4DOHA

Il20/il201/il20r2 ternary complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
ALKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
pubmed doi rcsb
molecule keywords Interleukin-20
molecule tags Signaling protein
source organism Homo sapiens
total genus 57
structure length 153
sequence length 153
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 4dohA00
1HGUA 1EXZA 3MZGA 1ITMA 3QAZA 4YUEC 1F45B 3QB7A 1HUWA 1A7MA 3BPOA 4RS1A 1EKUA 2Q7NB 1HZIA 4WRLB 1CSGA 1AXIA 1PVHB 1HULA 1M49A 4Z5RD 3SE4B 1PGRA 3D85C 2LMSA 4ZF7A 3UF2A 4NEMA 3VA2A 1Y6NL 5D71A 4YQXA 1RFBA 3L5WI 3PIVA 1ITFA 1Z92A 4DOHA 5L6YC 3DGCL 1B5LA 2INTA 1ILKA 3INKC 3N06A 1IK0A 1D9GA 1FG9A 1YKBA 4MHLA 1CYLA 3D48P 4PS4A 4J4LC 1CD9A 1D9CA 1P9MB 3UX9A 3DUHC 2H24A 3EW3A 4NI9A 4NI7A 1RHGA 5FUCA 1EERA 1RCBA 2ILKA 1M4CA 4GRWA 2LAGA 5D22A 5C7XA 2O26A 2B90A 1VLKA 3PIWA 2L3OA 1I1RB 1M4AA 3HMXB 1IJZA 4YDYI 2B8ZA 2B5IA 1AX8A 3G6DA 1A22A 4ZS7A 3D87A 3LB6A 3G9VB 1V7MV 1HIKA 1QVNA 1JLIA 1CN4C 1PY2A 1GNCA 5D70A 1HIJA 3EJJA 1IARA 1KF9A 5E4EA 3LB6B 4FA8E 1GA3A 3N0PA 3NCFA 2Q98A 3Q1SI 1LQSL 2HYMB 3BPNA 1EVSA 2D9QA 4CNIC 2KZ1A 1F6FA 1M4RA 1BP3A 3UEZE 2B8UA 5LQBA 4O6KA 1J7VL 1PW6A 1BGEA 2D48A 2IL6A 5D72A 1SCFA 3UF5A 5KNHI 5D28B 1Y6ML 1LKIA 1AU1A 1M48A 2ERJD 2GMFA 1BCNA 3QB1A 3NCBA 3SE3B 3QWRB 4NEJA 1ALUA 1WU3I 1ETEA 3S9DA 1RW5A 1IL6A 2B8YA 4I77Z 1BBNA 3NPZA 1FYHA 1HWGA 3NCEA 3B5KA 1BGCA 4NKQC 3OQ3A 1BGDA 1ITIA 1IRLA 1CNT1 1M4BA 2E9WC 3QT2C 4X51A 1Y6KL 3L5XA 4O9HA 5FHXA 1INRA 3BPLA 1HWHA 1LK3A 1N1FA 3NCCA 1EMRA 3DLQI 3HHRA 1M47A 4YPGC 1Z7CA 1ITLA 1V7NV 2B8XA 2L3YA 3BESL 1BUYA 2B91A 2CYKA 3WCYI 2O27A 1NBPA
chains in the Genus database with same CATH superfamily
