1BGDA

Crystal structure of canine and bovine granulocyte-colony stimulating factor (g-csf)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
164
structure length
157
Chain Sequence
LPQSFLLKCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQPPLSSCSSQALQLMGCLRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMAPTMPAFTSAFQRRAGGVLVASNLQSFLELAYRALRHFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of canine and bovine granulocyte-colony stimulating factor (G-CSF).
pubmed doi rcsb
molecule keywords GRANULOCYTE COLONY-STIMULATING FACTOR
molecule tags Cytokine
source organism Canis lupus familiaris
total genus 65
structure length 157
sequence length 164
ec nomenclature
pdb deposition date 1993-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16647 GCSF Granulocyte colony-stimulating factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1bgdA00
1V7NV 1AXIA 1WU3I 2B8ZA 4YUEC 1IK0A 3D87A 3QT2C 1QVNA 3N0PA 4CNIC 4DOHA 3NCCA 1HGUA 1Y6ML 1BGDA 4NEJA 4YDYI 2L3YA 2B91A 3PIWA 4WRLB 3BPLA 1NBPA 5FUCA 3UF2A 5L6YC 4NKQC 1M4BA 2LMSA 2O26A 3HHRA 3BESL 1AU1A 1A22A 1F6FA 1EMRA 4PS4A 5FHXA 3G6DA 4NI9A 1D9GA 1ITLA 2HYMB 1LK3A 4I77Z 3VA2A 1J7VL 4ZF7A 1Z92A 5C7XA 3BPOA 3D48P 3MZGA 1Y6KL 1CD9A 1PY2A 3SE4B 3L5WI 3LB6A 1RHGA 3Q1SI 2B8UA 1HZIA 5D71A 1HIJA 2L3OA 3S9DA 3D85C 1F45B 1IARA 1ILKA 4X51A 2B8XA 2B5IA 3NPZA 2LAGA 1I1RB 2E9WC 3NCBA 3PIVA 1SCFA 4YQXA 3B5KA 3INKC 1BBNA 3N06A 1M4CA 1ALUA 1M47A 1HIKA 1PW6A 5D70A 3DLQI 2CYKA 4J4LC 1VLKA 1BGEA 1EXZA 1GNCA 2ILKA 1ITMA 3UX9A 1HWGA 2Q98A 3WCYI 3QWRB 2ERJD 1FG9A 1N1FA 1ETEA 1INRA 1LQSL 5E4EA 1ITFA 1CYLA 1CSGA 5KNHI 1P9MB 2IL6A 1AX8A 2B90A 1RCBA 1JLIA 1EVSA 3BPNA 2D9QA 1BGCA 1CN4C 1FYHA 2H24A 1IL6A 1PVHB 1BP3A 1RFBA 1M49A 3EJJA 5LQBA 1RW5A 3NCFA 3LB6B 1HUWA 5D28B 3HMXB 1IRLA 3QAZA 5D22A 2B8YA 1ITIA 1HWHA 1M48A 1PGRA 3SE3B 3UF5A 4GRWA 1B5LA 3NCEA 4RS1A 1BUYA 1IJZA 3DGCL 3QB7A 2GMFA 2INTA 4MHLA 2Q7NB 1EKUA 2O27A 3OQ3A 1D9CA 4NEMA 1M4RA 2D48A 4YPGC 4O9HA 1Z7CA 3EW3A 2KZ1A 3L5XA 4FA8E 4O6KA 1KF9A 1CNT1 1HULA 5D72A 1YKBA 1M4AA 3G9VB 1V7MV 3QB1A 1Y6NL 1BCNA 1A7MA 4Z5RD 1GA3A 3UEZE 4ZS7A 1LKIA 1EERA 4NI7A 3DUHC
