1F45B

Human interleukin-12
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
178
structure length
133
Chain Sequence
b'QNLLRAVSNMLQKARQTLEFYPCSTVEACLPLELTKNESCTSFITNGSSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-12 BETA CHAIN
publication title Charged residues dominate a unique interlocking topography in the heterodimeric cytokine interleukin-12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine
total genus 53
structure length 133
sequence length 178
ec nomenclature
pdb deposition date 2000-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1f45B00
1A22A 1PW6A 3BPOA 3D48P 3B5KA 2O27A 4RS1A 4O9HA 2HYMB 2O26A 1IJZA 4YUEC 3PIWA 1HIKA 1CNT1 2Q7NB 1SCFA 5D70A 1ITLA 4I77Z 1PGRA 2D48A 3NCBA 1P9MB 3VA2A 1BGEA 1M4BA 1LK3A 2B90A 1F6FA 4NKQC 1AXIA 3G9VB 1HULA 1V7NV 3EJJA 5D28B 5KNHI 1HZIA 1IARA 4J4LC 1ILKA 1ITMA 3DGCL 4Z5RD 2D9QA 3Q1SI 3QT2C 1BUYA 1EERA 2LAGA 1BGCA 3PIVA 5LQBA 1HWHA 1M4CA 3DLQI 2LMSA 3NCEA 4X51A 1N1FA 3UX9A 3HHRA 1HWGA 2CYKA 2B8YA 1CYLA 3LB6B 1M4AA 1Z92A 1YKBA 1EXZA 2KZ1A 1D9GA 1PVHB 3D85C 3D87A 3OQ3A 2H24A 1FYHA 1VLKA 4PS4A 1PY2A 5L6YC 2ERJD 1BBNA 2ILKA 5D72A 1D9CA 3WCYI 1BCNA 3N06A 3UF2A 4NEJA 1ITIA 4YQXA 1B5LA 1Y6KL 1LKIA 1Y6ML 2IL6A 5D22A 1I1RB 1Y6NL 3S9DA 1JLIA 3L5XA 1RCBA 1AU1A 1M49A 4NI7A 1HUWA 3BESL 1ITFA 4YPGC 1INRA 2GMFA 3MZGA 3QB7A 3EW3A 2B91A 3G6DA 3QAZA 3LB6A 3INKC 2L3YA 1NBPA 1HGUA 4FA8E 3NCCA 1CN4C 1EKUA 1Z7CA 3L5WI 1BGDA 5FUCA 1CSGA 1ALUA 1FG9A 5D71A 2INTA 5FHXA 3NCFA 3N0PA 3UF5A 3BPLA 2Q98A 1M47A 1HIJA 1GNCA 1WU3I 2B5IA 3HMXB 5C7XA 3UEZE 3SE4B 1IRLA 4GRWA 4O6KA 1A7MA 3QWRB 1LQSL 1KF9A 1IL6A 1F45B 4ZF7A 2B8ZA 3BPNA 1EMRA 4MHLA 1IK0A 1GA3A 1CD9A 2B8UA 1AX8A 2B8XA 4WRLB 1EVSA 5E4EA 1BP3A 1M48A 4DOHA 1M4RA 3SE3B 1RW5A 4CNIC 3NPZA 4ZS7A 3DUHC 1ETEA 1RFBA 1RHGA 1J7VL 1QVNA 4YDYI 2L3OA 3QB1A 4NI9A 2E9WC 4NEMA 1V7MV
chains in the Genus database with same CATH superfamily