4ZW9A 5FLMD 3QAZA 1Y14A 3BPOA 4RS1A 1EKUA 5IP9D 4WRLB 1CSGA 4Q65A 3SE4B 4APSA 4ZF7A 3UF2A 4LRLA 4BY7D 1Y6NL 3L5WI 3PIVA 1Z92A 4DOHA 4ZYRA 3DGCL 3INKC 3N06A 3O7QA 4TPJA 2C35A 4NI9A 1RHGA 5EQGA 4EXNA 2ILKA 4IKXA 4GRWA 5D22A 5C7XA 2B90A 1VLKA 1I1RB 1A22A 4IU8A 3LB6A 1V7MV 1PY2A 1HIJA 1IARA 5E4EA 4FA8E 3PO2D 3I4MD 3NCFA 5D58A 1Y1WD 2Q98A 3BPNA 5C4XD 4O6KA 1PW6A 2D48A 4LDSA 3HOWD 3QB1A 4NEJA 1ALUA 4LEPA 2XUTA 5C3ED 1RW5A 4I77Z 4A3DD 1HWGA 3IRHA 1PV6A 2VUMD 3TGXB 3L5XA 1LK3A 3NCCA 3HHRA 1PV7A 1V7NV 2L3YA 4NN5A 4GBYA 3WCYI 3HOXD 2V8NA 1NBPA 1HGUA 4DKEA 4D2BA 5D6KA 1ITMA 4J05A 1F45B 4OAAA 4A3ID 2Q7NB 3HOVD 1AXIA 1PVHB 4Z5RD 1PGRA 3D85C 2LMSA 4D2CA 4YQXA 1ITFA 3FKID 4YB9D 4BBRD 1CYLA 4UVMA 4J4LC 3UX9A 5IYBD 1RCBA 2LAGA 2O26A 3I4ND 3PIWA 2L3OA 1IJZA 2B8ZA 3HOYD 1AX8A 4DKCA 4ZS7A 4A3KD 5A2OA 2JA7D 5D70A 3LB6B 3N0PA 1LQSL 2D9QA 3WDOA 1M4RA 1BP3A 3HOZD 2B8UA 5LQBA 1BGEA 5D72A 4GS7A 1AU1A 2GMFA 2O6IA 3SE3B 3QWRB 3S9DA 5IYDD 5IYCD 4BY1D 4IKZA 3NCEA 2Y5YA 5C44D 3OG6A 4ZWBA 3QT2C 4X51A 4DKFA 2XQBA 4BBSD 3DLQI 1M47A 4NN7A 4U4VA 5D59A 2B91A 4XNJA 2CYKA 2O27A 1EXZA 2PSMA 3MZGA 4OH3A 4YUEC 2CFQA 1A7MA 2JA8D 3H3VE 5A2NA 1M49A 2Q14A 3H0GD 5D71A 5L6YC 1B5LA 3HHCA 2INTA 1ILKA 4IU9A 1YKBA 4MHLA 3D48P 3O7PA 1CD9A 1D9CA 1P9MB 2H24A 3DI2A 3EW3A 4A3MD 4NI7A 1EERA 3AYHA 1M4CA 3G6DA 3G9VB 3PO3D 4A3GD 4PYPA 4IKYA 1KF9A 3OG4A 2R7ZD 1EVSA 2KZ1A 1WCMD 3UEZE 1J7VL 4GC0A 2IL6A 2R92D 1SCFA 3UF5A 5D28B 1LKIA 2ERJD 3NCBA 1ETEA 2B8YA 4QIQA 5GXBA 3HOUD 2CFPA 1BGCA 4A3JD 4NKQC 3OQ3A 1M4BA 4ZWCA 4TPHA 4O9HA 5FHXA 1INRA 4NN6A 1EMRA 1Z7CA 1ITLA 3BESL 1BUYA 2JA6D 4DKDA 4TPGA 4IKVA 3QB7A 1HUWA 4A3BD 1HZIA 1HULA 2Z3RA 4EXPA 2JA5D 4NEMA 3VA2A 2OQPA 1RFBA 1IK0A 1D9GA 1FG9A 4IKWA 4D2DA 4PS4A 4A93D 3DUHC 4JA3A 5FUCA 4JR9A 1M4AA 3HMXB 4YDYI 4A3CD 1Y1VD 2B5IA 3D87A 1HIKA 1QVNA 1JLIA 1CN4C 1GNCA 3EJJA 4JREA 3DI3A 4A3FD 1GA3A 1PW4A 3Q1SI 5EQHA 4A3LD 2HYMB 4CNIC 1F6FA 2Z3QA 5EQIA 5C65A 5KNHI 1Y6ML 1M48A 2B63D 1BCNA 5TS9A 1WU3I 2R93D 1IL6A 4XNIA 4U4TA 1BBNA 3NPZA 1FYHA 3B5KA 4GBZA 4YBQA 1BGDA 1ITIA 1IRLA 1CNT1 2E9WC 1Y6KL 5IP7D 3BPLA 1HWHA 1N1FA 4YPGC 4U4WA 4A3ED 2B8XA 4BXXD 4W6VA
chains in the Genus database with same CATH topology
