1HUWA

The crystal structure of affinity-matured human growth hormone at 2 angstroms resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
191
structure length
166
Chain Sequence
b'FPTIPLSRLADNAWLRADRLNQLAFDTYQEFEEAYIPKEQIHSFWWNPQTSLCPSESIPTPSNKEETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEALLKNYGLLYCFNKDMSKVSTYLRTVQCRSVEGSCGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN GROWTH HORMONE
publication title The crystal structure of affinity-matured human growth hormone at 2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 64
structure length 166
sequence length 191
ec nomenclature
pdb deposition date 1993-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1huwA00
5E4EA 3L5XA 5FUCA 1HWGA 2LMSA 3UF2A 2GMFA 3DLQI 1FG9A 3QB1A 4O9HA 1IL6A 1F45B 2Q98A 2B91A 4I77Z 3SE4B 3WCYI 1BBNA 1AU1A 4O6KA 1FYHA 1BUYA 2B5IA 3BESL 3N0PA 3Q1SI 1HIKA 3UX9A 3G9VB 4Z5RD 1IK0A 3SE3B 4FA8E 1I1RB 1RHGA 3INKC 3D85C 4J4LC 2B8ZA 1RFBA 1RW5A 3BPLA 5LQBA 4YDYI 1Z92A 1M47A 5D28B 1Y6NL 1LQSL 3VA2A 1Z7CA 3NCBA 1EKUA 2B8XA 1ITLA 1J7VL 3QB7A 4WRLB 3S9DA 3D87A 2B8UA 3NCCA 2L3OA 1N1FA 1IRLA 1ETEA 1CSGA 1D9CA 1CNT1 1LK3A 1Y6KL 1P9MB 3NCEA 5D71A 1GA3A 1EVSA 3NCFA 1ILKA 1NBPA 2E9WC 2B90A 1PVHB 3N06A 3PIVA 1YKBA 3EW3A 1M48A 1PY2A 1M49A 2ILKA 1M4BA 3G6DA 1B5LA 4NEMA 1IARA 1ITMA 4YQXA 1HULA 1PGRA 2Q7NB 5D72A 3BPOA 1PW6A 4MHLA 4X51A 5KNHI 1RCBA 4NEJA 2D48A 2L3YA 4GRWA 1EERA 1WU3I 1D9GA 3QT2C 3UEZE 4ZS7A 4CNIC 3LB6B 1VLKA 4PS4A 2D9QA 1HZIA 2O27A 3D48P 1ALUA 3B5KA 1ITIA 3MZGA 3QWRB 1BCNA 1A22A 3UF5A 1KF9A 4DOHA 1IJZA 1CN4C 5L6YC 3OQ3A 1M4RA 1GNCA 1M4AA 1Y6ML 4NKQC 2INTA 2LAGA 1HWHA 1EMRA 2CYKA 3DGCL 1BP3A 5D70A 1HIJA 3LB6A 5D22A 2ERJD 2O26A 3QAZA 1ITFA 1CYLA 1V7MV 3PIWA 1EXZA 5FHXA 1LKIA 1SCFA 1JLIA 1V7NV 1BGCA 1CD9A 4NI7A 1F6FA 3L5WI 1HUWA 1AXIA 2KZ1A 3DUHC 2B8YA 1BGDA 1HGUA 3HHRA 1BGEA 4YUEC 1QVNA 2HYMB 2H24A 2IL6A 4NI9A 3EJJA 1M4CA 1AX8A 4RS1A 4ZF7A 3HMXB 4YPGC 5C7XA 1A7MA 1INRA 3NPZA 3BPNA