1WCMD 4LRLA 3B5KA 5C44D 1IJZA 2Q7NB 5D70A 1ITLA 1P9MB 3VA2A 1BGEA 4NKQC 1AXIA 1HULA 4A3JD 4IKXA 5KNHI 1HZIA 1ILKA 3DGCL 4PYPA 4Z5RD 3HOZD 4GBZA 4BY1D 3NCEA 4X51A 4DKDA 3UX9A 4OAAA 2B8YA 5C4XD 3I4ND 4TPHA 4TPJA 3H3VE 4U4VA 1PY2A 4NN7A 2R7ZD 3WCYI 2B63D 1BCNA 4A3DD 1B5LA 5EQIA 5D22A 1JLIA 1RCBA 4YPGC 5D58A 3MZGA 3QB7A 2B91A 1PV6A 4U4WA 4A3GD 2L3YA 1NBPA 1HGUA 4FA8E 3NCCA 1Z7CA 1CSGA 2CFPA 4APSA 5IYBD 3SE4B 1IRLA 4GRWA 1A7MA 4ZF7A 2B8ZA 2B8UA 4ZYRA 1EVSA 4EXNA 3AYHA 4U4TA 4BXXD 2JA7D 1QVNA 4A3MD 4YDYI 2XQBA 3HOUD 1V7MV 1PW6A 3O7PA 2R93D 1HIKA 1CNT1 4YBQA 1SCFA 4I77Z 3HHCA 5IYCD 1LK3A 5C3ED 3G9VB 3EJJA 5D28B 1ITMA 4YB9D 1EERA 3PIVA 5LQBA 1HWHA 3DLQI 2LMSA 4W6VA 3HHRA 1HWGA 5A2NA 1M4AA 3HOVD 3HOWD 1PV7A 1Z92A 1YKBA 2KZ1A 3D85C 3OQ3A 1FYHA 1VLKA 5L6YC 2ERJD 4XNIA 3UF2A 5EQGA 1ITIA 1Y6ML 2IL6A 4A3CD 5GXBA 4NN6A 2Z3QA 1M49A 3OG4A 1HUWA 1INRA 2XUTA 3QAZA 3LB6A 4A3ID 3INKC 2CFQA 3HOYD 1EKUA 3WDOA 3FKID 3L5WI 4JREA 1BGDA 5FUCA 1FG9A 5D71A 2INTA 3N0PA 2Q98A 2Z3RA 1M47A 2JA8D 1GNCA 1KF9A 4D2CA 3BPNA 2Y5YA 5EQHA 2B8XA 4WRLB 5E4EA 4DOHA 4CNIC 2O6IA 3DUHC 4NN5A 4NEMA 3BPOA 2O27A 4D2DA 2HYMB 4YUEC 3PIWA 2D48A 3NCBA 1M4BA 2B90A 3O7QA 4GC0A 5D59A 1IARA 4J4LC 4EXPA 1Y1WD 2PSMA 3Q1SI 1BUYA 4IKWA 2LAGA 1BGCA 1M4CA 2R92D 1CYLA 1D9GA 4XNJA 3D87A 4UVMA 4GBYA 5D6KA 2H24A 5TS9A 1BBNA 1D9CA 3N06A 4NEJA 4YQXA 3HOXD 5IP7D 4QIQA 3BESL 2C35A 2Q14A 4IU8A 4JR9A 3H0GD 1CN4C 3OG6A 4A3FD 5FHXA 3NCFA 3BPLA 3PO3D 1WU3I 5C7XA 3UEZE 4O6KA 1LQSL 4GS7A 1EMRA 4MHLA 1GA3A 1Y14A 4ZW9A 1AX8A 4JA3A 4ZS7A 1RW5A 1RFBA 1J7VL 3DI3A 4ZWCA 3QB1A 4D2BA 2E9WC 4NI9A 4IKVA 1A22A 3D48P 4RS1A 4O9HA 2O26A 1Y1VD 4A3ED 1PGRA 1F6FA 1V7NV 3PO2D 4A3KD 2D9QA 3QT2C 4ZWBA 5FLMD 2JA5D 1N1FA 3TGXB 2CYKA 3LB6B 4LEPA 1EXZA 1PVHB 5A2OA 1PW4A 4PS4A 4IKZA 2ILKA 5D72A 4DKCA 4BBRD 1LKIA 1Y6KL 4IKYA 4BY7D 1I1RB 5IP9D 1Y6NL 3S9DA 2OQPA 3L5XA 1AU1A 4TPGA 4NI7A 4DKEA 4LDSA 1ITFA 4OH3A 4A3LD 2GMFA 3EW3A 3G6DA 2V8NA 3I4MD 2JA6D 1ALUA 4BBSD 3UF5A 1HIJA 2B5IA 3HMXB 4A93D 3QWRB 1IL6A 1F45B 4IU9A 1IK0A 1CD9A 4J05A 5C65A 5IYDD 1BP3A 2VUMD 1M48A 1M4RA 3SE3B 4A3BD 3NPZA 1ETEA 1RHGA 4DKFA 3DI2A 3IRHA 2L3OA 4Q65A