2JA6D 1HGUA 1EXZA 4DKEA 2PSMA 3MZGA 1ITMA 5FLMD 4DKDA 3QAZA 4YUEC 1F45B 3QB7A 1HUWA 4A3BD 1A7MA 1Y14A 2JA8D 3BPOA 4RS1A 4A3ID 1EKUA 5IP9D 3H3VE 2Q7NB 1HZIA 3HOVD 4WRLB 1CSGA 1AXIA 1PVHB 1HULA 1M49A 4Z5RD 2Z3RA 1PGRA 2Q14A 2LMSA 3D85C 3H0GD 3SE4B 4ZF7A 3UF2A 4EXPA 4LRLA 2JA5D 4NEMA 3VA2A 2OQPA 4BY7D 1Y6NL 5D71A 4YQXA 1RFBA 3L5WI 3PIVA 1ITFA 1Z92A 4DOHA 5L6YC 3DGCL 1B5LA 3HHCA 2INTA 1ILKA 3INKC 3FKID 3N06A 4BBRD 1D9GA 1FG9A 1YKBA 1IK0A 4MHLA 1CYLA 3D48P 4PS4A 4J4LC 1CD9A 1D9CA 1P9MB 3UX9A 5IYBD 4A93D 3DUHC 2H24A 3DI2A 2C35A 3EW3A 4NI9A 4A3MD 4NI7A 1RHGA 5FUCA 4EXNA 1EERA 1RCBA 2ILKA 3AYHA 1M4CA 4GRWA 2LAGA 5D22A 5C7XA 2O26A 3I4ND 2B90A 1VLKA 3PIWA 2L3OA 1I1RB 1M4AA 3HMXB 1IJZA 4YDYI 2B8ZA 1Y1VD 2B5IA 4A3CD 3HOYD 1AX8A 4DKCA 3G6DA 1A22A 4ZS7A 3D87A 3LB6A 3G9VB 3PO3D 1V7MV 4A3KD 1HIKA 1QVNA 4A3GD 1JLIA 1CN4C 1PY2A 2JA7D 5D70A 1GNCA 1HIJA 3EJJA 1IARA 1KF9A 5E4EA 3OG4A 3LB6B 4FA8E 3PO2D 3DI3A 4A3FD 1GA3A 3N0PA 3I4MD 3NCFA 1Y1WD 2Q98A 3Q1SI 1LQSL 4A3LD 2R7ZD 2HYMB 3BPNA 1EVSA 2D9QA 4CNIC 5C4XD 2KZ1A 1F6FA 1M4RA 1WCMD 1BP3A 2Z3QA 3HOZD 3UEZE 2B8UA 5LQBA 4O6KA 1J7VL 1PW6A 1BGEA 2D48A 2IL6A 2R92D 5D72A 4GS7A 1SCFA 3UF5A 5KNHI 5D28B 1Y6ML 1LKIA 1AU1A 1M48A 3HOWD 2B63D 2ERJD 2GMFA 1BCNA 3QB1A 2O6IA 3NCBA 3SE3B 3QWRB 4NEJA 5TS9A 1ALUA 1WU3I 1ETEA 3S9DA 5IYDD 2R93D 5C3ED 1RW5A 1IL6A 5IYCD 2B8YA 4I77Z 1BBNA 3HOUD 4A3DD 3NPZA 4BY1D 1FYHA 1HWGA 3NCEA 3B5KA 5C44D 1BGCA 3IRHA 3OG6A 4NKQC 4A3JD 3OQ3A 1BGDA 1ITIA 1IRLA 1CNT1 1M4BA 2E9WC 3QT2C 4X51A 1Y6KL 3TGXB 2VUMD 5IP7D 4DKFA 2XQBA 3L5XA 4O9HA 1INRA 3BPLA 5FHXA 4BBSD 1HWHA 4NN6A 1LK3A 1N1FA 3NCCA 1EMRA 3DLQI 3HHRA 1M47A 4YPGC 4A3ED 1Z7CA 1ITLA 1V7NV 2B8XA 4NN7A 2L3YA 3BESL 4BXXD 1BUYA 2B91A 2CYKA 4NN5A 3WCYI 2O27A 3HOXD 1NBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGU A;  1EXZ A;  3MZG A;  1ITM A;  3QAZ A;  4YUE C;  1F45 B;  3QB7 A;  1HUW A;  1A7M A;  3BPO A;  4RS1 A;  1EKU A;  