chains in the Genus database with same CATH superfamily
4BBSD 2GMFA 4JA3A 5EQIA 3QB1A 4YB9D 2Z3RA 3SE4B 4J05A 4NN6A 1FYHA 1BUYA 1Y1VD 3BESL 3N0PA 3Q1SI 4IU9A 3UX9A 5IYCD 2R93D 3HOZD 1I1RB 4J4LC 4BY7D 2VUMD 1Z92A 2B63D 5D28B 3OG6A 4LEPA 3H0GD 1EKUA 1ITLA 1Y6KL 5D71A 4ZYRA 4BBRD 4A3JD 1PVHB 4EXPA 5A2OA 2L3YA 4NN7A 1D9GA 4U4WA 3HOWD 2O27A 1ALUA 4NN5A 1BCNA 1IJZA 4ZWBA 1GNCA 1M4AA 2INTA 2LAGA 1HWHA 2CYKA 3O7QA 1BP3A 5C65A 3HOUD 3TGXB 1BGCA 1HUWA 3DUHC 4A3MD 1BGEA 4YUEC 4BY1D 2HYMB 3FKID 3EJJA 4RS1A 4YPGC 5EQGA 4XNJA 3BPNA 5E4EA 5FUCA 1HWGA 2Q98A 4I77Z 4W6VA 4O6KA 1HIKA 3INKC 5TS9A 2B8ZA 1RW5A 5A2NA 5LQBA 1Y6NL 1LQSL 5IYBD 1Z7CA 3QB7A 4WRLB 2JA6D 3S9DA 4UVMA 3D87A 4IKYA 3NCCA 1N1FA 1ETEA 1P9MB 1GA3A 4GBYA 4DKEA 1ILKA 1NBPA 2XQBA 3N06A 4A3CD 1M48A 1PY2A 4TPJA 2R92D 3G6DA 1ITMA 2OQPA 4X51A 5KNHI 1RCBA 5EQHA 2JA7D 4U4TA 1EERA 1WU3I 3QT2C 4CNIC 2D9QA 1HZIA 4D2CA 3MZGA 1Y1WD 4JREA 5L6YC 2PSMA 3O7PA 4IKXA 1EMRA 1HIJA 2O26A 1ITFA 1CYLA 1SCFA 1JLIA 2XUTA 2KZ1A 1AXIA 1HGUA 1QVNA 4A3BD 4NI9A 1AX8A 5C3ED 4ZF7A 4DKFA 1PW4A 3OG4A 3L5XA 4A3DD 3UF2A 3DLQI 4IKZA 4A3LD 4DKCA 1IL6A 1F45B 4PYPA 4ZW9A 2B91A 4BXXD 3WCYI 1BBNA 5GXBA 1AU1A 1IK0A 4Z5RD 4FA8E 1RHGA 1RFBA 3PO3D 1M47A 5D6KA 5FLMD 4DKDA 2B8UA 1IRLA 1LK3A 1CSGA 1D9CA 1CNT1 3AYHA 4IKVA 3I4MD 3NCFA 2E9WC 2B90A 2V8NA 4ZWCA 1M49A 5IP9D 1PV7A 5D72A 1PW6A 4MHLA 3DI2A 4OAAA 3UEZE 4ZS7A 4APSA 3LB6B 4A3FD 4GBZA 3UF5A 5IYDD 1KF9A 4TPHA 1Y6ML 2Q14A 5D70A 5D22A 2ERJD 4TPGA 1V7MV 3HOYD 1EXZA 5IP7D 1LKIA 1CD9A 4NI7A 1F6FA 3L5WI 4YBQA 2B8YA 1BGDA 4A3ID 3PO2D 3HHRA 4A3ED 1PV6A 2H24A 2IL6A 2JA8D 4GS7A 5C7XA 1INRA 3NPZA 3HHCA 1WCMD 4A3GD 3H3VE 2LMSA 3HOXD 1FG9A 4U4VA 2O6IA 4O9HA 2B5IA 3G9VB 4IU8A 3SE3B 4Q65A 3D85C 4XNIA 3BPLA 4YDYI 3WDOA 4QIQA 4D2BA 3VA2A 2CFPA 3NCBA 2B8XA 1J7VL 2L3OA 3IRHA 3NCEA 1EVSA 4OH3A 3PIVA 1YKBA 3EW3A 2ILKA 1M4BA 2Y5YA 1B5LA 4NEMA 1IARA 4YQXA 2Q7NB 1HULA 1PGRA 3BPOA 4GC0A 1Y14A 4NEJA 2D48A 2Z3QA 4GRWA 5C4XD 1VLKA 4PS4A 5D58A 3D48P 3B5KA 1ITIA 4A3KD 3QWRB 4LRLA 3DI3A 1A22A 3I4ND 4A93D 4DOHA 1CN4C 4JR9A 3OQ3A 4EXNA 1M4RA 4NKQC 2R7ZD 3DGCL 4LDSA 3LB6A 3QAZA 3HOVD 5D59A 3PIWA 5FHXA 1V7NV 2JA5D 4IKWA 2C35A 5C44D 4D2DA 1M4CA 2CFQA 3HMXB 1A7MA