chains in the Genus database with same CATH topology
1A22A 1WCMD 1PW6A 4LRLA 3BPOA 3D48P 3B5KA 2O27A 4RS1A 2R93D 4O9HA 2HYMB 2O26A 1Y1VD 5C44D 1IJZA 4YUEC 4A3ED 3PIWA 1HIKA 1CNT1 2Q7NB 1SCFA 5D70A 1ITLA 4I77Z 1PGRA 2D48A 3NCBA 1P9MB 3VA2A 1BGEA 3HHCA 1M4BA 5IYCD 1LK3A 2B90A 1F6FA 4NKQC 1AXIA 5C3ED 3G9VB 1GNCA 1HULA 1V7NV 3EJJA 4A3JD 5D28B 3PO2D 5KNHI 1HZIA 1IARA 4J4LC 4EXPA 1Y1WD 1ILKA 1ITMA 3DGCL 4A3KD 4Z5RD 2D9QA 2PSMA 3Q1SI 3QT2C 3HOZD 1BUYA 4BY1D 1EERA 2LAGA 1BGCA 3PIVA 5LQBA 5FLMD 1HWHA 1M4CA 3DLQI 2LMSA 3NCEA 2JA5D 2R92D 4X51A 1N1FA 4DKDA 3UX9A 4NN5A 3TGXB 3HHRA 1HWGA 2CYKA 2B8YA 1CYLA 5C4XD 3LB6B 1M4AA 3HOVD 3HOWD 3I4ND 1Z92A 1YKBA 1EXZA 2KZ1A 1D9GA 1PVHB 3D85C 3D87A 3OQ3A 2H24A 1FYHA 3H3VE 1VLKA 4PS4A 1PY2A 5L6YC 5TS9A 2ERJD 1BBNA 2ILKA 4NN7A 1D9CA 5D72A 3WCYI 2R7ZD 2B63D 1BCNA 3N06A 4DKCA 4BBRD 3UF2A 4A3DD 4NEJA 1ITIA 4YQXA 1B5LA 1LKIA 1Y6KL 1Y6ML 2IL6A 4A3CD 4BY7D 5D22A 1I1RB 5IP9D 1Y6NL 3HOXD 4NN6A 2OQPA 5IP7D 2Z3QA 1JLIA 3L5XA 3S9DA 1RCBA 1AU1A 1M49A 3OG4A 1HUWA 3BESL 4NI7A 4DKEA 2C35A 2Q14A 1ITFA 4YPGC 4A3LD 1INRA 2GMFA 3MZGA 3QB7A 3EW3A 2B91A 3G6DA 3QAZA 3LB6A 4A3ID 3INKC 4A3GD 2L3YA 1NBPA 3I4MD 1HGUA 4FA8E 2JA6D 3H0GD 3NCCA 1CN4C 1EKUA 3HOYD 1Z7CA 3FKID 3L5WI 1BGDA 3OG6A 5FUCA 1CSGA 4A3FD 1ALUA 1FG9A 5D71A 2INTA 5FHXA 3NCFA 3N0PA 4BBSD 3UF5A 3BPLA 3PO3D 2Q98A 2Z3RA 1M47A 5IYBD 1HIJA 2JA8D 1WU3I 2B5IA 3HMXB 5C7XA 3UEZE 3SE4B 1IRLA 4GRWA 4O6KA 4A93D 1A7MA 3QWRB 1LQSL 1KF9A 4GS7A 1IL6A 1F45B 4ZF7A 2B8ZA 3BPNA 1EMRA 4MHLA 1IK0A 1GA3A 1CD9A 1Y14A 2B8UA 1AX8A 2B8XA 4WRLB 1EVSA 5E4EA 1BP3A 5IYDD 1M48A 2VUMD 4DOHA 1M4RA 4EXNA 3SE3B 1RW5A 4CNIC 3NPZA 3AYHA 4ZS7A 4A3BD 2O6IA 3DUHC 4BXXD 2JA7D 1ETEA 1RFBA 1RHGA 4DKFA 3DI2A 1J7VL 3IRHA 1QVNA 3DI3A 4A3MD 4YDYI 2L3OA 3QB1A 4NI9A 2E9WC 2XQBA 3HOUD 4NEMA 1V7MV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A22 