2Q7N B;  1HZI A;  4WRL B;  1CSG A;  1AXI A;  1PVH B;  1HUL A;  1M49 A;  4Z5R D;  3SE4 B;  1PGR A;  3D85 C;  2LMS A;  4ZF7 A;  3UF2 A;  4NEM A;  3VA2 A;  1Y6N L;  5D71 A;  4YQX A;  1RFB A;  3L5W I;  3PIV A;  1ITF A;  1Z92 A;  4DOH A;  5L6Y C;  3DGC L;  1B5L A;  2INT A;  1ILK A;  3INK C;  3N06 A;  1IK0 A;  1D9G A;  1FG9 A;  1YKB A;  4MHL A;  1CYL A;  3D48 P;  4PS4 A;  4J4L C;  1CD9 A;  1D9C A;  1P9M B;  3UX9 A;  3DUH C;  2H24 A;  3EW3 A;  4NI9 A;  4NI7 A;  1RHG A;  5FUC A;  1EER A;  1RCB A;  2ILK A;  1M4C A;  4GRW A;  2LAG A;  5D22 A;  5C7X A;  2O26 A;  2B90 A;  1VLK A;  3PIW A;  2L3O A;  1I1R B;  1M4A A;  3HMX B;  1IJZ A;  4YDY I;  2B8Z A;  2B5I A;  1AX8 A;  3G6D A;  1A22 A;  4ZS7 A;  3D87 A;  3LB6 A;  3G9V B;  1V7M V;  1HIK A;  1QVN A;  1JLI A;  1CN4 C;  1PY2 A;  1GNC A;  5D70 A;  1HIJ A;  3EJJ A;  1IAR A;  1KF9 A;  5E4E A;  3LB6 B;  4FA8 E;  1GA3 A;  3N0P A;  3NCF A;  2Q98 A;  3Q1S I;  1LQS L;  2HYM B;  3BPN A;  1EVS A;  2D9Q A;  4CNI C;  2KZ1 A;  1F6F A;  1M4R A;  1BP3 A;  3UEZ E;  2B8U A;  5LQB A;  4O6K A;  1J7V L;  1PW6 A;  1BGE A;  2D48 A;  2IL6 A;  5D72 A;  1SCF A;  3UF5 A;  5KNH I;  5D28 B;  1Y6M L;  1LKI A;  1AU1 A;  1M48 A;  2ERJ D;  2GMF A;  1BCN A;  3QB1 A;  3NCB A;  3SE3 B;  3QWR B;  4NEJ A;  1ALU A;  1WU3 I;  1ETE A;  3S9D A;  1RW5 A;  1IL6 A;  2B8Y A;  4I77 Z;  1BBN A;  3NPZ A;  1FYH A;  1HWG A;  3NCE A;  3B5K A;  1BGC A;  4NKQ C;  3OQ3 A;  1BGD A;  1ITI A;  1IRL A;  1CNT 1;  1M4B A;  2E9W C;  3QT2 C;  4X51 A;  1Y6K L;  3L5X A;  4O9H A;  5FHX A;  1INR A;  3BPL A;  1HWH A;  1LK3 A;  1N1F A;  3NCC A;  1EMR A;  3DLQ I;  3HHR A;  1M47 A;  4YPG C;  1Z7C A;  1ITL A;  1V7N V;  2B8X A;  2L3Y A;  3BES L;  1BUY A;  2B91 A;  2CYK A;  3WCY I;  2O27 A;  1NBP A; 
#chains in the Genus database with same CATH topology