chains in the Genus database with same CATH superfamily
1V7NV 1AXIA 4OAAA 2VUMD 4DOHA 4NEJA 4YDYI 4QIQA 5FUCA 1NBPA 3UF2A 5TS9A 5L6YC 3HHRA 1AU1A 3IRHA 3O7QA 4BXXD 4ZF7A 1Z92A 4JA3A 5C7XA 3BPOA 3MZGA 1CD9A 3HOUD 2JA5D 1F45B 1ILKA 3NPZA 1Y14A 2E9WC 3NCBA 4NN6A 4A3LD 3PIVA 3B5KA 3N06A 1M4CA 1PW6A 4ZYRA 1VLKA 1GNCA 2ILKA 1HWGA 3WCYI 3QWRB 2JA6D 2R92D 1Y1WD 2B90A 1RCBA 1BGCA 4GBZA 1HUWA 3HMXB 1IRLA 4IKWA 5EQIA 4GS7A 4UVMA 3I4ND 3UF5A 3QB7A 3OQ3A 1D9CA 4YPGC 2D48A 4TPJA 3AYHA 4FA8E 1CNT1 4LDSA 2OQPA 4Z5RD 2B63D 3UEZE 3OG6A 4A3MD 5FLMD 4BY7D 4A3FD 2XQBA 5A2OA 4D2DA 1Y6ML 4IU8A 5C65A 5D59A 4NKQC 2LMSA 2O26A 4DKDA 5IYCD 4IKXA 4PS4A 5FHXA 4IKZA 3I4MD 4Q65A 4I77Z 3VA2A 1J7VL 3HHCA 3D48P 1Y6KL 3Q1SI 4XNJA 3S9DA 3D85C 4A3GD 4XNIA 3HOZD 4IU9A 1HIKA 4PYPA 3DLQI 1Y1VD 2CYKA 5A2NA 4A3DD 3UX9A 2ERJD 2CFQA 4GBYA 4IKVA 1LQSL 5E4EA 3PO3D 1ITFA 1CYLA 2IL6A 1AX8A 1EVSA 4ZWBA 1BP3A 4A3ED 5EQGA 4A93D 4BBSD 3LB6B 4TPGA 4U4VA 3QAZA 4EXNA 4ZW9A 2Z3RA 3PO2D 4LRLA 4GRWA 3NCEA 4RS1A 1BUYA 5D58A 4MHLA 2JA8D 3FKID 2O27A 2KZ1A 4U4WA 1BCNA 1YKBA 1V7MV 2JA7D 1GA3A 1LKIA 1EERA 3DUHC 1WU3I 5D6KA 2B8ZA 4YUEC 1IK0A 3D87A 2XUTA 1QVNA 4CNIC 5IYBD 1HGUA 1BGDA 2R7ZD 5C4XD 3HOXD 4WRLB 3H3VE 1PV6A 1M4BA 3BESL 1A22A 1EMRA 3G6DA 4NI9A 3DI2A 3O7PA 1D9GA 1ITLA 4IKYA 4APSA 2Z3QA 1PY2A 3L5WI 3LB6A 4A3ID 3DI3A 3WDOA 5D71A 2L3OA 3H0GD 1IARA 4LEPA 2B8XA 2B5IA 4NN5A 4D2CA 1SCFA 4YQXA 3INKC 5IYDD 2CFPA 4EXPA 1PV7A 1EXZA 1ITMA 4DKCA 2Q98A 4JR9A 1FG9A 3OG4A 4A3BD 4J05A 1CSGA 5KNHI 4GC0A 1JLIA 3HOYD 1CN4C 4OH3A 2V8NA 1PVHB 1RFBA 1M49A 5D28B 1ITIA 3SE3B 1IJZA 1EKUA 4NEMA 1PW4A 3HOWD 1Z7CA 4O6KA 5D72A 1A7MA 2C35A 4DKEA 5GXBA 3QT2C 3N0PA 4BBRD 5C44D 3NCCA 4W6VA 2R93D 2L3YA 2B91A 3PIWA 3BPLA 4TPHA 5IP9D 1F6FA 2HYMB 1LK3A 2PSMA 3SE4B 4BY1D 1RHGA 2B8UA 1HZIA 1HIJA 4YBQA 4ZWCA 4X51A 2LAGA 1I1RB 3HOVD 4NN7A 3TGXB 4D2BA 1BBNA 5IP7D 1ALUA 