A;  1PW6 A;  3BPO A;  3D48 P;  3B5K A;  2O27 A;  4RS1 A;  4O9H A;  2HYM B;  2O26 A;  1IJZ A;  4YUE C;  3PIW A;  1HIK A;  1CNT 1;  2Q7N B;  1SCF A;  5D70 A;  1ITL A;  4I77 Z;  1PGR A;  2D48 A;  3NCB A;  1P9M B;  3VA2 A;  1BGE A;  1M4B A;  1LK3 A;  2B90 A;  1F6F A;  4NKQ C;  1AXI A;  3G9V B;  1HUL A;  1V7N V;  3EJJ A;  5D28 B;  5KNH I;  1HZI A;  1IAR A;  4J4L C;  1ILK A;  1ITM A;  3DGC L;  4Z5R D;  2D9Q A;  3Q1S I;  3QT2 C;  1BUY A;  1EER A;  2LAG A;  1BGC A;  3PIV A;  5LQB A;  1HWH A;  1M4C A;  3DLQ I;  2LMS A;  3NCE A;  4X51 A;  1N1F A;  3UX9 A;  3HHR A;  1HWG A;  2CYK A;  2B8Y A;  1CYL A;  3LB6 B;  1M4A A;  1Z92 A;  1YKB A;  1EXZ A;  2KZ1 A;  1D9G A;  1PVH B;  3D85 C;  3D87 A;  3OQ3 A;  2H24 A;  1FYH A;  1VLK A;  4PS4 A;  1PY2 A;  5L6Y C;  2ERJ D;  1BBN A;  2ILK A;  5D72 A;  1D9C A;  3WCY I;  1BCN A;  3N06 A;  3UF2 A;  4NEJ A;  1ITI A;  4YQX A;  1B5L A;  1Y6K L;  1LKI A;  1Y6M L;  2IL6 A;  5D22 A;  1I1R B;  1Y6N L;  3S9D A;  1JLI A;  3L5X A;  1RCB A;  1AU1 A;  1M49 A;  4NI7 A;  1HUW A;  3BES L;  1ITF A;  4YPG C;  1INR A;  2GMF A;  3MZG A;  3QB7 A;  3EW3 A;  2B91 A;  3G6D A;  3QAZ A;  3LB6 A;  3INK C;  2L3Y A;  1NBP A;  1HGU A;  4FA8 E;  3NCC A;  1CN4 C;  1EKU A;  1Z7C A;  3L5W I;  1BGD A;  5FUC A;  1CSG A;  1ALU A;  1FG9 A;  5D71 A;  2INT A;  5FHX A;  3NCF A;  3N0P A;  3UF5 A;  3BPL A;  2Q98 A;  1M47 A;  1HIJ A;  1GNC A;  1WU3 I;  2B5I A;  3HMX B;  5C7X A;  3UEZ E;  3SE4 B;  1IRL A;  4GRW A;  4O6K A;  1A7M A;  3QWR B;  1LQS L;  1KF9 A;  1IL6 A;  1F45 B;  4ZF7 A;  2B8Z A;  3BPN A;  1EMR A;  4MHL A;  1IK0 A;  1GA3 A;  1CD9 A;  2B8U A;  1AX8 A;  2B8X A;  4WRL B;  1EVS A;  5E4E A;  1BP3 A;  1M48 A;  4DOH A;  1M4R A;  3SE3 B;  1RW5 A;  4CNI C;  3NPZ A;  4ZS7 A;  3DUH C;  1ETE A;  1RFB A;  1RHG A;  1J7V L;  1QVN A;  4YDY I;  2L3O A;  3QB1 A;  4NI9 A;  2E9W C;  4NEM A;  1V7M V; 
#chains in the Genus database with same CATH topology