chains in the Genus database with same CATH topology
3HHCA 5E4EA 1WCMD 3L5XA 5FUCA 4A3GD 1HWGA 3H3VE 2LMSA 4A3DD 3UF2A 4BBSD 3HOXD 2GMFA 3DLQI 4A3LD 1FG9A 4DKCA 3QB1A 2O6IA 4O9HA 1IL6A 1F45B 2Q98A 2B91A 4I77Z 4BXXD 2Z3RA 3SE4B 3WCYI 1BBNA 1AU1A 4NN6A 1FYHA 1BUYA 1Y1VD 2B5IA 3BESL 3N0PA 1HIKA 3Q1SI 3G9VB 4O6KA 4Z5RD 3UX9A 5IYCD 3SE3B 4FA8E 3HOZD 1I1RB 2R93D 1RHGA 3INKC 3D85C 4J4LC 5TS9A 2B8ZA 1RFBA 4BY7D 1RW5A 2VUMD 3BPLA 5LQBA 4YDYI 1Z92A 2B63D 1M47A 5D28B 3PO3D 1Y6NL 1LQSL 3OG6A 3H0GD 3VA2A 5IYBD 1Z7CA 3NCBA 1EKUA 2B8XA 1ITLA 1J7VL 3QB7A 4WRLB 2JA6D 3S9DA 5FLMD 3D87A 4DKDA 2B8UA 3NCCA 2L3OA 1N1FA 1IRLA 1ETEA 1CSGA 1D9CA 1CNT1 1LK3A 1Y6KL 1P9MB 3AYHA 3IRHA 3NCEA 5D71A 4BBRD 1GA3A 1EVSA 3I4MD 3NCFA 4DKEA 1ILKA 1NBPA 2E9WC 4A3JD 2B90A 2XQBA 1PVHB 3N06A 3PIVA 1YKBA 3EW3A 4A3CD 1M48A 1PY2A 1M49A 2ILKA 2R92D 4EXPA 1M4BA 5IP9D 3G6DA 1B5LA 4NEMA 1IARA 1ITMA 4YQXA 1HULA 1PGRA 2Q7NB 5D72A 3BPOA 1PW6A 4MHLA 2OQPA 4X51A 5KNHI 1RCBA 1Y14A 4NEJA 3DI2A 2D48A 2JA7D 2L3YA 2Z3QA 4GRWA 4NN7A 1EERA 1WU3I 1D9GA 3QT2C 3UEZE 4ZS7A 5C4XD 4CNIC 3LB6B 4A3FD 1VLKA 3HOWD 4PS4A 2D9QA 1HZIA 2O27A 3D48P 1ALUA 3B5KA 1ITIA 4A3KD 3MZGA 3QWRB 4LRLA 3DI3A 4NN5A 1Y1WD 1BCNA 1A22A 3UF5A 3I4ND 5IYDD 4A93D 1KF9A 4DOHA 1IJZA 1CN4C 5L6YC 3OQ3A 4EXNA 1M4RA 2PSMA 1GNCA 1M4AA 1Y6ML 4NKQC 2INTA 2R7ZD 2LAGA 1HWHA 1EMRA 2CYKA 3DGCL 1IK0A 1BP3A 2Q14A 5D70A 1HIJA 3LB6A 5D22A 2ERJD 2O26A 3QAZA 3HOVD 1ITFA 1CYLA 1V7MV 3HOUD 3HOYD 3PIWA 1EXZA 5FHXA 5IP7D 3TGXB 1LKIA 1SCFA 1JLIA 1V7NV 2C35A 1BGCA 1CD9A 4NI7A 2JA5D 1F6FA 3L5WI 1HUWA 1AXIA 2KZ1A 3DUHC 5C44D 2B8YA 1BGDA 4A3ID 3PO2D 1HGUA 3HHRA 4A3ED 4A3MD 1BGEA 4YUEC 4BY1D 1QVNA 2HYMB 2H24A 2IL6A 3FKID 4A3BD 4NI9A 3EJJA 1M4CA 1AX8A 4RS1A 4ZF7A 5C3ED 2JA8D 4DKFA 4GS7A 3HMXB 4YPGC 5C7XA 1A7MA 1INRA 