 4ZW9 A;  5FLM D;  3QAZ A;  1Y14 A;  3BPO A;  4RS1 A;  1EKU A;  5IP9 D;  4WRL B;  1CSG A;  4Q65 A;  3SE4 B;  4APS A;  4ZF7 A;  3UF2 A;  4LRL A;  4BY7 D;  1Y6N L;  3L5W I;  3PIV A;  1Z92 A;  4DOH A;  4ZYR A;  3DGC L;  3INK C;  3N06 A;  3O7Q A;  4TPJ A;  2C35 A;  4NI9 A;  1RHG A;  5EQG A;  4EXN A;  2ILK A;  4IKX A;  4GRW A;  5D22 A;  5C7X A;  2B90 A;  1VLK A;  1I1R B;  1A22 A;  4IU8 A;  3LB6 A;  1V7M V;  1PY2 A;  1HIJ A;  1IAR A;  5E4E A;  4FA8 E;  3PO2 D;  3I4M D;  3NCF A;  5D58 A;  1Y1W D;  2Q98 A;  3BPN A;  5C4X D;  4O6K A;  1PW6 A;  2D48 A;  4LDS A;  3HOW D;  3QB1 A;  4NEJ A;  1ALU A;  4LEP A;  2XUT A;  5C3E D;  1RW5 A;  4I77 Z;  4A3D D;  1HWG A;  3IRH A;  1PV6 A;  2VUM D;  3TGX B;  3L5X A;  1LK3 A;  3NCC A;  3HHR A;  1PV7 A;  1V7N V;  2L3Y A;  4NN5 A;  4GBY A;  3WCY I;  3HOX D;  2V8N A;  1NBP A;  1HGU A;  4DKE A;  4D2B A;  5D6K A;  1ITM A;  4J05 A;  1F45 B;  4OAA A;  4A3I D;  2Q7N B;  3HOV D;  1AXI A;  1PVH B;  4Z5R D;  1PGR A;  3D85 C;  2LMS A;  4D2C A;  4YQX A;  1ITF A;  3FKI D;  4YB9 D;  4BBR D;  1CYL A;  4UVM A;  4J4L C;  3UX9 A;  5IYB D;  1RCB A;  2LAG A;  2O26 A;  3I4N D;  3PIW A;  2L3O A;  1IJZ A;  2B8Z A;  3HOY D;  1AX8 A;  4DKC A;  4ZS7 A;  4A3K D;  5A2O A;  2JA7 D;  5D70 A;  3LB6 B;  3N0P A;  1LQS L;  2D9Q A;  3WDO A;  1M4R A;  1BP3 A;  3HOZ D;  2B8U A;  5LQB A;  1BGE A;  5D72 A;  4GS7 A;  1AU1 A;  2GMF A;  2O6I A;  3SE3 B;  3QWR B;  3S9D A;  5IYD D;  5IYC D;  4BY1 D;  4IKZ A;  3NCE A;  2Y5Y A;  5C44 D;  3OG6 A;  4ZWB A;  3QT2 C;  4X51 A;  4DKF A;  2XQB A;  4BBS D;  3DLQ I;  1M47 A;  4NN7 A;  4U4V A;  5D59 A;  2B91 A;  4XNJ A;  2CYK A;  2O27 A;  1EXZ A;  2PSM A;  3MZG A;  4OH3 A;  4YUE C;  2CFQ A;  1A7M A;  2JA8 D;  3H3V E;  5A2N A;  1M49 A;  2Q14 A;  3H0G D;  5D71 A;  5L6Y C;  1B5L A;  3HHC A;  2INT A;  1ILK A;  4IU9 A;  1YKB A;  4MHL A;  3D48 P;  3O7P A;  1CD9 A;  1D9C A;  1P9M B;  2H24 A;  3DI2 A;  3EW3 A;  4A3M D;  4NI7 A;  1EER A;  3AYH A;  1M4C A;  3G6D A;  3G9V B;  3PO3 D;  4A3G D;  4PYP A;  4IKY A;  1KF9 A;  3OG4 A;  2R7Z D;  1EVS