A;  4O9H A;  1KF9 A;  4WRL B;  1A7M A;  4A3F D;  2VUM D;  2LAG A;  2IL6 A;  5IP9 D;  1Y6K L;  1ALU A;  1JLI A;  2L3O A;  2Z3Q A;  3B5K A;  5E4E A;  3UX9 A;  1D9C A;  5C44 D;  1V7M V;  3D85 C;  3N06 A;  3PIW A;  5LQB A;  4A3M D;  1PY2 A;  3OQ3 A;  1A22 A;  3DI2 A;  2O26 A;  1J7V L;  1EVS A;  4PS4 A;  4ZF7 A;  2B90 A;  1RCB A;  4J4L C;  4NI7 A;  1ITL A;  3WCY I;  1BGE A;  1HGU A;  3QAZ A;  3BPL A;  2R92 D;  3H3V E;  1B5L A;  2C35 A;  3EW3 A;  3G9V B;  3OG6 A;  1GA3 A;  1EMR A;  2Q7N B;  1HIJ A;  3INK C;  4YUE C;  3SE3 B;  3HOW D;  4A93 D;  3PO2 D;  4A3I D;  3N0P A;  1CN4 C;  1NBP A;  1IL6 A;  2O6I A;  4GRW A;  1M48 A;  3UEZ E;  4DKC A;  5IYC D;  3HHR A;  1P9M B;  5C7X A;  4NEM A;  3PO3 D;  4A3K D;  4NN7 A;  2Z3R A;  1BCN A;  5TS9 A;  2JA5 D;  1LK3 A;  1SCF A;  2ERJ D;  1M47 A;  1RFB A;  1HZI A;  1I1R B;  2GMF A;  2B63 D;  4O6K A;  1HWG A;  1LQS L;  5D70 A;  4DKF A;  1LKI A;  3I4N D;  3NCC A;  2OQP A;  3EJJ A;  4CNI C;  5IP7 D;  1ITI A;  4MHL A;  2R7Z D;  3H0G D;  3I4M D;  4YPG C;  3TGX B;  2L3Y A;  3MZG A;  2HYM B;  3HOZ D;  3G6D A;  2KZ1 A;  3HOX D;  3HHC A;  1BBN A;  4RS1 A;  3BES L;  4ZS7 A;  4A3G D;  1IRL A;  4LRL A;  3Q1S I;  3UF2 A;  3DI3 A;  1WU3 I;  2JA6 D;  4NI9 A;  3PIV A;  1WCM D;  3AYH A;  1CSG A;  2H24 A;  1PGR A;  4A3B D;  1IJZ A;  1BUY A;  3BPO A;  3QB1 A;  4EXP A;  3L5X A;  3L5W I;  1M4C A;  5KNH I;  5D28 B;  4BXX D;  5L6Y C;  3S9D A;  1HUL A;  2B91 A;  2B5I A;  1D9G A;  1AU1 A;  3HOY D;  5IYD D;  3FKI D;  2CYK A;  3DUH C;  2Q14 A;  4DKD A;  1V7N V;  1AXI A;  1QVN A;  5C3E D;  1RW5 A;  4YQX A;  1ITM A;  2Q98 A;  5D72 A;  4I77 Z;  4EXN A;  5FUC A;  4A3E D;  3UF5 A;  3HOV D;  3NCE A;  5C4X D;  1F6F A;  3DGC L;  4NEJ A;  2B8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...