4J4LC

Modular evolution and design of the protein binding interface
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
155
Chain Sequence
GSLTSSERIDKQIRYILDGISALRKETCNKSNMCENLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNTTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modular evolution and design of the protein binding interface
rcsb
molecule keywords Internalin B,REPEAT MODULES,Variable lymphocyte receptor B
molecule tags Protein binding/cytokine
source organism Listeria monocytogenes
total genus 56
structure length 155
sequence length 168
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 4j4lC00
1EVSA 1I1RB 1P9MB 3EW3A 2KZ1A 1BGDA 2IL6A 3D48P 3UF2A 5E4EA 1HULA 2Q98A 1EMRA 4WRLB 2D9QA 4FA8E 4ZF7A 1Y6KL 3N0PA 1AX8A 1B5LA 1F6FA 1F45B 2LMSA 1IJZA 3DLQI 5D28B 1IARA 1ITMA 1WU3I 1N1FA 4NEMA 1ITFA 4O6KA 3NCEA 2HYMB 2H24A 2LAGA 1A7MA 1ETEA 3G9VB 3QB1A 1BP3A 1AU1A 3BESL 3VA2A 4RS1A 5D70A 1IK0A 3MZGA 3HMXB 1CYLA 1D9GA 1LK3A 2B8XA 1HWHA 2INTA 2GMFA 1NBPA 3SE3B 3OQ3A 1PW6A 3S9DA 1KF9A 3NCCA 4O9HA 1INRA 5D22A 1ILKA 1IRLA 4I77Z 1CSGA 4YQXA 2E9WC 1HUWA 1M4RA 3BPLA 3NCBA 1GA3A 1GNCA 1QVNA 1ITIA 5FHXA 3Q1SI 1ALUA 1Z7CA 2O27A 5C7XA 4DOHA 2O26A 3L5WI 2B5IA 4Z5RD 1BCNA 1J7VL 3B5KA 1M48A 1M4AA 1RFBA 1BGCA 3EJJA 1IL6A 4YUEC 3SE4B 3QB7A 4CNIC 2ILKA 1M4BA 1ITLA 2B8ZA 1VLKA 1HWGA 1HIKA 1M49A 3NCFA 3WCYI 4NKQC 2CYKA 3HHRA 1M47A 1Z92A 3G6DA 1M4CA 3INKC 3PIVA 1SCFA 1BBNA 1CNT1 1HGUA 3PIWA 4X51A 1RHGA 1LKIA 1AXIA 3BPNA 1Y6ML 2B8YA 1D9CA 1BUYA 2B91A 1A22A 5KNHI 4MHLA 3UX9A 1JLIA 3DGCL 2ERJD 1RW5A 3LB6A 4YDYI 1PY2A 2Q7NB 4PS4A 2B8UA 1HIJA 1V7MV 4J4LC 3D87A 3DUHC 1EERA 3LB6B 5LQBA 3N06A 3QT2C 1CD9A 1BGEA 1HZIA 3UF5A 3QAZA 5D71A 3QWRB 1FG9A 1YKBA 1PGRA 3L5XA 4NEJA 5FUCA 4NI7A 4YPGC 1RCBA 2B90A 1Y6NL 1EKUA 1LQSL 4ZS7A 2D48A 5L6YC 2L3YA 1V7NV 3D85C 1FYHA 3BPOA 3UEZE 4NI9A 2L3OA 1EXZA 5D72A 1CN4C 1PVHB 3NPZA 4GRWA
chains in the Genus database with same CATH superfamily