A;  2KZ1 A;  1WCM D;  3UEZ E;  1J7V L;  4GC0 A;  2IL6 A;  2R92 D;  1SCF A;  3UF5 A;  5D28 B;  1LKI A;  2ERJ D;  3NCB A;  1ETE A;  2B8Y A;  4QIQ A;  5GXB A;  3HOU D;  2CFP A;  1BGC A;  4A3J D;  4NKQ C;  3OQ3 A;  1M4B A;  4ZWC A;  4TPH A;  4O9H A;  5FHX A;  1INR A;  4NN6 A;  1EMR A;  1Z7C A;  1ITL A;  3BES L;  1BUY A;  2JA6 D;  4DKD A;  4TPG A;  4IKV A;  3QB7 A;  1HUW A;  4A3B D;  1HZI A;  1HUL A;  2Z3R A;  4EXP A;  2JA5 D;  4NEM A;  3VA2 A;  2OQP A;  1RFB A;  1IK0 A;  1D9G A;  1FG9 A;  4IKW A;  4D2D A;  4PS4 A;  4A93 D;  3DUH C;  4JA3 A;  5FUC A;  4JR9 A;  1M4A A;  3HMX B;  4YDY I;  4A3C D;  1Y1V D;  2B5I A;  3D87 A;  1HIK A;  1QVN A;  1JLI A;  1CN4 C;  1GNC A;  3EJJ A;  4JRE A;  3DI3 A;  4A3F D;  1GA3 A;  1PW4 A;  3Q1S I;  5EQH A;  4A3L D;  2HYM B;  4CNI C;  1F6F A;  2Z3Q A;  5EQI A;  5C65 A;  5KNH I;  1Y6M L;  1M48 A;  2B63 D;  1BCN A;  5TS9 A;  1WU3 I;  2R93 D;  1IL6 A;  4XNI A;  4U4T A;  1BBN A;  3NPZ A;  1FYH A;  3B5K A;  4GBZ A;  4YBQ A;  1BGD A;  1ITI A;  1IRL A;  1CNT 1;  2E9W C;  1Y6K L;  5IP7 D;  3BPL A;  1HWH A;  1N1F A;  4YPG C;  4U4W A;  4A3E D;  2B8X A;  4BXX D;  4W6V A; 
#chains in the Genus database with same CATH homology
 2JA6 D;  1HGU A;  1EXZ A;  4DKE A;  2PSM A;  3MZG A;  1ITM A;  5FLM D;  4DKD A;  3QAZ A;  4YUE C;  1F45 B;  3QB7 A;  1HUW A;  4A3B D;  1A7M A;  1Y14 A;  2JA8 D;  3BPO A;  4RS1 A;  4A3I D;  1EKU A;  5IP9 D;  3H3V E;  2Q7N B;  1HZI A;  3HOV D;  4WRL B;  1CSG A;  1AXI A;  1PVH B;  1HUL A;  1M49 A;  4Z5R D;  2Z3R A;  1PGR A;  2Q14 A;  2LMS A;  3D85 C;  3H0G D;  3SE4 B;  4ZF7 A;  3UF2 A;  4EXP A;  4LRL A;  2JA5 D;  4NEM A;  3VA2 A;  2OQP A;  4BY7 D;  1Y6N L;  5D71 A;  4YQX A;  1RFB A;  3L5W I;  3PIV A;  1ITF A;  1Z92 A;  4DOH A;  5L6Y C;  3DGC L;  1B5L A;  3HHC A;  2INT A;  1ILK A;  3INK C;  3FKI D;  3N06 A;  4BBR D;  1D9G A;  1FG9 A;  1YKB A;  1IK0 A;  4MHL A;  1CYL A;  3D48 P;  4PS4 A;  4J4L C;  1CD9 A;  