1M47A 2Y5YA 5D70A 5EQHA 4J4LC 4A3KD 1BGEA 1N1FA 1ETEA 1INRA 4A3CD 1P9MB 3BPNA 2D9QA 1FYHA 2H24A 1IL6A 2Q14A 3EJJA 5LQBA 4JREA 1RW5A 2O6IA 3NCFA 5D22A 2B8YA 1HWHA 1M48A 1PGRA 1B5LA 3DGCL 2GMFA 2INTA 5C3ED 2Q7NB 4YB9D 1M4RA 4O9HA 3EW3A 4DKFA 3L5XA 1KF9A 1HULA 1M4AA 3G9VB 3QB1A 4U4TA 1Y6NL 4A3JD 1WCMD 4ZS7A 4NI7A
chains in the Genus database with same CATH topology
1V7NV 1AXIA 1WU3I 2B8ZA 4YUEC 4DKEA 3D87A 1IK0A 4A3FD 2XQBA 3QT2C 1QVNA 3N0PA 4BBRD 4CNIC 4DOHA 5IYBD 3NCCA 1HGUA 5C44D 1Y6ML 1BGDA 2R93D 4NEJA 4YDYI 3HOXD 2R7ZD 5C4XD 2L3YA 2B91A 3PIWA 4WRLB 3BPLA 1NBPA 5FUCA 3H3VE 3UF2A 5TS9A 5L6YC 4NKQC 1M4BA 2LMSA 2O26A 3HHRA 3BESL 1AU1A 5IP9D 4DKDA 1A22A 5IYCD 1F6FA 1EMRA 3IRHA 4PS4A 5FHXA 3I4MD 3G6DA 4NI9A 3DI2A 1D9GA 1ITLA 2HYMB 4BXXD 1LK3A 4I77Z 3VA2A 1J7VL 4ZF7A 1Z92A 3HHCA 2Z3QA 5C7XA 2PSMA 3BPOA 3D48P 3MZGA 1Y6KL 1CD9A 1PY2A 3SE4B 3L5WI 3LB6A 1RHGA 4A3ID 4BY1D 3HOUD 3Q1SI 2B8UA 3DI3A 2JA5D 1HZIA 5D71A 1HIJA 2L3OA 3H0GD 3S9DA 3D85C 1F45B 1IARA 1ILKA 4X51A 2B8XA 2B5IA 3NPZA 1Y14A 4NN5A 4A3GD 2LAGA 1I1RB 2E9WC 3HOVD 3NCBA 4NN6A 4A3LD 4NN7A 3HOZD 3PIVA 1SCFA 4YQXA 3B5KA 3TGXB 3INKC 5IYDD 1BBNA 3N06A 2VUMD 1M4CA 5IP7D 1ALUA 1M47A 1HIKA 1PW6A 5D70A 3DLQI 1Y1VD 2CYKA 4EXPA 4J4LC 1VLKA 4A3KD 1BGEA 1EXZA 1GNCA 2ILKA 1ITMA 3UX9A 4DKCA 4A3DD 1HWGA 2Q98A 3WCYI 3QWRB 2JA6D 2ERJD 1FG9A 1N1FA 1ETEA 1INRA 1LQSL 2R92D 5E4EA 1Y1WD 3PO3D 3OG4A 4A3BD 4A3CD 1ITFA 1CYLA 1CSGA 5KNHI 1P9MB 2IL6A 1AX8A 2B90A 1RCBA 1JLIA 3HOYD 1EVSA 3BPNA 2D9QA 1BGCA 1CN4C 1FYHA 2H24A 1IL6A 1PVHB 1BP3A 1RFBA 1M49A 2Q14A 4A3ED 3EJJA 5LQBA 1RW5A 2O6IA 4BBSD 4A93D 3NCFA 3LB6B 1HUWA 5D28B 3HMXB 1IRLA 3QAZA 4GS7A 5D22A 4EXNA 2B8YA 1ITIA 1HWHA 1M48A 1PGRA 2Z3RA 4LRLA 3SE3B 3UF5A 3I4ND 4GRWA 3PO2D 1B5LA 3NCEA 4RS1A 1BUYA 1IJZA 3DGCL 3QB7A 2GMFA 2INTA 5C3ED 4MHLA 2Q7NB 2JA8D 1EKUA 3FKID 2O27A 3OQ3A 1D9CA 4NEMA 1M4RA 2D48A 4YPGC 4O9HA 3HOWD 1Z7CA 3AYHA 3EW3A 2KZ1A 3L5XA 4DKFA 4FA8E 4O6KA 1KF9A 1CNT1 1HULA 2OQPA 1YKBA 1M4AA 3G9VB 1V7MV 3QB1A 1Y6NL 5D72A 