2Z3RA 1I1RB 4DKFA 4IKVA 1EMRA 2PSMA 2D9QA 4FA8E 4ZWBA 4TPHA 5D28B 1ITMA 4APSA 4GBYA 4O6KA 2HYMB 2LAGA 4A3ED 1BP3A 3FKID 3DI3A 1Y1VD 1PV6A 3WDOA 3HHCA 3S9DA 5IYDD 1INRA 1IRLA 3I4ND 3BPLA 4QIQA 5IYCD 1Z7CA 5C7XA 5EQHA 2JA7D 2XQBA 1BCNA 4Q65A 3EJJA 1IL6A 2ILKA 4PYPA 1M4BA 3NCFA 3WCYI 1Z92A 1M4CA 4YB9D 4X51A 4IU9A 5KNHI 3UX9A 4D2DA 4OAAA 3LB6A 2Q7NB 2B8UA 4OH3A 1EERA 3HOUD 3N06A 4U4VA 3HOZD 3L5XA 4NEJA 1RCBA 4A3MD 2B90A 1Y6NL 4NN6A 1EKUA 2D48A 2L3YA 4NI9A 1FYHA 3BPOA 2L3OA 1EXZA 4U4WA 1CN4C 3NPZA 5D58A 4GRWA 1EVSA 2KZ1A 1BGDA 2IL6A 3D48P 4JR9A 5E4EA 3UF2A 2Q98A 2JA6D 2Z3QA 1Y6KL 4A3CD 2R92D 1IJZA 3DLQI 1IARA 4UVMA 1N1FA 1ITFA 2H24A 3QB1A 4GS7A 3BESL 3VA2A 1IK0A 1D9GA 2CFPA 2B8XA 4JA3A 1Y1WD 4BY7D 4J05A 4TPGA 5D22A 1ILKA 5IYBD 4DKCA 4YQXA 1HUWA 1GNCA 1ITIA 1ALUA 2B5IA 4Z5RD 3B5KA 1M48A 4YUEC 1BGCA 4D2BA 4A3DD 4DKDA 1VLKA 1HIKA 4NN7A 4NKQC 3HHRA 4IKXA 3HOXD 1WCMD 1Y6ML 4IU8A 3DGCL 4YBQA 4GC0A 1HIJA 1V7MV 5EQIA 3D87A 3DUHC 4EXNA 3I4MD 2B63D 3DI2A 4DKEA 5LQBA 1Y14A 3QT2C 4A93D 3QWRB 4LRLA 3H3VE 5EQGA 4A3LD 5FUCA 3IRHA 4ZS7A 3D85C 3UEZE 1PVHB 2C35A 1P9MB 3EW3A 1HULA 4ZF7A 1B5LA 1F6FA 1F45B 5D59A 4U4TA 4A3GD 3NCEA 1A7MA 2R93D 1ETEA 3OG4A 1AU1A 4D2CA 4RS1A 5A2OA 4ZWCA 5D70A 3MZGA 1CYLA 1HWHA 2INTA 3SE3B 3OQ3A 1PW6A 3NCCA 4A3FD 4I77Z 5TS9A 1CSGA 2E9WC 4A3KD 1QVNA 5FHXA 3Q1SI 3TGXB 2O27A 2O26A 3L5WI 4TPJA 1RFBA 1M4AA 3SE4B 4CNIC 4GBZA 1ITLA 5IP7D 3G6DA 5C4XD 1SCFA 1CNT1 1HGUA 3PO3D 5C65A 1AXIA 3BPNA 2B8YA 1D9CA 3HOYD 2B91A 1JLIA 5A2NA 1PY2A 4A3BD 2R7ZD 4J4LC 5IP9D 4BXXD 1CD9A 1BGEA 1PGRA 4YPGC 2CFQA 4XNIA 1LQSL 5L6YC 1V7NV 4BBRD 2JA5D 4LDSA 3H0GD 4BY1D 4IKWA 4W6VA 4WRLB 4NN5A 4ZW9A 2Q14A 3N0PA 1AX8A 2LMSA 1WU3I 4NEMA 4IKYA 3G9VB 4A3JD 3HMXB 1LK3A 2O6IA 2GMFA 1NBPA 1KF9A 4O9HA 3HOVD 4LEPA 1M4RA 3NCBA 1GA3A 4XNJA 3AYHA 4DOHA 1J7VL 5C3ED 3QB7A 2B8ZA 1HWGA 5GXBA 2Y5YA 1M49A 4ZYRA 2CYKA 1M47A 4EXPA 3O7PA 3O7QA 3INKC 3PIVA 2VUMD 1BBNA 3PIWA 1RHGA 1LKIA 2XUTA 5D6KA 1BUYA 2V8NA 4BBSD 1A22A 5FLMD 4MHLA 2ERJD 1RW5A 4YDYI 3OG6A 4PS4A 3HOWD 4IKZA 5C44D 1PW4A 3LB6B 3UF5A 1HZIA 3QAZA 5D71A 1FG9A 1YKBA 4JREA 2JA8D 4NI7A 2OQPA 4A3ID 5D72A 3PO2D 1PV7A