1D9C A;  1P9M B;  3UX9 A;  5IYB D;  4A93 D;  3DUH C;  2H24 A;  3DI2 A;  2C35 A;  3EW3 A;  4NI9 A;  4A3M D;  4NI7 A;  1RHG A;  5FUC A;  4EXN A;  1EER A;  1RCB A;  2ILK A;  3AYH A;  1M4C A;  4GRW A;  2LAG A;  5D22 A;  5C7X A;  2O26 A;  3I4N D;  2B90 A;  1VLK A;  3PIW A;  2L3O A;  1I1R B;  1M4A A;  3HMX B;  1IJZ A;  4YDY I;  2B8Z A;  1Y1V D;  2B5I A;  4A3C D;  3HOY D;  1AX8 A;  4DKC A;  3G6D A;  1A22 A;  4ZS7 A;  3D87 A;  3LB6 A;  3G9V B;  3PO3 D;  1V7M V;  4A3K D;  1HIK A;  1QVN A;  4A3G D;  1JLI A;  1CN4 C;  1PY2 A;  2JA7 D;  5D70 A;  1GNC A;  1HIJ A;  3EJJ A;  1IAR A;  1KF9 A;  5E4E A;  3OG4 A;  3LB6 B;  4FA8 E;  3PO2 D;  3DI3 A;  4A3F D;  1GA3 A;  3N0P A;  3I4M D;  3NCF A;  1Y1W D;  2Q98 A;  3Q1S I;  1LQS L;  4A3L D;  2R7Z D;  2HYM B;  3BPN A;  1EVS A;  2D9Q A;  4CNI C;  5C4X D;  2KZ1 A;  1F6F A;  1M4R A;  1WCM D;  1BP3 A;  2Z3Q A;  3HOZ D;  3UEZ E;  2B8U A;  5LQB A;  4O6K A;  1J7V L;  1PW6 A;  1BGE A;  2D48 A;  2IL6 A;  2R92 D;  5D72 A;  4GS7 A;  1SCF A;  3UF5 A;  5KNH I;  5D28 B;  1Y6M L;  1LKI A;  1AU1 A;  1M48 A;  3HOW D;  2B63 D;  2ERJ D;  2GMF A;  1BCN A;  3QB1 A;  2O6I A;  3NCB A;  3SE3 B;  3QWR B;  4NEJ A;  5TS9 A;  1ALU A;  1WU3 I;  1ETE A;  3S9D A;  5IYD D;  2R93 D;  5C3E D;  1RW5 A;  1IL6 A;  5IYC D;  2B8Y A;  4I77 Z;  1BBN A;  3HOU D;  4A3D D;  3NPZ A;  4BY1 D;  1FYH A;  1HWG A;  3NCE A;  3B5K A;  5C44 D;  1BGC A;  3IRH A;  3OG6 A;  4NKQ C;  4A3J D;  3OQ3 A;  1BGD A;  1ITI A;  1IRL A;  1CNT 1;  1M4B A;  2E9W C;  3QT2 C;  4X51 A;  1Y6K L;  3TGX B;  2VUM D;  5IP7 D;  4DKF A;  2XQB A;  3L5X A;  4O9H A;  1INR A;  3BPL A;  5FHX A;  4BBS D;  1HWH A;  4NN6 A;  1LK3 A;  1N1F A;  3NCC A;  1EMR A;  3DLQ I;  3HHR A;  1M47 A;  4YPG C;  4A3E D;  1Z7C A;  1ITL A;  1V7N V;  2B8X A;  4NN7 A;  2L3Y A;  3BES L;  4BXX D;  1BUY A;  2B91 A;  2CYK A;  4NN5 A;  3WCY I;  2O27 A;  3HOX D;  1NBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...