3NPZA 3OG4A 3BPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E4E A;  3L5X A;  5FUC A;  1HWG A;  2LMS A;  3UF2 A;  2GMF A;  3DLQ I;  1FG9 A;  3QB1 A;  4O9H A;  1IL6 A;  1F45 B;  2Q98 A;  2B91 A;  4I77 Z;  3SE4 B;  3WCY I;  1BBN A;  1AU1 A;  4O6K A;  1FYH A;  1BUY A;  2B5I A;  3BES L;  3N0P A;  3Q1S I;  1HIK A;  3UX9 A;  3G9V B;  4Z5R D;  1IK0 A;  3SE3 B;  4FA8 E;  1I1R B;  1RHG A;  3INK C;  3D85 C;  4J4L C;  2B8Z A;  1RFB A;  1RW5 A;  3BPL A;  5LQB A;  4YDY I;  1Z92 A;  1M47 A;  5D28 B;  1Y6N L;  1LQS L;  3VA2 A;  1Z7C A;  3NCB A;  1EKU A;  2B8X A;  1ITL A;  1J7V L;  3QB7 A;  4WRL B;  3S9D A;  3D87 A;  2B8U A;  3NCC A;  2L3O A;  1N1F A;  1IRL A;  1ETE A;  1CSG A;  1D9C A;  1CNT 1;  1LK3 A;  1Y6K L;  1P9M B;  3NCE A;  5D71 A;  1GA3 A;  1EVS A;  3NCF A;  1ILK A;  1NBP A;  2E9W C;  2B90 A;  1PVH B;  3N06 A;  3PIV A;  1YKB A;  3EW3 A;  1M48 A;  1PY2 A;  1M49 A;  2ILK A;  1M4B A;  3G6D A;  1B5L A;  4NEM A;  1IAR A;  1ITM A;  4YQX A;  1HUL A;  1PGR A;  2Q7N B;  5D72 A;  3BPO A;  1PW6 A;  4MHL A;  4X51 A;  5KNH I;  1RCB A;  4NEJ A;  2D48 A;  2L3Y A;  4GRW A;  1EER A;  1WU3 I;  1D9G A;  3QT2 C;  3UEZ E;  4ZS7 A;  4CNI C;  3LB6 B;  1VLK A;  4PS4 A;  2D9Q A;  1HZI A;  2O27 A;  3D48 P;  1ALU A;  3B5K A;  1ITI A;  3MZG A;  3QWR B;  1BCN A;  1A22 A;  3UF5 A;  1KF9 A;  4DOH A;  1IJZ A;  1CN4 C;  5L6Y C;  3OQ3 A;  1M4R A;  1GNC A;  1M4A A;  1Y6M L;  4NKQ C;  2INT A;  2LAG A;  1HWH A;  1EMR A;  2CYK A;  3DGC L;  1BP3 A;  5D70 A;  1HIJ A;  3LB6 A;  5D22 A;  2ERJ D;  2O26 A;  3QAZ A;  1ITF A;  1CYL A;  1V7M V;  3PIW A;  1EXZ A;  5FHX A;  1LKI A;  1SCF A;  1JLI A;  1V7N V;  1BGC A;  1CD9 A;  4NI7 A;  1F6F A;  3L5W I;  1HUW A;  1AXI A;  2KZ1 A;  3DUH C;  2B8Y A;  1BGD A;  1HGU A;  3HHR A;  1BGE A;  4YUE C;  1QVN A;  2HYM B;  2H24 A;  2IL6 A;  4NI9 A;  3EJJ A;  1M4C A;  1AX8 A;  4RS1 A;  4ZF7 A;  3HMX B;  4YPG C;  5C7X A;  1A7M A;  1INR A;  3NPZ A;  3BPN A; 
#chains in the Genus database with same CATH topology