4A3JD 1BCNA 1A7MA 4Z5RD 2JA7D 2B63D 1WCMD 2C35A 1GA3A 3UEZE 4ZS7A 4A3MD 1LKIA 1EERA 3OG6A 4NI7A 5FLMD 3DUHC 4BY7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V7N V;  1AXI A;  1WU3 I;  2B8Z A;  4YUE C;  1IK0 A;  3D87 A;  3QT2 C;  1QVN A;  3N0P A;  4CNI C;  4DOH A;  3NCC A;  1HGU A;  1Y6M L;  1BGD A;  4NEJ A;  4YDY I;  2L3Y A;  2B91 A;  3PIW A;  4WRL B;  3BPL A;  1NBP A;  5FUC A;  3UF2 A;  5L6Y C;  4NKQ C;  1M4B A;  2LMS A;  2O26 A;  3HHR A;  3BES L;  1AU1 A;  1A22 A;  1F6F A;  1EMR A;  4PS4 A;  5FHX A;  3G6D A;  4NI9 A;  1D9G A;  1ITL A;  2HYM B;  1LK3 A;  4I77 Z;  3VA2 A;  1J7V L;  4ZF7 A;  1Z92 A;  5C7X A;  3BPO A;  3D48 P;  3MZG A;  1Y6K L;  1CD9 A;  1PY2 A;  3SE4 B;  3L5W I;  3LB6 A;  1RHG A;  3Q1S I;  2B8U A;  1HZI A;  5D71 A;  1HIJ A;  2L3O A;  3S9D A;  3D85 C;  1F45 B;  1IAR A;  1ILK A;  4X51 A;  2B8X A;  2B5I A;  3NPZ A;  2LAG A;  1I1R B;  2E9W C;  3NCB A;  3PIV A;  1SCF A;  4YQX A;  3B5K A;  3INK C;  1BBN A;  3N06 A;  1M4C A;  1ALU A;  1M47 A;  1HIK A;  1PW6 A;  5D70 A;  3DLQ I;  2CYK A;  4J4L C;  1VLK A;  1BGE A;  1EXZ A;  1GNC A;  2ILK A;  1ITM A;  3UX9 A;  1HWG A;  2Q98 A;  3WCY I;  3QWR B;  2ERJ D;  1FG9 A;  1N1F A;  1ETE A;  1INR A;  1LQS L;  5E4E A;  1ITF A;  1CYL A;  1CSG A;  5KNH I;  1P9M B;  2IL6 A;  1AX8 A;  2B90 A;  1RCB A;  1JLI A;  1EVS A;  3BPN A;  2D9Q A;  1BGC A;  1CN4 C;  1FYH A;  2H24 A;  1IL6 A;  1PVH B;  1BP3 A;  1RFB A;  1M49 A;  3EJJ A;  5LQB A;  1RW5 A;  3NCF A;  3LB6 B;  1HUW A;  5D28 B;  3HMX B;  1IRL A;  3QAZ A;  5D22 A;  2B8Y A;  1ITI A;  1HWH A;  1M48 A;  1PGR A;  3SE3 B;  3UF5 A;  4GRW A;  1B5L A;  3NCE A;  4RS1 A;  1BUY A;  1IJZ A;  3DGC L;  3QB7 A;  2GMF A;  2INT A;  4MHL A;  2Q7N B;  1EKU A;  2O27 A;  3OQ3 A;  1D9C A;  4NEM A;  1M4R A;  2D48 A;  4YPG C;  4O9H A;  1Z7C A;  3EW3 A;  2KZ1 A;  3L5X A;  4FA8 E;  4O6K A;  1KF9 A;  1CNT 1;  1HUL A;  5D72 A;  1YKB A;  1M4A A;  3G9V B;  1V7M V;  3QB1 A;  1Y6N L;  1BCN A;  1A7M A;  4Z5R D;  1GA3 A;  3UEZ E;  4ZS7 A;  1LKI A;  1EER A;  4NI7 A;  3DUH C; 