chains in the Genus database with same CATH topology
2Z3RA 1EVSA 1I1RB 1P9MB 3EW3A 2KZ1A 4DKFA 4BY1D 1BGDA 2IL6A 3D48P 3UF2A 5E4EA 1HULA 2Q98A 2JA6D 1EMRA 2PSMA 4WRLB 2D9QA 4NN5A 2Z3QA 4FA8E 4ZF7A 1Y6KL 2Q14A 3N0PA 1AX8A 1B5LA 4A3CD 1F6FA 1F45B 2LMSA 2R92D 1IJZA 3DLQI 5D28B 1IARA 1ITMA 1WU3I 1N1FA 4NEMA 4A3GD 1ITFA 4O6KA 3NCEA 2HYMB 2H24A 2LAGA 1A7MA 4A3ED 2R93D 1ETEA 3G9VB 4A3JD 3QB1A 4GS7A 1BP3A 1AU1A 3BESL 3OG4A 3FKID 4RS1A 3VA2A 3DI3A 5D70A 1IK0A 3MZGA 3HMXB 1CYLA 1D9GA 1LK3A 2B8XA 1Y1VD 2O6IA 1HWHA 2INTA 2GMFA 1NBPA 1Y1WD 3HHCA 3SE3B 3OQ3A 4BY7D 1PW6A 3S9DA 1KF9A 3NCCA 4O9HA 5IYDD 4A3FD 1INRA 3HOVD 5D22A 1ILKA 1IRLA 4I77Z 5IYBD 5TS9A 4DKCA 1CSGA 4YQXA 2E9WC 3I4ND 1HUWA 1M4RA 3BPLA 3NCBA 4A3KD 1GA3A 1QVNA 1GNCA 1ITIA 5FHXA 3Q1SI 1ALUA 3AYHA 5IYCD 3TGXB 1Z7CA 2O27A 5C7XA 4DOHA 2O26A 3L5WI 2JA7D 2B5IA 2XQBA 4Z5RD 1BCNA 1J7VL 3B5KA 1M48A 1M4AA 1RFBA 1BGCA 3EJJA 1IL6A 4YUEC 3SE4B 3QB7A 4CNIC 5C3ED 2ILKA 4A3DD 1M4BA 1ITLA 4DKDA 2B8ZA 1VLKA 1HWGA 1HIKA 1M49A 3NCFA 3WCYI 4NN7A 4NKQC 5IP7D 2CYKA 3HHRA 1M47A 4EXPA 1Z92A 3G6DA 1M4CA 3INKC 3HOXD 3PIVA 2VUMD 5C4XD 1SCFA 1BBNA 1WCMD 1CNT1 1HGUA 3PIWA 4X51A 1RHGA 3PO3D 1LKIA 1AXIA 3BPNA 1Y6ML 2B8YA 1D9CA 1BUYA 3HOYD 2B91A 1A22A 5KNHI 5FLMD 4MHLA 3UX9A 1JLIA 4BBSD 3DGCL 2ERJD 1RW5A 3LB6A 4YDYI 3OG6A 1PY2A 2Q7NB 4A3BD 4PS4A 3HOWD 2B8UA 1HIJA 1V7MV 2R7ZD 4J4LC 5IP9D 5C44D 4BXXD 3D87A 3DUHC 1EERA 3LB6B 4EXNA 3I4MD 3HOUD 3DI2A 2B63D 4DKEA 5LQBA 3N06A 1Y14A 3QT2C 1CD9A 1BGEA 1HZIA 3UF5A 4A93D 3QAZA 5D71A 3QWRB 1FG9A 4LRLA 3H3VE 1YKBA 3HOZD 4A3LD 1PGRA 3L5XA 4NEJA 5FUCA 2JA8D 4NI7A 4YPGC 1RCBA 2OQPA 2B90A 4A3ID 4A3MD 1Y6NL 4NN6A 1EKUA 1LQSL 3IRHA 2D48A 4ZS7A 5L6YC 2L3YA 1V7NV 3D85C 1FYHA 3BPOA 3UEZE 4NI9A 2L3OA 4BBRD 1EXZA 5D72A 1CN4C 2JA5D 1PVHB 3NPZA 3H0GD 3PO2D 2C35A 4GRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EVS A;  1I1R B;  1P9M B;  3EW3 A;  2KZ1 A;  1BGD A;  2IL6 A;  3D48 P;  3UF2 A;  5E4E A;  1HUL A;  2Q98 A;  1EMR A;  4WRL B;  2D9Q A;  4FA8 E;  4ZF7 A;  1Y6K L;  3N0P A;  1AX8 A;  1B5L A;  1F6F A;  1F45 B;  2LMS A;  1IJZ A;  3DLQ I;  5D28 B;  1IAR A;  1ITM A;  1WU3 I;  1N1F A;  4NEM A;  1ITF A;  4O6K A;  3NCE A;  2HYM B;  2H24 A;  2LAG A;  1A7M A;  1ETE A;  3G9V B;  3QB1 A;  1BP3 A;  1AU1 A;  3BES L;  3VA2 A;  4RS1 A;  5D70 A;  1IK0 A;  3MZG A;  3HMX B;  1CYL A;  1D9G A;  1LK3 A;  2B8X A;  1HWH A;  2INT A;  2GMF A;  1NBP A;  3SE3 B;  3OQ3 A;  1PW6 A;  3S9D A;  1KF9 A;  3NCC A;  4O9H A;  1INR A;  5D22 A;  1ILK A;  1IRL A;  4I77 Z;  1CSG A;  4YQX A;  2E9W C;  1HUW A;  1M4R A;  3BPL A;  3NCB A;  1GA3 A;  1GNC A;  1QVN A;  1ITI A;  5FHX A;  3Q1S I;  1ALU A;  1Z7C A;  2O27 A;  5C7X A;  4DOH A;  2O26 A;  3L5W I;  2B5I A;  4Z5R D;  1BCN A;  1J7V L;  3B5K A;  1M48 A;  1M4A A;  1RFB A;  1BGC A;  3EJJ A;  1IL6 A;  4YUE C;  3SE4 B;  3QB7 A;  4CNI C;  2ILK A;  1M4B A;  1ITL A;  2B8Z A;  1VLK A;  1HWG A;  1HIK A;  1M49 A;  3NCF A;  3WCY I;  4NKQ C;  2CYK A;  3HHR A;  1M47 A;  1Z92 A;  3G6D A;  1M4C A;  3INK C;  3PIV A;  1SCF A;  1BBN A;  1CNT 1;  1HGU A;  3PIW A;  4X51 A;  1RHG A;  1LKI A;  1AXI A;  3BPN A;  1Y6M L;  2B8Y A;  1D9C A;  1BUY A;  2B91 A;  1A22 A;  5KNH I;  4MHL A;  3UX9 A;  1JLI A;  3DGC L;  2ERJ D;  1RW5 A;  3LB6 A;  4YDY I;  1PY2 A;  2Q7N B;  4PS4 A;  2B8U A;  1HIJ A;  1V7M V;  4J4L C;  3D87 A;  3DUH C;  1EER A;  3LB6 B;  5LQB A;  3N06 A;  3QT2 C;  1CD9 A;  1BGE A;  1HZI A;  3UF5 A;  3QAZ A;  5D71 A;  3QWR B;  1FG9 A;  1YKB A;  1PGR A;  3L5X A;  4NEJ A;  5FUC A;  4NI7 A;  4YPG C;  1RCB A;  2B90 A;  1Y6N L;  1EKU A;  1LQS L;  4ZS7 A;  2D48 A;  5L6Y C;  2L3Y A;  1V7N V;  3D85 C;  1FYH A;  3BPO A;  3UEZ E;  4NI9 A;  2L3O A;  1EXZ A;  5D72 A;  1CN4 C;  1PVH B;  3NPZ A;  4GRW A; 
#chains in the Genus database with same CATH topology