 4BBS D;  2GMF A;  4JA3 A;  5EQI A;  3QB1 A;  4YB9 D;  2Z3R A;  3SE4 B;  4J05 A;  4NN6 A;  1FYH A;  1BUY A;  1Y1V D;  3BES L;  3N0P A;  3Q1S I;  4IU9 A;  3UX9 A;  5IYC D;  2R93 D;  3HOZ D;  1I1R B;  4J4L C;  4BY7 D;  2VUM D;  1Z92 A;  2B63 D;  5D28 B;  3OG6 A;  4LEP A;  3H0G D;  1EKU A;  1ITL A;  1Y6K L;  5D71 A;  4ZYR A;  4BBR D;  4A3J D;  1PVH B;  4EXP A;  5A2O A;  2L3Y A;  4NN7 A;  1D9G A;  4U4W A;  3HOW D;  2O27 A;  1ALU A;  4NN5 A;  1BCN A;  1IJZ A;  4ZWB A;  1GNC A;  1M4A A;  2INT A;  2LAG A;  1HWH A;  2CYK A;  3O7Q A;  1BP3 A;  5C65 A;  3HOU D;  3TGX B;  1BGC A;  1HUW A;  3DUH C;  4A3M D;  1BGE A;  4YUE C;  4BY1 D;  2HYM B;  3FKI D;  3EJJ A;  4RS1 A;  4YPG C;  5EQG A;  4XNJ A;  3BPN A;  5E4E A;  5FUC A;  1HWG A;  2Q98 A;  4I77 Z;  4W6V A;  4O6K A;  1HIK A;  3INK C;  5TS9 A;  2B8Z A;  1RW5 A;  5A2N A;  5LQB A;  1Y6N L;  1LQS L;  5IYB D;  1Z7C A;  3QB7 A;  4WRL B;  2JA6 D;  3S9D A;  4UVM A;  3D87 A;  4IKY A;  3NCC A;  1N1F A;  1ETE A;  1P9M B;  1GA3 A;  4GBY A;  4DKE A;  1ILK A;  1NBP A;  2XQB A;  3N06 A;  4A3C D;  1M48 A;  1PY2 A;  4TPJ A;  2R92 D;  3G6D A;  1ITM A;  2OQP A;  4X51 A;  5KNH I;  1RCB A;  5EQH A;  2JA7 D;  4U4T A;  1EER A;  1WU3 I;  3QT2 C;  4CNI C;  2D9Q A;  1HZI A;  4D2C A;  3MZG A;  1Y1W D;  4JRE A;  5L6Y C;  2PSM A;  3O7P A;  4IKX A;  1EMR A;  1HIJ A;  2O26 A;  1ITF A;  1CYL A;  1SCF A;  1JLI A;  2XUT A;  2KZ1 A;  1AXI A;  1HGU A;  1QVN A;  4A3B D;  4NI9 A;  1AX8 A;  5C3E D;  4ZF7 A;  4DKF A;  1PW4 A;  3OG4 A;  3L5X A;  4A3D D;  3UF2 A;  3DLQ I;  4IKZ A;  4A3L D;  4DKC A;  1IL6 A;  1F45 B;  4PYP A;  4ZW9 A;  2B91 A;  4BXX D;  3WCY I;  1BBN A;  5GXB A;  1AU1 A;  1IK0 A;  4Z5R D;  4FA8 E;  1RHG A;  1RFB A;  3PO3 D;  1M47 A;  5D6K A;  5FLM D;  4DKD A;  2B8U A;  1IRL A;  1LK3 A;  1CSG A;  1D9C A;  1CNT 1;  3AYH A;  4IKV A;  3I4M D;  3NCF A;  2E9W C;  2B90 A;  2V8N A;  4ZWC A;  1M49 A;  5IP9 D;  1PV7 A;  5D72 A;  1PW6 A;  4MHL A;  3DI2 A;  4OAA