 1WCM D;  4LRL A;  3B5K A;  5C44 D;  1IJZ A;  2Q7N B;  5D70 A;  1ITL A;  1P9M B;  3VA2 A;  1BGE A;  4NKQ C;  1AXI A;  1HUL A;  4A3J D;  4IKX A;  5KNH I;  1HZI A;  1ILK A;  3DGC L;  4PYP A;  4Z5R D;  3HOZ D;  4GBZ A;  4BY1 D;  3NCE A;  4X51 A;  4DKD A;  3UX9 A;  4OAA A;  2B8Y A;  5C4X D;  3I4N D;  4TPH A;  4TPJ A;  3H3V E;  4U4V A;  1PY2 A;  4NN7 A;  2R7Z D;  3WCY I;  2B63 D;  1BCN A;  4A3D D;  1B5L A;  5EQI A;  5D22 A;  1JLI A;  1RCB A;  4YPG C;  5D58 A;  3MZG A;  3QB7 A;  2B91 A;  1PV6 A;  4U4W A;  4A3G D;  2L3Y A;  1NBP A;  1HGU A;  4FA8 E;  3NCC A;  1Z7C A;  1CSG A;  2CFP A;  4APS A;  5IYB D;  3SE4 B;  1IRL A;  4GRW A;  1A7M A;  4ZF7 A;  2B8Z A;  2B8U A;  4ZYR A;  1EVS A;  4EXN A;  3AYH A;  4U4T A;  4BXX D;  2JA7 D;  1QVN A;  4A3M D;  4YDY I;  2XQB A;  3HOU D;  1V7M V;  1PW6 A;  3O7P A;  2R93 D;  1HIK A;  1CNT 1;  4YBQ A;  1SCF A;  4I77 Z;  3HHC A;  5IYC D;  1LK3 A;  5C3E D;  3G9V B;  3EJJ A;  5D28 B;  1ITM A;  4YB9 D;  1EER A;  3PIV A;  5LQB A;  1HWH A;  3DLQ I;  2LMS A;  4W6V A;  3HHR A;  1HWG A;  5A2N A;  1M4A A;  3HOV D;  3HOW D;  1PV7 A;  1Z92 A;  1YKB A;  2KZ1 A;  3D85 C;  3OQ3 A;  1FYH A;  1VLK A;  5L6Y C;  2ERJ D;  4XNI A;  3UF2 A;  5EQG A;  1ITI A;  1Y6M L;  2IL6 A;  4A3C D;  5GXB A;  4NN6 A;  2Z3Q A;  1M49 A;  3OG4 A;  1HUW A;  1INR A;  2XUT A;  3QAZ A;  3LB6 A;  4A3I D;  3INK C;  2CFQ A;  3HOY D;  1EKU A;  3WDO A;  3FKI D;  3L5W I;  4JRE A;  1BGD A;  5FUC A;  1FG9 A;  5D71 A;  2INT A;  3N0P A;  2Q98 A;  2Z3R A;  1M47 A;  2JA8 D;  1GNC A;  1KF9 A;  4D2C A;  3BPN A;  2Y5Y A;  5EQH A;  2B8X A;  4WRL B;  5E4E A;  4DOH A;  4CNI C;  2O6I A;  3DUH C;  4NN5 A;  4NEM A;  3BPO A;  2O27 A;  4D2D A;  2HYM B;  4YUE C;  3PIW A;  2D48 A;  3NCB A;  1M4B A;  2B90 A;  3O7Q A;  4GC0 A;  5D59 A;  1IAR A;  4J4L C;  4EXP A;  1Y1W D;  2PSM A;  3Q1S I;  1BUY A;  4IKW A;  2LAG A;  1BGC A;  1M4C A;  2R92 D;  1CYL A;  1D9G A;  4XNJ A;  3D87 A;  4UVM A;  4GBY A;  5D6K A;  2H24 A;  5TS9 A;  1BBN A;  1D9C A;  3N06 