 2Z3R A;  1I1R B;  4DKF A;  4IKV A;  1EMR A;  2PSM A;  2D9Q A;  4FA8 E;  4ZWB A;  4TPH A;  5D28 B;  1ITM A;  4APS A;  4GBY A;  4O6K A;  2HYM B;  2LAG A;  4A3E D;  1BP3 A;  3FKI D;  3DI3 A;  1Y1V D;  1PV6 A;  3WDO A;  3HHC A;  3S9D A;  5IYD D;  1INR A;  1IRL A;  3I4N D;  3BPL A;  4QIQ A;  5IYC D;  1Z7C A;  5C7X A;  5EQH A;  2JA7 D;  2XQB A;  1BCN A;  4Q65 A;  3EJJ A;  1IL6 A;  2ILK A;  4PYP A;  1M4B A;  3NCF A;  3WCY I;  1Z92 A;  1M4C A;  4YB9 D;  4X51 A;  4IU9 A;  5KNH I;  3UX9 A;  4D2D A;  4OAA A;  3LB6 A;  2Q7N B;  2B8U A;  4OH3 A;  1EER A;  3HOU D;  3N06 A;  4U4V A;  3HOZ D;  3L5X A;  4NEJ A;  1RCB A;  4A3M D;  2B90 A;  1Y6N L;  4NN6 A;  1EKU A;  2D48 A;  2L3Y A;  4NI9 A;  1FYH A;  3BPO A;  2L3O A;  1EXZ A;  4U4W A;  1CN4 C;  3NPZ A;  5D58 A;  4GRW A;  1EVS A;  2KZ1 A;  1BGD A;  2IL6 A;  3D48 P;  4JR9 A;  5E4E A;  3UF2 A;  2Q98 A;  2JA6 D;  2Z3Q A;  1Y6K L;  4A3C D;  2R92 D;  1IJZ A;  3DLQ I;  1IAR A;  4UVM A;  1N1F A;  1ITF A;  2H24 A;  3QB1 A;  4GS7 A;  3BES L;  3VA2 A;  1IK0 A;  1D9G A;  2CFP A;  2B8X A;  4JA3 A;  1Y1W D;  4BY7 D;  4J05 A;  4TPG A;  5D22 A;  1ILK A;  5IYB D;  4DKC A;  4YQX A;  1HUW A;  1GNC A;  1ITI A;  1ALU A;  2B5I A;  4Z5R D;  3B5K A;  1M48 A;  4YUE C;  1BGC A;  4D2B A;  4A3D D;  4DKD A;  1VLK A;  1HIK A;  4NN7 A;  4NKQ C;  3HHR A;  4IKX A;  3HOX D;  1WCM D;  1Y6M L;  4IU8 A;  3DGC L;  4YBQ A;  4GC0 A;  1HIJ A;  1V7M V;  5EQI A;  3D87 A;  3DUH C;  4EXN A;  3I4M D;  2B63 D;  3DI2 A;  4DKE A;  5LQB A;  1Y14 A;  3QT2 C;  4A93 D;  3QWR B;  4LRL A;  3H3V E;  5EQG A;  4A3L D;  5FUC A;  3IRH A;  4ZS7 A;  3D85 C;  3UEZ E;  1PVH B;  2C35 A;  1P9M B;  3EW3 A;  1HUL A;  4ZF7 A;  1B5L A;  1F6F A;  1F45 B;  5D59 A;  4U4T A;  4A3G D;  3NCE A;  1A7M A;  2R93 D;  1ETE A;  3OG4 A;  1AU1 A;  4D2C A;  4RS1 A;  5A2O A;  4ZWC A;  5D70 A;  3MZG A;  1CYL A;  1HWH A;  2INT A;  3SE3 B;  3OQ3 A;  1PW6 A;  3NCC A;  4A3F D;  4I77 Z;  5TS9 A;  1CSG A;  2E9W C;  4A3K D;  1QVN A;  5FHX