#chains in the Genus database with same CATH topology
 1V7N V;  1AXI A;  4OAA A;  2VUM D;  4DOH A;  4NEJ A;  4YDY I;  4QIQ A;  5FUC A;  1NBP A;  3UF2 A;  5TS9 A;  5L6Y C;  3HHR A;  1AU1 A;  3IRH A;  3O7Q A;  4BXX D;  4ZF7 A;  1Z92 A;  4JA3 A;  5C7X A;  3BPO A;  3MZG A;  1CD9 A;  3HOU D;  2JA5 D;  1F45 B;  1ILK A;  3NPZ A;  1Y14 A;  2E9W C;  3NCB A;  4NN6 A;  4A3L D;  3PIV A;  3B5K A;  3N06 A;  1M4C A;  1PW6 A;  4ZYR A;  1VLK A;  1GNC A;  2ILK A;  1HWG A;  3WCY I;  3QWR B;  2JA6 D;  2R92 D;  1Y1W D;  2B90 A;  1RCB A;  1BGC A;  4GBZ A;  1HUW A;  3HMX B;  1IRL A;  4IKW A;  5EQI A;  4GS7 A;  4UVM A;  3I4N D;  3UF5 A;  3QB7 A;  3OQ3 A;  1D9C A;  4YPG C;  2D48 A;  4TPJ A;  3AYH A;  4FA8 E;  1CNT 1;  4LDS A;  2OQP A;  4Z5R D;  2B63 D;  3UEZ E;  3OG6 A;  4A3M D;  5FLM D;  4BY7 D;  4A3F D;  2XQB A;  5A2O A;  4D2D A;  1Y6M L;  4IU8 A;  5C65 A;  5D59 A;  4NKQ C;  2LMS A;  2O26 A;  4DKD A;  5IYC D;  4IKX A;  4PS4 A;  5FHX A;  4IKZ A;  3I4M D;  4Q65 A;  4I77 Z;  3VA2 A;  1J7V L;  3HHC A;  3D48 P;  1Y6K L;  3Q1S I;  4XNJ A;  3S9D A;  3D85 C;  4A3G D;  4XNI A;  3HOZ D;  4IU9 A;  1HIK A;  4PYP A;  3DLQ I;  1Y1V D;  2CYK A;  5A2N A;  4A3D D;  3UX9 A;  2ERJ D;  2CFQ A;  4GBY A;  4IKV A;  1LQS L;  5E4E A;  3PO3 D;  1ITF A;  1CYL A;  2IL6 A;  1AX8 A;  1EVS A;  4ZWB A;  1BP3 A;  4A3E D;  5EQG A;  4A93 D;  4BBS D;  3LB6 B;  4TPG A;  4U4V A;  3QAZ A;  4EXN A;  4ZW9 A;  2Z3R A;  3PO2 D;  4LRL A;  4GRW A;  3NCE A;  4RS1 A;  1BUY A;  5D58 A;  4MHL A;  2JA8 D;  3FKI D;  2O27 A;  2KZ1 A;  4U4W A;  1BCN A;  1YKB A;  1V7M V;  2JA7 D;  1GA3 A;  1LKI A;  1EER A;  3DUH C;  1WU3 I;  5D6K A;  2B8Z A;  4YUE C;  1IK0 A;  3D87 A;  2XUT A;  1QVN A;  4CNI C;  5IYB D;  1HGU A;  1BGD A;  2R7Z D;  5C4X D;  3HOX D;  4WRL B;  3H3V E;  1PV6 A;  1M4B A;  3BES L;  1A22 A;  1EMR A;  3G6D A;  4NI9 A;  3DI2 A;  3O7P A;  1D9G A;  1ITL A;  4IKY A;  4APS A;  2Z3Q A;  1PY2 A;  3L5W I;  3LB6 A;  4A3I D;  3DI3 A;  3WDO A;  