A;  3UEZ E;  4ZS7 A;  4APS A;  3LB6 B;  4A3F D;  4GBZ A;  3UF5 A;  5IYD D;  1KF9 A;  4TPH A;  1Y6M L;  2Q14 A;  5D70 A;  5D22 A;  2ERJ D;  4TPG A;  1V7M V;  3HOY D;  1EXZ A;  5IP7 D;  1LKI A;  1CD9 A;  4NI7 A;  1F6F A;  3L5W I;  4YBQ A;  2B8Y A;  1BGD A;  4A3I D;  3PO2 D;  3HHR A;  4A3E D;  1PV6 A;  2H24 A;  2IL6 A;  2JA8 D;  4GS7 A;  5C7X A;  1INR A;  3NPZ A;  3HHC A;  1WCM D;  4A3G D;  3H3V E;  2LMS A;  3HOX D;  1FG9 A;  4U4V A;  2O6I A;  4O9H A;  2B5I A;  3G9V B;  4IU8 A;  3SE3 B;  4Q65 A;  3D85 C;  4XNI A;  3BPL A;  4YDY I;  3WDO A;  4QIQ A;  4D2B A;  3VA2 A;  2CFP A;  3NCB A;  2B8X A;  1J7V L;  2L3O A;  3IRH A;  3NCE A;  1EVS A;  4OH3 A;  3PIV A;  1YKB A;  3EW3 A;  2ILK A;  1M4B A;  2Y5Y A;  1B5L A;  4NEM A;  1IAR A;  4YQX A;  2Q7N B;  1HUL A;  1PGR A;  3BPO A;  4GC0 A;  1Y14 A;  4NEJ A;  2D48 A;  2Z3Q A;  4GRW A;  5C4X D;  1VLK A;  4PS4 A;  5D58 A;  3D48 P;  3B5K A;  1ITI A;  4A3K D;  3QWR B;  4LRL A;  3DI3 A;  1A22 A;  3I4N D;  4A93 D;  4DOH A;  1CN4 C;  4JR9 A;  3OQ3 A;  4EXN A;  1M4R A;  4NKQ C;  2R7Z D;  3DGC L;  4LDS A;  3LB6 A;  3QAZ A;  3HOV D;  5D59 A;  3PIW A;  5FHX A;  1V7N V;  2JA5 D;  4IKW A;  2C35 A;  5C44 D;  4D2D A;  1M4C A;  2CFQ A;  3HMX B;  1A7M A; 
#chains in the Genus database with same CATH homology
 3HHC A;  5E4E A;  1WCM D;  3L5X A;  5FUC A;  4A3G D;  1HWG A;  3H3V E;  2LMS A;  4A3D D;  3UF2 A;  4BBS D;  3HOX D;  2GMF A;  3DLQ I;  4A3L D;  1FG9 A;  4DKC A;  3QB1 A;  2O6I A;  4O9H A;  1IL6 A;  1F45 B;  2Q98 A;  2B91 A;  4I77 Z;  4BXX D;  2Z3R A;  3SE4 B;  3WCY I;  1BBN A;  1AU1 A;  4NN6 A;  1FYH A;  1BUY A;  1Y1V D;  2B5I A;  3BES L;  3N0P A;  1HIK A;  3Q1S I;  3G9V B;  4O6K A;  4Z5R D;  3UX9 A;  5IYC D;  3SE3 B;  4FA8 E;  3HOZ D;  1I1R B;  2R93 D;  1RHG A;  3INK C;  3D85 C;  4J4L C;  5TS9 A;  2B8Z A;  1RFB A;  4BY7 D;  1RW5 A;  2VUM D;  3BPL A;  5LQB A;  4YDY I;  1Z92 A;  2B63 D;  1M47 A;  5D28 B;  3PO3 D;  1Y6N L;  1LQS L;  3OG6 A;  3H0G D;  3VA2 A;  