A;  3Q1S I;  3TGX B;  2O27 A;  2O26 A;  3L5W I;  4TPJ A;  1RFB A;  1M4A A;  3SE4 B;  4CNI C;  4GBZ A;  1ITL A;  5IP7 D;  3G6D A;  5C4X D;  1SCF A;  1CNT 1;  1HGU A;  3PO3 D;  5C65 A;  1AXI A;  3BPN A;  2B8Y A;  1D9C A;  3HOY D;  2B91 A;  1JLI A;  5A2N A;  1PY2 A;  4A3B D;  2R7Z D;  4J4L C;  5IP9 D;  4BXX D;  1CD9 A;  1BGE A;  1PGR A;  4YPG C;  2CFQ A;  4XNI A;  1LQS L;  5L6Y C;  1V7N V;  4BBR D;  2JA5 D;  4LDS A;  3H0G D;  4BY1 D;  4IKW A;  4W6V A;  4WRL B;  4NN5 A;  4ZW9 A;  2Q14 A;  3N0P A;  1AX8 A;  2LMS A;  1WU3 I;  4NEM A;  4IKY A;  3G9V B;  4A3J D;  3HMX B;  1LK3 A;  2O6I A;  2GMF A;  1NBP A;  1KF9 A;  4O9H A;  3HOV D;  4LEP A;  1M4R A;  3NCB A;  1GA3 A;  4XNJ A;  3AYH A;  4DOH A;  1J7V L;  5C3E D;  3QB7 A;  2B8Z A;  1HWG A;  5GXB A;  2Y5Y A;  1M49 A;  4ZYR A;  2CYK A;  1M47 A;  4EXP A;  3O7P A;  3O7Q A;  3INK C;  3PIV A;  2VUM D;  1BBN A;  3PIW A;  1RHG A;  1LKI A;  2XUT A;  5D6K A;  1BUY A;  2V8N A;  4BBS D;  1A22 A;  5FLM D;  4MHL A;  2ERJ D;  1RW5 A;  4YDY I;  3OG6 A;  4PS4 A;  3HOW D;  4IKZ A;  5C44 D;  1PW4 A;  3LB6 B;  3UF5 A;  1HZI A;  3QAZ A;  5D71 A;  1FG9 A;  1YKB A;  4JRE A;  2JA8 D;  4NI7 A;  2OQP A;  4A3I D;  5D72 A;  3PO2 D;  1PV7 A; 
#chains in the Genus database with same CATH homology
 2Z3R A;  1EVS A;  1I1R B;  1P9M B;  3EW3 A;  2KZ1 A;  4DKF A;  4BY1 D;  1BGD A;  2IL6 A;  3D48 P;  3UF2 A;  5E4E A;  1HUL A;  2Q98 A;  2JA6 D;  1EMR A;  2PSM A;  4WRL B;  2D9Q A;  4NN5 A;  2Z3Q A;  4FA8 E;  4ZF7 A;  1Y6K L;  2Q14 A;  3N0P A;  1AX8 A;  1B5L A;  4A3C D;  1F6F A;  1F45 B;  2LMS A;  2R92 D;  1IJZ A;  3DLQ I;  5D28 B;  1IAR A;  1ITM A;  1WU3 I;  1N1F A;  4NEM A;  4A3G D;  1ITF A;  4O6K A;  3NCE A;  2HYM B;  2H24 A;  2LAG A;  1A7M A;  4A3E D;  2R93 D;  1ETE A;  3G9V B;  4A3J D;  3QB1 A;  4GS7 A;  1BP3 A;  1AU1 A;  3BES L;  3OG4 A;  3FKI D;  4RS1 A;  3VA2 A;  3DI3 A;  5D70 A;  1IK0 A;  3MZG A;  3HMX B;  1CYL A;  1D9G A;  1LK3 A;  2B8X A;  1Y1V D;  2O6I A;  