A;  4NEJ A;  4YQX A;  3HOX D;  5IP7 D;  4QIQ A;  3BES L;  2C35 A;  2Q14 A;  4IU8 A;  4JR9 A;  3H0G D;  1CN4 C;  3OG6 A;  4A3F D;  5FHX A;  3NCF A;  3BPL A;  3PO3 D;  1WU3 I;  5C7X A;  3UEZ E;  4O6K A;  1LQS L;  4GS7 A;  1EMR A;  4MHL A;  1GA3 A;  1Y14 A;  4ZW9 A;  1AX8 A;  4JA3 A;  4ZS7 A;  1RW5 A;  1RFB A;  1J7V L;  3DI3 A;  4ZWC A;  3QB1 A;  4D2B A;  2E9W C;  4NI9 A;  4IKV A;  1A22 A;  3D48 P;  4RS1 A;  4O9H A;  2O26 A;  1Y1V D;  4A3E D;  1PGR A;  1F6F A;  1V7N V;  3PO2 D;  4A3K D;  2D9Q A;  3QT2 C;  4ZWB A;  5FLM D;  2JA5 D;  1N1F A;  3TGX B;  2CYK A;  3LB6 B;  4LEP A;  1EXZ A;  1PVH B;  5A2O A;  1PW4 A;  4PS4 A;  4IKZ A;  2ILK A;  5D72 A;  4DKC A;  4BBR D;  1LKI A;  1Y6K L;  4IKY A;  4BY7 D;  1I1R B;  5IP9 D;  1Y6N L;  3S9D A;  2OQP A;  3L5X A;  1AU1 A;  4TPG A;  4NI7 A;  4DKE A;  4LDS A;  1ITF A;  4OH3 A;  4A3L D;  2GMF A;  3EW3 A;  3G6D A;  2V8N A;  3I4M D;  2JA6 D;  1ALU A;  4BBS D;  3UF5 A;  1HIJ A;  2B5I A;  3HMX B;  4A93 D;  3QWR B;  1IL6 A;  1F45 B;  4IU9 A;  1IK0 A;  1CD9 A;  4J05 A;  5C65 A;  5IYD D;  1BP3 A;  2VUM D;  1M48 A;  1M4R A;  3SE3 B;  4A3B D;  3NPZ A;  1ETE A;  1RHG A;  4DKF A;  3DI2 A;  3IRH A;  2L3O A;  4Q65 A; 
#chains in the Genus database with same CATH homology
 1A22 A;  1WCM D;  1PW6 A;  4LRL A;  3BPO A;  3D48 P;  3B5K A;  2O27 A;  4RS1 A;  2R93 D;  4O9H A;  2HYM B;  2O26 A;  1Y1V D;  5C44 D;  1IJZ A;  4YUE C;  4A3E D;  3PIW A;  1HIK A;  1CNT 1;  2Q7N B;  1SCF A;  5D70 A;  1ITL A;  4I77 Z;  1PGR A;  2D48 A;  3NCB A;  1P9M B;  3VA2 A;  1BGE A;  3HHC A;  1M4B A;  5IYC D;  1LK3 A;  2B90 A;  1F6F A;  4NKQ C;  1AXI A;  5C3E D;  3G9V B;  1GNC A;  1HUL A;  1V7N V;  3EJJ A;  4A3J D;  5D28 B;  3PO2 D;  5KNH I;  1HZI A;  1IAR A;  4J4L C;  4EXP A;  1Y1W D;  1ILK A;  1ITM A;  3DGC L;  4A3K D;  4Z5R D;  2D9Q A;  2PSM A;  3Q1S I;  3QT2 C;  3HOZ D;  1BUY A;  4BY1 D;  1EER A;  2LAG A;  1BGC A;  3PIV A;  5LQB A;  5FLM D;  1HWH A;  1M4C A;  3DLQ I;  