5D71 A;  2L3O A;  3H0G D;  1IAR A;  4LEP A;  2B8X A;  2B5I A;  4NN5 A;  4D2C A;  1SCF A;  4YQX A;  3INK C;  5IYD D;  2CFP A;  4EXP A;  1PV7 A;  1EXZ A;  1ITM A;  4DKC A;  2Q98 A;  4JR9 A;  1FG9 A;  3OG4 A;  4A3B D;  4J05 A;  1CSG A;  5KNH I;  4GC0 A;  1JLI A;  3HOY D;  1CN4 C;  4OH3 A;  2V8N A;  1PVH B;  1RFB A;  1M49 A;  5D28 B;  1ITI A;  3SE3 B;  1IJZ A;  1EKU A;  4NEM A;  1PW4 A;  3HOW D;  1Z7C A;  4O6K A;  5D72 A;  1A7M A;  2C35 A;  4DKE A;  5GXB A;  3QT2 C;  3N0P A;  4BBR D;  5C44 D;  3NCC A;  4W6V A;  2R93 D;  2L3Y A;  2B91 A;  3PIW A;  3BPL A;  4TPH A;  5IP9 D;  1F6F A;  2HYM B;  1LK3 A;  2PSM A;  3SE4 B;  4BY1 D;  1RHG A;  2B8U A;  1HZI A;  1HIJ A;  4YBQ A;  4ZWC A;  4X51 A;  2LAG A;  1I1R B;  3HOV D;  4NN7 A;  3TGX B;  4D2B A;  1BBN A;  5IP7 D;  1ALU A;  1M47 A;  2Y5Y A;  5D70 A;  5EQH A;  4J4L C;  4A3K D;  1BGE A;  1N1F A;  1ETE A;  1INR A;  4A3C D;  1P9M B;  3BPN A;  2D9Q A;  1FYH A;  2H24 A;  1IL6 A;  2Q14 A;  3EJJ A;  5LQB A;  4JRE A;  1RW5 A;  2O6I A;  3NCF A;  5D22 A;  2B8Y A;  1HWH A;  1M48 A;  1PGR A;  1B5L A;  3DGC L;  2GMF A;  2INT A;  5C3E D;  2Q7N B;  4YB9 D;  1M4R A;  4O9H A;  3EW3 A;  4DKF A;  3L5X A;  1KF9 A;  1HUL A;  1M4A A;  3G9V B;  3QB1 A;  4U4T A;  1Y6N L;  4A3J D;  1WCM D;  4ZS7 A;  4NI7 A; 
#chains in the Genus database with same CATH homology
 1V7N V;  1AXI A;  1WU3 I;  2B8Z A;  4YUE C;  4DKE A;  3D87 A;  1IK0 A;  4A3F D;  2XQB A;  3QT2 C;  1QVN A;  3N0P A;  4BBR D;  4CNI C;  4DOH A;  5IYB D;  3NCC A;  1HGU A;  5C44 D;  1Y6M L;  1BGD A;  2R93 D;  4NEJ A;  4YDY I;  3HOX D;  2R7Z D;  5C4X D;  2L3Y A;  2B91 A;  3PIW A;  4WRL B;  3BPL A;  1NBP A;  5FUC A;  3H3V E;  3UF2 A;  5TS9 A;  5L6Y C;  4NKQ C;  1M4B A;  2LMS A;  2O26 A;  3HHR A;  3BES L;  1AU1 A;  5IP9 D;  4DKD A;  1A22 A;  5IYC D;  1F6F A;  1EMR A;  3IRH A;  4PS4 A;  5FHX A;  3I4M D;  3G6D A;  4NI9 A;  3DI2 A;  1D9G A;  1ITL A;  2HYM B;  4BXX D;  1LK3 A;  4I77 Z;  3VA2 A;  1J7V L;  4ZF7 A;  1Z92 A;  3HHC A;  2Z3Q A;  5C7X