1HWH A;  2INT A;  2GMF A;  1NBP A;  1Y1W D;  3HHC A;  3SE3 B;  3OQ3 A;  4BY7 D;  1PW6 A;  3S9D A;  1KF9 A;  3NCC A;  4O9H A;  5IYD D;  4A3F D;  1INR A;  3HOV D;  5D22 A;  1ILK A;  1IRL A;  4I77 Z;  5IYB D;  5TS9 A;  4DKC A;  1CSG A;  4YQX A;  2E9W C;  3I4N D;  1HUW A;  1M4R A;  3BPL A;  3NCB A;  4A3K D;  1GA3 A;  1QVN A;  1GNC A;  1ITI A;  5FHX A;  3Q1S I;  1ALU A;  3AYH A;  5IYC D;  3TGX B;  1Z7C A;  2O27 A;  5C7X A;  4DOH A;  2O26 A;  3L5W I;  2JA7 D;  2B5I A;  2XQB A;  4Z5R D;  1BCN A;  1J7V L;  3B5K A;  1M48 A;  1M4A A;  1RFB A;  1BGC A;  3EJJ A;  1IL6 A;  4YUE C;  3SE4 B;  3QB7 A;  4CNI C;  5C3E D;  2ILK A;  4A3D D;  1M4B A;  1ITL A;  4DKD A;  2B8Z A;  1VLK A;  1HWG A;  1HIK A;  1M49 A;  3NCF A;  3WCY I;  4NN7 A;  4NKQ C;  5IP7 D;  2CYK A;  3HHR A;  1M47 A;  4EXP A;  1Z92 A;  3G6D A;  1M4C A;  3INK C;  3HOX D;  3PIV A;  2VUM D;  5C4X D;  1SCF A;  1BBN A;  1WCM D;  1CNT 1;  1HGU A;  3PIW A;  4X51 A;  1RHG A;  3PO3 D;  1LKI A;  1AXI A;  3BPN A;  1Y6M L;  2B8Y A;  1D9C A;  1BUY A;  3HOY D;  2B91 A;  1A22 A;  5KNH I;  5FLM D;  4MHL A;  3UX9 A;  1JLI A;  4BBS D;  3DGC L;  2ERJ D;  1RW5 A;  3LB6 A;  4YDY I;  3OG6 A;  1PY2 A;  2Q7N B;  4A3B D;  4PS4 A;  3HOW D;  2B8U A;  1HIJ A;  1V7M V;  2R7Z D;  4J4L C;  5IP9 D;  5C44 D;  4BXX D;  3D87 A;  3DUH C;  1EER A;  3LB6 B;  4EXN A;  3I4M D;  3HOU D;  3DI2 A;  2B63 D;  4DKE A;  5LQB A;  3N06 A;  1Y14 A;  3QT2 C;  1CD9 A;  1BGE A;  1HZI A;  3UF5 A;  4A93 D;  3QAZ A;  5D71 A;  3QWR B;  1FG9 A;  4LRL A;  3H3V E;  1YKB A;  3HOZ D;  4A3L D;  1PGR A;  3L5X A;  4NEJ A;  5FUC A;  2JA8 D;  4NI7 A;  4YPG C;  1RCB A;  2OQP A;  2B90 A;  4A3I D;  4A3M D;  1Y6N L;  4NN6 A;  1EKU A;  1LQS L;  3IRH A;  2D48 A;  4ZS7 A;  5L6Y C;  2L3Y A;  1V7N V;  3D85 C;  1FYH A;  3BPO A;  3UEZ E;  4NI9 A;  2L3O A;  4BBR D;  1EXZ A;  5D72 A;  1CN4 C;  2JA5 D;  1PVH B;  3NPZ A;  3H0G D;  3PO2 D;  2C35 A;  4GRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...