5IYB D;  1Z7C A;  3NCB A;  1EKU A;  2B8X A;  1ITL A;  1J7V L;  3QB7 A;  4WRL B;  2JA6 D;  3S9D A;  5FLM D;  3D87 A;  4DKD A;  2B8U A;  3NCC A;  2L3O A;  1N1F A;  1IRL A;  1ETE A;  1CSG A;  1D9C A;  1CNT 1;  1LK3 A;  1Y6K L;  1P9M B;  3AYH A;  3IRH A;  3NCE A;  5D71 A;  4BBR D;  1GA3 A;  1EVS A;  3I4M D;  3NCF A;  4DKE A;  1ILK A;  1NBP A;  2E9W C;  4A3J D;  2B90 A;  2XQB A;  1PVH B;  3N06 A;  3PIV A;  1YKB A;  3EW3 A;  4A3C D;  1M48 A;  1PY2 A;  1M49 A;  2ILK A;  2R92 D;  4EXP A;  1M4B A;  5IP9 D;  3G6D A;  1B5L A;  4NEM A;  1IAR A;  1ITM A;  4YQX A;  1HUL A;  1PGR A;  2Q7N B;  5D72 A;  3BPO A;  1PW6 A;  4MHL A;  2OQP A;  4X51 A;  5KNH I;  1RCB A;  1Y14 A;  4NEJ A;  3DI2 A;  2D48 A;  2JA7 D;  2L3Y A;  2Z3Q A;  4GRW A;  4NN7 A;  1EER A;  1WU3 I;  1D9G A;  3QT2 C;  3UEZ E;  4ZS7 A;  5C4X D;  4CNI C;  3LB6 B;  4A3F D;  1VLK A;  3HOW D;  4PS4 A;  2D9Q A;  1HZI A;  2O27 A;  3D48 P;  1ALU A;  3B5K A;  1ITI A;  4A3K D;  3MZG A;  3QWR B;  4LRL A;  3DI3 A;  4NN5 A;  1Y1W D;  1BCN A;  1A22 A;  3UF5 A;  3I4N D;  5IYD D;  4A93 D;  1KF9 A;  4DOH A;  1IJZ A;  1CN4 C;  5L6Y C;  3OQ3 A;  4EXN A;  1M4R A;  2PSM A;  1GNC A;  1M4A A;  1Y6M L;  4NKQ C;  2INT A;  2R7Z D;  2LAG A;  1HWH A;  1EMR A;  2CYK A;  3DGC L;  1IK0 A;  1BP3 A;  2Q14 A;  5D70 A;  1HIJ A;  3LB6 A;  5D22 A;  2ERJ D;  2O26 A;  3QAZ A;  3HOV D;  1ITF A;  1CYL A;  1V7M V;  3HOU D;  3HOY D;  3PIW A;  1EXZ A;  5FHX A;  5IP7 D;  3TGX B;  1LKI A;  1SCF A;  1JLI A;  1V7N V;  2C35 A;  1BGC A;  1CD9 A;  4NI7 A;  2JA5 D;  1F6F A;  3L5W I;  1HUW A;  1AXI A;  2KZ1 A;  3DUH C;  5C44 D;  2B8Y A;  1BGD A;  4A3I D;  3PO2 D;  1HGU A;  3HHR A;  4A3E D;  4A3M D;  1BGE A;  4YUE C;  4BY1 D;  1QVN A;  2HYM B;  2H24 A;  2IL6 A;  3FKI D;  4A3B D;  4NI9 A;  3EJJ A;  1M4C A;  1AX8 A;  4RS1 A;  4ZF7 A;  5C3E D;  2JA8 D;  4DKF A;  4GS7 A;  3HMX B;  4YPG C;  5C7X A;  1A7M A;  1INR A;  3NPZ A;  3OG4 A;  3BPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...