A;  2PSM A;  3BPO A;  3D48 P;  3MZG A;  1Y6K L;  1CD9 A;  1PY2 A;  3SE4 B;  3L5W I;  3LB6 A;  1RHG A;  4A3I D;  4BY1 D;  3HOU D;  3Q1S I;  2B8U A;  3DI3 A;  2JA5 D;  1HZI A;  5D71 A;  1HIJ A;  2L3O A;  3H0G D;  3S9D A;  3D85 C;  1F45 B;  1IAR A;  1ILK A;  4X51 A;  2B8X A;  2B5I A;  3NPZ A;  1Y14 A;  4NN5 A;  4A3G D;  2LAG A;  1I1R B;  2E9W C;  3HOV D;  3NCB A;  4NN6 A;  4A3L D;  4NN7 A;  3HOZ D;  3PIV A;  1SCF A;  4YQX A;  3B5K A;  3TGX B;  3INK C;  5IYD D;  1BBN A;  3N06 A;  2VUM D;  1M4C A;  5IP7 D;  1ALU A;  1M47 A;  1HIK A;  1PW6 A;  5D70 A;  3DLQ I;  1Y1V D;  2CYK A;  4EXP A;  4J4L C;  1VLK A;  4A3K D;  1BGE A;  1EXZ A;  1GNC A;  2ILK A;  1ITM A;  3UX9 A;  4DKC A;  4A3D D;  1HWG A;  2Q98 A;  3WCY I;  3QWR B;  2JA6 D;  2ERJ D;  1FG9 A;  1N1F A;  1ETE A;  1INR A;  1LQS L;  2R92 D;  5E4E A;  1Y1W D;  3PO3 D;  3OG4 A;  4A3B D;  4A3C D;  1ITF A;  1CYL A;  1CSG A;  5KNH I;  1P9M B;  2IL6 A;  1AX8 A;  2B90 A;  1RCB A;  1JLI A;  3HOY D;  1EVS A;  3BPN A;  2D9Q A;  1BGC A;  1CN4 C;  1FYH A;  2H24 A;  1IL6 A;  1PVH B;  1BP3 A;  1RFB A;  1M49 A;  2Q14 A;  4A3E D;  3EJJ A;  5LQB A;  1RW5 A;  2O6I A;  4BBS D;  4A93 D;  3NCF A;  3LB6 B;  1HUW A;  5D28 B;  3HMX B;  1IRL A;  3QAZ A;  4GS7 A;  5D22 A;  4EXN A;  2B8Y A;  1ITI A;  1HWH A;  1M48 A;  1PGR A;  2Z3R A;  4LRL A;  3SE3 B;  3UF5 A;  3I4N D;  4GRW A;  3PO2 D;  1B5L A;  3NCE A;  4RS1 A;  1BUY A;  1IJZ A;  3DGC L;  3QB7 A;  2GMF A;  2INT A;  5C3E D;  4MHL A;  2Q7N B;  2JA8 D;  1EKU A;  3FKI D;  2O27 A;  3OQ3 A;  1D9C A;  4NEM A;  1M4R A;  2D48 A;  4YPG C;  4O9H A;  3HOW D;  1Z7C A;  3AYH A;  3EW3 A;  2KZ1 A;  3L5X A;  4DKF A;  4FA8 E;  4O6K A;  1KF9 A;  1CNT 1;  1HUL A;  2OQP A;  1YKB A;  1M4A A;  3G9V B;  1V7M V;  3QB1 A;  1Y6N L;  5D72 A;  4A3J D;  1BCN A;  1A7M A;  4Z5R D;  2JA7 D;  2B63 D;  1WCM D;  2C35 A;  1GA3 A;  3UEZ E;  4ZS7 A;  4A3M D;  1LKI A;  1EER A;  3OG6 A;  4NI7 A;  5FLM D;  3DUH C;  4BY7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...