2LMS A;  3NCE A;  2JA5 D;  2R92 D;  4X51 A;  1N1F A;  4DKD A;  3UX9 A;  4NN5 A;  3TGX B;  3HHR A;  1HWG A;  2CYK A;  2B8Y A;  1CYL A;  5C4X D;  3LB6 B;  1M4A A;  3HOV D;  3HOW D;  3I4N D;  1Z92 A;  1YKB A;  1EXZ A;  2KZ1 A;  1D9G A;  1PVH B;  3D85 C;  3D87 A;  3OQ3 A;  2H24 A;  1FYH A;  3H3V E;  1VLK A;  4PS4 A;  1PY2 A;  5L6Y C;  5TS9 A;  2ERJ D;  1BBN A;  2ILK A;  4NN7 A;  1D9C A;  5D72 A;  3WCY I;  2R7Z D;  2B63 D;  1BCN A;  3N06 A;  4DKC A;  4BBR D;  3UF2 A;  4A3D D;  4NEJ A;  1ITI A;  4YQX A;  1B5L A;  1LKI A;  1Y6K L;  1Y6M L;  2IL6 A;  4A3C D;  4BY7 D;  5D22 A;  1I1R B;  5IP9 D;  1Y6N L;  3HOX D;  4NN6 A;  2OQP A;  5IP7 D;  2Z3Q A;  1JLI A;  3L5X A;  3S9D A;  1RCB A;  1AU1 A;  1M49 A;  3OG4 A;  1HUW A;  3BES L;  4NI7 A;  4DKE A;  2C35 A;  2Q14 A;  1ITF A;  4YPG C;  4A3L D;  1INR A;  2GMF A;  3MZG A;  3QB7 A;  3EW3 A;  2B91 A;  3G6D A;  3QAZ A;  3LB6 A;  4A3I D;  3INK C;  4A3G D;  2L3Y A;  1NBP A;  3I4M D;  1HGU A;  4FA8 E;  2JA6 D;  3H0G D;  3NCC A;  1CN4 C;  1EKU A;  3HOY D;  1Z7C A;  3FKI D;  3L5W I;  1BGD A;  3OG6 A;  5FUC A;  1CSG A;  4A3F D;  1ALU A;  1FG9 A;  5D71 A;  2INT A;  5FHX A;  3NCF A;  3N0P A;  4BBS D;  3UF5 A;  3BPL A;  3PO3 D;  2Q98 A;  2Z3R A;  1M47 A;  5IYB D;  1HIJ A;  2JA8 D;  1WU3 I;  2B5I A;  3HMX B;  5C7X A;  3UEZ E;  3SE4 B;  1IRL A;  4GRW A;  4O6K A;  4A93 D;  1A7M A;  3QWR B;  1LQS L;  1KF9 A;  4GS7 A;  1IL6 A;  1F45 B;  4ZF7 A;  2B8Z A;  3BPN A;  1EMR A;  4MHL A;  1IK0 A;  1GA3 A;  1CD9 A;  1Y14 A;  2B8U A;  1AX8 A;  2B8X A;  4WRL B;  1EVS A;  5E4E A;  1BP3 A;  5IYD D;  1M48 A;  2VUM D;  4DOH A;  1M4R A;  4EXN A;  3SE3 B;  1RW5 A;  4CNI C;  3NPZ A;  3AYH A;  4ZS7 A;  4A3B D;  2O6I A;  3DUH C;  4BXX D;  2JA7 D;  1ETE A;  1RFB A;  1RHG A;  4DKF A;  3DI2 A;  1J7V L;  3IRH A;  1QVN A;  3DI3 A;  4A3M D;  4YDY I;  2L3O A;  3QB1 A;  4NI9 A;  2E9W C;  2XQB A;  3HOU D;  4NEM A;  1V7M V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...